BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037C11

Length=669
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...    229   3e-68   
ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like          226   3e-67   Nicotiana tomentosiformis
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like          224   7e-67   Solanum tuberosum [potatoes]
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like          225   9e-67   Nicotiana sylvestris
ref|XP_010100678.1|  hypothetical protein L484_023447                   223   1e-65   Morus notabilis
gb|KJB24531.1|  hypothetical protein B456_004G149500                    219   9e-65   Gossypium raimondii
ref|XP_002529965.1|  DNA binding protein, putative                      219   1e-64   Ricinus communis
gb|KJB41602.1|  hypothetical protein B456_007G111800                    216   2e-63   Gossypium raimondii
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2               214   1e-62   
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like          212   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_002301432.1|  basic helix-loop-helix family protein              212   7e-62   Populus trichocarpa [western balsam poplar]
gb|ABK94979.1|  unknown                                                 211   1e-61   Populus trichocarpa [western balsam poplar]
gb|KJB09595.1|  hypothetical protein B456_001G151700                    211   3e-61   Gossypium raimondii
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like          210   4e-61   Vitis vinifera
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...    209   9e-61   
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like          209   1e-60   Populus euphratica
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2               208   2e-60   Sesamum indicum [beniseed]
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like          207   3e-60   Solanum lycopersicum
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2    208   3e-60   Populus euphratica
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1    208   4e-60   Populus euphratica
gb|KJB49615.1|  hypothetical protein B456_008G128800                    203   1e-58   Gossypium raimondii
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like          199   2e-57   Solanum tuberosum [potatoes]
emb|CBI38690.3|  unnamed protein product                                196   4e-57   Vitis vinifera
ref|XP_008233076.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    197   2e-56   Prunus mume [ume]
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                   198   3e-56   Citrus sinensis [apfelsine]
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg             197   3e-56   Citrus clementina [clementine]
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg             197   4e-56   Prunus persica
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2               197   4e-56   Fragaria vesca subsp. vesca
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2               195   7e-56   Nicotiana sylvestris
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...    193   4e-55   Solanum lycopersicum
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...    193   4e-55   Solanum lycopersicum
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like        194   5e-55   
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2               187   3e-52   Eucalyptus grandis [rose gum]
ref|XP_002320222.1|  basic helix-loop-helix family protein              184   6e-52   
gb|KDP28433.1|  hypothetical protein JCGZ_14204                         185   1e-51   Jatropha curcas
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                     183   8e-51   Eucalyptus grandis [rose gum]
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like          182   1e-50   Eucalyptus grandis [rose gum]
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2               181   4e-50   Nelumbo nucifera [Indian lotus]
gb|KJB52372.1|  hypothetical protein B456_008G259000                    171   2e-46   Gossypium raimondii
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...    168   2e-45   Medicago truncatula
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like          164   9e-44   Sesamum indicum [beniseed]
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...    163   2e-43   
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                   163   3e-43   Citrus sinensis [apfelsine]
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like          163   3e-43   Citrus sinensis [apfelsine]
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg             161   1e-42   
gb|ACF19982.1|  MYC2                                                    159   5e-42   Hevea brasiliensis [jebe]
gb|ADK91082.1|  LMYC2                                                   158   1e-41   Hevea brasiliensis [jebe]
gb|AEG74013.1|  lMYC3                                                   158   1e-41   Hevea brasiliensis [jebe]
gb|AEG74014.1|  lMYC4                                                   157   2e-41   Hevea brasiliensis [jebe]
ref|XP_002518914.1|  DNA binding protein, putative                      157   3e-41   Ricinus communis
gb|ADK56287.1|  LMYC1                                                   156   6e-41   Hevea brasiliensis [jebe]
gb|KJB25303.1|  hypothetical protein B456_004G184800                    156   2e-40   Gossypium raimondii
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like        154   3e-40   Solanum lycopersicum
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...    155   4e-40   
gb|KJB24138.1|  hypothetical protein B456_004G129600                    154   4e-40   Gossypium raimondii
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg             153   5e-40   
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like          153   7e-40   Populus euphratica
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...    153   7e-40   
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...    153   7e-40   Prunus mume [ume]
ref|XP_010100202.1|  hypothetical protein L484_015347                   153   9e-40   Morus notabilis
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like          154   1e-39   Populus euphratica
gb|ACO53628.1|  bHLH domain protein                                     154   1e-39   Gossypium hirsutum [American cotton]
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like          153   2e-39   
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g             152   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010104300.1|  hypothetical protein L484_023250                   154   2e-39   Morus notabilis
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like          152   3e-39   Nelumbo nucifera [Indian lotus]
gb|ACF05947.1|  MYC1                                                    151   3e-39   Hevea brasiliensis [jebe]
ref|XP_006368399.1|  phaseolin G-box binding protein PG2                152   4e-39   
ref|XP_006385657.1|  phaseolin G-box binding protein PG2                152   4e-39   
gb|KJB37703.1|  hypothetical protein B456_006G216700                    152   5e-39   Gossypium raimondii
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like          152   5e-39   Nelumbo nucifera [Indian lotus]
gb|KDP25207.1|  hypothetical protein JCGZ_20363                         150   9e-39   Jatropha curcas
ref|XP_006830285.1|  hypothetical protein AMTR_s00121p00026620          150   1e-38   Amborella trichopoda
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like          150   1e-38   Glycine max [soybeans]
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like          150   1e-38   Glycine max [soybeans]
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like          150   1e-38   Cucumis sativus [cucumbers]
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2               150   2e-38   Glycine max [soybeans]
emb|CDP08631.1|  unnamed protein product                                149   2e-38   Coffea canephora [robusta coffee]
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like          150   2e-38   Populus euphratica
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like          150   2e-38   Cucumis melo [Oriental melon]
ref|XP_002519814.1|  Transcription factor AtMYC2, putative              150   3e-38   Ricinus communis
ref|XP_004148475.1|  PREDICTED: transcription factor MYC2-like          149   5e-38   
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like          149   5e-38   
ref|XP_004166734.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    149   5e-38   
gb|KGN60384.1|  Transcription factor AtMYC2                             149   6e-38   Cucumis sativus [cucumbers]
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22          149   6e-38   Lotus japonicus
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like          147   7e-38   Solanum tuberosum [potatoes]
gb|ABR16623.1|  unknown                                                 148   7e-38   Picea sitchensis
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2               149   1e-37   Prunus mume [ume]
ref|XP_008803328.1|  PREDICTED: transcription factor MYC3-like          146   1e-37   Phoenix dactylifera
gb|AGL98101.1|  transcription factor MYC2-like protein                  148   1e-37   Nicotiana attenuata
ref|XP_006601141.1|  PREDICTED: transcription factor MYC2-like          143   1e-37   Glycine max [soybeans]
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like          145   2e-37   Nicotiana sylvestris
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g             147   2e-37   Phaseolus vulgaris [French bean]
gb|KJB21076.1|  hypothetical protein B456_003G182100                    147   2e-37   Gossypium raimondii
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like          147   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACM48567.1|  JAMYC                                                   147   2e-37   Taxus cuspidata [ichii]
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like          145   3e-37   Nicotiana tomentosiformis
gb|KJB51639.1|  hypothetical protein B456_008G226300                    147   3e-37   Gossypium raimondii
emb|CDX78808.1|  BnaA01g08750D                                          146   3e-37   
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...    145   4e-37   Nicotiana tomentosiformis
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like          145   4e-37   Populus euphratica
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like          147   4e-37   Cucumis melo [Oriental melon]
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg             147   4e-37   Citrus clementina [clementine]
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                   147   4e-37   Citrus sinensis [apfelsine]
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg             145   6e-37   
gb|ADH04268.1|  MYC1b transcription factor                              146   7e-37   Nicotiana tabacum [American tobacco]
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like          146   7e-37   Nicotiana sylvestris
ref|XP_003612908.1|  Transcription factor MYC2                          140   7e-37   Medicago truncatula
gb|ADH04267.1|  MYC1a transcription factor                              146   7e-37   Nicotiana tabacum [American tobacco]
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2               146   7e-37   
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like          146   7e-37   Nicotiana tomentosiformis
ref|NP_193522.1|  transcription factor MYC4                             145   7e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4           145   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like          146   7e-37   Phoenix dactylifera
ref|XP_010058366.1|  PREDICTED: transcription factor MYC4-like          144   8e-37   Eucalyptus grandis [rose gum]
gb|KEH27718.1|  basic helix loop helix (BHLH) family transcriptio...    140   8e-37   Medicago truncatula
gb|ADH04262.1|  bHLH1 transcription factor                              146   9e-37   Nicotiana benthamiana
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like        144   9e-37   Cicer arietinum [garbanzo]
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like        144   1e-36   Prunus mume [ume]
gb|KDP34321.1|  hypothetical protein JCGZ_12669                         145   1e-36   Jatropha curcas
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g             144   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg             145   1e-36   Capsella rubella
ref|XP_003612909.1|  BHLH transcription factor                          145   2e-36   Medicago truncatula
emb|CDY44507.1|  BnaC01g10420D                                          144   2e-36   Brassica napus [oilseed rape]
ref|XP_009139989.1|  PREDICTED: transcription factor MYC4-like          140   3e-36   
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14             142   3e-36   Tarenaya hassleriana [spider flower]
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...    144   3e-36   Brassica oleracea
gb|KHN15898.1|  Transcription factor bHLH14                             142   4e-36   Glycine soja [wild soybean]
ref|XP_007210224.1|  hypothetical protein PRUPE_ppa015634mg             142   4e-36   
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2               144   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU18071.1|  unknown                                                 138   5e-36   Glycine max [soybeans]
ref|XP_002868032.1|  basic helix-loop-helix family protein              143   5e-36   
emb|CDP13028.1|  unnamed protein product                                144   7e-36   Coffea canephora [robusta coffee]
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...    142   7e-36   Medicago truncatula
gb|ADH04263.1|  bHLH2 transcription factor                              143   7e-36   Nicotiana benthamiana
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like          144   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010463090.1|  PREDICTED: transcription factor MYC2-like          142   8e-36   
gb|AAB00686.1|  phaseolin G-box binding protein PG1                     143   8e-36   Phaseolus vulgaris [French bean]
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like          143   9e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like          142   9e-36   Glycine max [soybeans]
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like          143   1e-35   Fragaria vesca subsp. vesca
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like          142   1e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like          141   1e-35   
gb|AEG74015.1|  lMYC5                                                   141   1e-35   Hevea brasiliensis [jebe]
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2               142   1e-35   Brassica rapa
gb|AIT39751.1|  transcription factor MYC2                               142   1e-35   Chrysanthemum boreale
emb|CDP12229.1|  unnamed protein product                                140   2e-35   Coffea canephora [robusta coffee]
gb|AGL98100.1|  transcription factor MYC2                               141   3e-35   Nicotiana attenuata
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like          141   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_002893732.1|  ATMYC2                                             141   3e-35   Arabidopsis lyrata subsp. lyrata
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like        140   3e-35   Nicotiana tomentosiformis
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4               140   3e-35   Vitis vinifera
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    141   3e-35   
gb|AAQ14332.1|AF283507_1  MYC2                                          142   4e-35   Catharanthus roseus [chatas]
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like          140   4e-35   Pyrus x bretschneideri [bai li]
ref|NP_001288107.1|  uncharacterized protein LOC101261048               141   4e-35   Solanum lycopersicum
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like          141   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...    140   4e-35   Tarenaya hassleriana [spider flower]
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg             140   4e-35   Capsella rubella
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like          139   4e-35   Elaeis guineensis
gb|ABS11038.1|  MYC                                                     140   5e-35   Brassica oleracea var. gemmifera
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like          139   6e-35   
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like          140   6e-35   Cicer arietinum [garbanzo]
ref|XP_001754025.1|  predicted protein                                  140   6e-35   
gb|ADL36595.1|  BHLH domain class transcription factor                  140   8e-35   Malus domestica [apple tree]
ref|XP_010058370.1|  PREDICTED: transcription factor MYC2-like          139   8e-35   Eucalyptus grandis [rose gum]
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2               140   8e-35   
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like          139   1e-34   Prunus mume [ume]
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like          139   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g             140   1e-34   Phaseolus vulgaris [French bean]
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like          140   1e-34   Sesamum indicum [beniseed]
emb|CAF74711.1|  MYC transcription factor                               139   1e-34   Solanum tuberosum [potatoes]
ref|NP_174541.1|  transcription factor MYC2                             139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like          139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg             139   2e-34   Eutrema salsugineum [saltwater cress]
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6           139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like          139   2e-34   Elaeis guineensis
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like          139   2e-34   Tarenaya hassleriana [spider flower]
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like          139   2e-34   Nicotiana tomentosiformis
dbj|BAA25078.1|  RD22BP1                                                139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like          138   2e-34   
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like          139   3e-34   Nicotiana sylvestris
gb|ADH04269.1|  MYC2a transcription factor                              139   3e-34   Nicotiana tabacum [American tobacco]
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4               138   4e-34   Tarenaya hassleriana [spider flower]
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like          137   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like          139   5e-34   Glycine max [soybeans]
dbj|BAJ33793.1|  unnamed protein product                                137   5e-34   Eutrema halophilum
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like          137   5e-34   
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like          138   5e-34   Solanum tuberosum [potatoes]
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like          136   6e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like          136   9e-34   Pyrus x bretschneideri [bai li]
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg             137   9e-34   
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like          136   1e-33   
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4               137   1e-33   Phoenix dactylifera
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like          135   1e-33   Nicotiana sylvestris
emb|CAF74710.1|  MYC transcription factor                               137   1e-33   Solanum tuberosum [potatoes]
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like          136   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like          137   2e-33   Elaeis guineensis
ref|XP_001765254.1|  predicted protein                                  138   2e-33   
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like          137   2e-33   Solanum tuberosum [potatoes]
gb|AGZ94899.1|  MYC transcription factor 2                              137   2e-33   Solanum lycopersicum
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2               137   2e-33   
ref|XP_008780029.1|  PREDICTED: transcription factor MYC4-like          134   2e-33   
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg             135   2e-33   
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3             135   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5           135   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...    135   3e-33   Prunus mume [ume]
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...    135   3e-33   Prunus mume [ume]
ref|XP_010058369.1|  PREDICTED: transcription factor MYC2-like          134   3e-33   Eucalyptus grandis [rose gum]
ref|XP_009776798.1|  PREDICTED: transcription factor MYC2-like          131   3e-33   Nicotiana sylvestris
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g             134   3e-33   Phaseolus vulgaris [French bean]
ref|XP_006838603.1|  hypothetical protein AMTR_s00002p00225810          136   3e-33   Amborella trichopoda
gb|KCW72573.1|  hypothetical protein EUGRSUZ_E01042                     134   4e-33   Eucalyptus grandis [rose gum]
ref|XP_009396848.1|  PREDICTED: transcription factor MYC4-like          136   5e-33   
gb|AIO09733.1|  transcription factor MYC2                               135   5e-33   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like          134   5e-33   
emb|CDY03195.1|  BnaC09g19610D                                          134   5e-33   
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                    135   6e-33   Arabis alpina [alpine rockcress]
ref|XP_010058361.1|  PREDICTED: transcription factor MYC2-like          134   6e-33   Eucalyptus grandis [rose gum]
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like          135   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140617.1|  PREDICTED: transcription factor ATR2-like          133   7e-33   Cucumis sativus [cucumbers]
emb|CDY35179.1|  BnaA09g18160D                                          134   7e-33   Brassica napus [oilseed rape]
ref|XP_010058362.1|  PREDICTED: transcription factor MYC2-like          134   7e-33   
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like          134   7e-33   Brassica rapa
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3               134   8e-33   Brassica rapa
ref|XP_010058368.1|  PREDICTED: transcription factor MYC2-like          133   8e-33   Eucalyptus grandis [rose gum]
ref|XP_008342536.1|  PREDICTED: transcription factor MYC2-like          133   1e-32   
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like          134   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...    133   1e-32   Prunus mume [ume]
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...    133   1e-32   Prunus mume [ume]
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like          134   1e-32   
ref|XP_010940945.1|  PREDICTED: transcription factor MYC4-like          132   1e-32   Elaeis guineensis
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like          134   1e-32   Elaeis guineensis
ref|XP_010910582.1|  PREDICTED: transcription factor MYC4-like          132   1e-32   Elaeis guineensis
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like          134   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like          132   2e-32   
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like          132   2e-32   Nicotiana sylvestris
ref|XP_004166899.1|  PREDICTED: transcription factor ATR2-like          132   2e-32   
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like          134   2e-32   Elaeis guineensis
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like          132   2e-32   Pyrus x bretschneideri [bai li]
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg             132   3e-32   
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                    132   3e-32   Arabis alpina [alpine rockcress]
gb|KDP22548.1|  hypothetical protein JCGZ_26379                         131   4e-32   Jatropha curcas
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like          131   4e-32   Prunus mume [ume]
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like          132   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3               132   5e-32   Camelina sativa [gold-of-pleasure]
ref|XP_008350027.1|  PREDICTED: transcription factor MYC2-like          131   5e-32   
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg             131   5e-32   
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg             132   5e-32   Capsella rubella
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg             131   6e-32   Prunus persica
gb|AHN63211.1|  transcription factor MYC2                               131   1e-31   Salvia miltiorrhiza f. alba
gb|EPS57820.1|  hypothetical protein M569_16997                         130   1e-31   Genlisea aurea
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...    129   2e-31   
ref|XP_008385247.1|  PREDICTED: transcription factor MYC3-like          129   2e-31   Malus domestica [apple tree]
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...    129   2e-31   Malus domestica [apple tree]
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...    130   3e-31   Medicago truncatula
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like          129   3e-31   Malus domestica [apple tree]
ref|XP_003628820.1|  Transcription factor MYC2                          130   3e-31   
ref|XP_008385225.1|  PREDICTED: transcription factor MYC2-like          129   3e-31   Malus domestica [apple tree]
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg             130   4e-31   
ref|XP_009354516.1|  PREDICTED: transcription factor MYC3-like          128   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_008810069.1|  PREDICTED: transcription factor MYC4-like          127   7e-31   Phoenix dactylifera
ref|XP_006662628.1|  PREDICTED: transcription factor MYC2-like          127   9e-31   
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752             129   9e-31   Arabidopsis lyrata subsp. lyrata
dbj|BAJ91022.1|  predicted protein                                      129   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011468569.1|  PREDICTED: transcription factor MYC2-like          124   1e-30   Fragaria vesca subsp. vesca
ref|XP_009370919.1|  PREDICTED: transcription factor MYC2-like          127   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like          129   1e-30   Cicer arietinum [garbanzo]
gb|KHN47226.1|  Transcription factor bHLH14-like protein                126   1e-30   Glycine soja [wild soybean]
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like          126   1e-30   Glycine max [soybeans]
dbj|BAJ91674.1|  predicted protein                                      129   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    128   1e-30   
dbj|BAJ86015.1|  predicted protein                                      129   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009359542.1|  PREDICTED: transcription factor MYC2-like          127   1e-30   Pyrus x bretschneideri [bai li]
gb|AEJ88337.1|  putative MYC protein                                    127   1e-30   Tamarix hispida
gb|ABR16436.1|  unknown                                                 128   1e-30   Picea sitchensis
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like          126   1e-30   Solanum lycopersicum
ref|XP_010053608.1|  PREDICTED: transcription factor MYC2-like          128   2e-30   Eucalyptus grandis [rose gum]
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                    127   2e-30   
gb|AGQ80897.1|  MYC1                                                    127   3e-30   
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like          128   3e-30   
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4               128   3e-30   
gb|AAD15818.1|  transcription factor MYC7E                              128   3e-30   
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like          127   7e-30   
gb|KCW72577.1|  hypothetical protein EUGRSUZ_E01046                     124   7e-30   
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g             125   8e-30   
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230          126   1e-29   
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg             125   2e-29   
ref|XP_002987548.1|  hypothetical protein SELMODRAFT_158887             119   3e-29   
gb|KFK30669.1|  hypothetical protein AALP_AA6G012400                    122   4e-29   
gb|EPS60924.1|  hypothetical protein M569_13876                         122   8e-29   
emb|CDY58502.1|  BnaA06g40330D                                          122   9e-29   
emb|CDX77688.1|  BnaC07g19420D                                          122   1e-28   
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like          122   1e-28   
ref|XP_006361064.1|  PREDICTED: transcription factor MYC4-like          117   1e-28   
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like          120   2e-28   
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like          120   3e-28   
gb|EEE51454.1|  hypothetical protein OsJ_32566                          122   3e-28   
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like          120   3e-28   
gb|AAK00453.1|AC060755_23  putative MYC transcription factor            122   4e-28   
ref|NP_001065478.1|  Os10g0575000                                       122   4e-28   
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like          119   5e-28   
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like          122   6e-28   
ref|XP_008358724.1|  PREDICTED: transcription factor MYC3-like          119   7e-28   
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like          121   8e-28   
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like          119   9e-28   
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like        118   1e-27   
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like          117   3e-27   
ref|XP_001765161.1|  predicted protein                                  119   6e-27   
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein     119   7e-27   
ref|XP_007161222.1|  hypothetical protein PHAVU_001G052200g             114   9e-27   
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg                116   9e-27   
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2               118   1e-26   
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                     118   1e-26   
ref|XP_010507550.1|  PREDICTED: transcription factor MYC2-like          115   1e-26   
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like          115   1e-26   
ref|XP_010513049.1|  PREDICTED: transcription factor MYC2-like          115   2e-26   
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like          115   2e-26   
emb|CDX77694.1|  BnaC07g19480D                                          113   2e-26   
ref|XP_010494874.1|  PREDICTED: transcription factor bHLH28-like        115   2e-26   
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg             115   2e-26   
ref|XP_008386326.1|  PREDICTED: transcription factor MYC3-like          115   3e-26   
emb|CDY59973.1|  BnaA09g53560D                                          115   4e-26   
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like        113   6e-26   
ref|XP_009627739.1|  PREDICTED: transcription factor bHLH13-like        115   7e-26   
ref|XP_009101673.1|  PREDICTED: transcription factor bHLH28-like        113   8e-26   
ref|XP_009770264.1|  PREDICTED: transcription factor bHLH13-like        115   8e-26   
gb|KCW72574.1|  hypothetical protein EUGRSUZ_E01043                     113   1e-25   
gb|KFK31426.1|  hypothetical protein AALP_AA6G110400                    113   1e-25   
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like        113   2e-25   
ref|XP_009781532.1|  PREDICTED: transcription factor bHLH13-like        114   2e-25   
emb|CDY03183.1|  BnaC09g19730D                                          112   2e-25   
gb|ABD59338.1|  G-box element binding protein                           114   3e-25   
emb|CDX73261.1|  BnaC05g28450D                                          111   3e-25   
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like        112   4e-25   
emb|CDY35183.1|  BnaA09g18200D                                          112   4e-25   
emb|CDY26910.1|  BnaA05g18020D                                          111   4e-25   
ref|XP_004159750.1|  PREDICTED: transcription factor MYC4-like          111   5e-25   
gb|ABV79897.1|  Myc2 bHLH splice variant                                108   5e-25   
gb|KGN55667.1|  hypothetical protein Csa_3G002860                       111   5e-25   
ref|XP_004146202.1|  PREDICTED: transcription factor MYC4-like          111   5e-25   
emb|CDY03185.1|  BnaC09g19710D                                          111   5e-25   
ref|XP_010242395.1|  PREDICTED: transcription factor bHLH13-like        112   6e-25   
ref|XP_006339721.1|  PREDICTED: transcription factor bHLH13-like        112   9e-25   
emb|CBI40563.3|  unnamed protein product                                108   1e-24   
ref|NP_567195.1|  transcription factor bHLH14                           110   1e-24   
ref|NP_001267974.1|  Myc2 bHLH protein                                  110   4e-24   
ref|XP_006852614.1|  hypothetical protein AMTR_s00021p00226670          109   5e-24   
emb|CDP08667.1|  unnamed protein product                                109   8e-24   
emb|CDX84081.1|  BnaC08g07580D                                          108   8e-24   
ref|XP_011093027.1|  PREDICTED: transcription factor bHLH13-like ...    108   1e-23   
ref|XP_011093025.1|  PREDICTED: transcription factor bHLH13-like ...    109   1e-23   
ref|XP_004229991.1|  PREDICTED: transcription factor bHLH13-like        108   1e-23   
ref|XP_002872924.1|  predicted protein                                  107   1e-23   
ref|XP_002865159.1|  predicted protein                                  107   2e-23   
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg                108   2e-23   
ref|XP_010474717.1|  PREDICTED: transcription factor bHLH13-like        107   3e-23   
emb|CDY70012.1|  BnaCnng66310D                                          104   3e-23   
gb|KCW72571.1|  hypothetical protein EUGRSUZ_E01039                     106   4e-23   
ref|XP_011093944.1|  PREDICTED: transcription factor bHLH13-like        107   4e-23   
ref|XP_006345551.1|  PREDICTED: transcription factor bHLH13-like        107   6e-23   
ref|XP_008233131.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    107   6e-23   
ref|XP_010256776.1|  PREDICTED: transcription factor bHLH13             107   7e-23   
ref|XP_006836904.1|  hypothetical protein AMTR_s00099p00127980          106   7e-23   
ref|XP_010480459.1|  PREDICTED: transcription factor bHLH13-like        106   7e-23   
ref|XP_010321507.1|  PREDICTED: transcription factor bHLH13-like        106   8e-23   
ref|XP_002892077.1|  basic helix-loop-helix family protein              106   9e-23   
ref|XP_008392629.1|  PREDICTED: transcription factor MYC2-like          103   9e-23   
gb|AIU98517.1|  bHLH transcription factor                               106   1e-22   
ref|XP_009608279.1|  PREDICTED: transcription factor bHLH13-like        106   1e-22   
gb|AAC28907.1|  phaseolin G-box binding protein PG2                     106   1e-22   
ref|NP_171634.1|  transcription factor bHLH13                           105   2e-22   
gb|AAM10932.1|AF488559_1  putative bHLH transcription factor            105   2e-22   
ref|XP_006444826.1|  hypothetical protein CICLE_v10019339mg             105   2e-22   
ref|XP_006491293.1|  PREDICTED: transcription factor bHLH13-like        105   2e-22   
ref|XP_010428091.1|  PREDICTED: transcription factor bHLH14-like        103   2e-22   
emb|CDX90021.1|  BnaA10g00610D                                          104   2e-22   
ref|XP_009119682.1|  PREDICTED: transcription factor bHLH13             105   2e-22   
ref|XP_006418406.1|  hypothetical protein EUTSA_v10007139mg             105   2e-22   
ref|XP_002320871.2|  hypothetical protein POPTR_0014s09520g             105   3e-22   
ref|XP_001752627.1|  predicted protein                                  106   3e-22   
ref|XP_011038317.1|  PREDICTED: transcription factor bHLH13-like        105   3e-22   
ref|XP_010457144.1|  PREDICTED: transcription factor bHLH13             104   4e-22   
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like          102   5e-22   
gb|KJB41555.1|  hypothetical protein B456_007G109300                    103   6e-22   
ref|XP_010556598.1|  PREDICTED: transcription factor bHLH13-like        103   1e-21   
ref|XP_011026186.1|  PREDICTED: basic helix-loop-helix protein A-...    103   1e-21   
ref|XP_006287856.1|  hypothetical protein CARUB_v10001082mg             101   1e-21   
ref|XP_010522910.1|  PREDICTED: transcription factor bHLH13-like        102   2e-21   
gb|EYU38884.1|  hypothetical protein MIMGU_mgv1a003886mg                102   2e-21   
ref|XP_010422737.1|  PREDICTED: transcription factor bHLH14-like        101   2e-21   
ref|XP_006307052.1|  hypothetical protein CARUB_v10008640mg             102   2e-21   
ref|XP_002302118.1|  hypothetical protein POPTR_0002s05510g             102   3e-21   
ref|XP_007220204.1|  hypothetical protein PRUPE_ppa002985mg             102   3e-21   
ref|XP_007051527.1|  Myc2 bHLH protein isoform 1                        102   3e-21   
gb|EYU32259.1|  hypothetical protein MIMGU_mgv1a021930mg                100   5e-21   
gb|EYU40715.1|  hypothetical protein MIMGU_mgv1a020739mg                100   5e-21   
ref|XP_004306657.1|  PREDICTED: transcription factor bHLH13-like        101   6e-21   
gb|KDP28477.1|  hypothetical protein JCGZ_14248                         101   6e-21   
ref|XP_004494832.1|  PREDICTED: transcription factor bHLH13-like        100   7e-21   
gb|KHG04474.1|  Transcription factor bHLH13 -like protein               101   7e-21   
ref|XP_002302637.2|  basic helix-loop-helix family protein              100   7e-21   
ref|XP_006398377.1|  hypothetical protein EUTSA_v10000853mg             100   8e-21   
ref|XP_009392688.1|  PREDICTED: basic helix-loop-helix protein A-...    100   1e-20   
ref|XP_010456175.1|  PREDICTED: transcription factor bHLH14-like ...  99.0    1e-20   
ref|XP_011023168.1|  PREDICTED: transcription factor bHLH13-like        100   2e-20   
ref|XP_007162415.1|  hypothetical protein PHAVU_001G1503001g          97.1    2e-20   
ref|XP_007200710.1|  hypothetical protein PRUPE_ppa002884m1g          95.1    2e-20   
ref|XP_010696336.1|  PREDICTED: transcription factor bHLH13-like      99.4    3e-20   
sp|E3SXU5.1|BHLHM_PEA  RecName: Full=Truncated basic helix-loop-h...  96.7    4e-20   
ref|XP_010437974.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  97.8    5e-20   
ref|XP_009415334.1|  PREDICTED: transcription factor bHLH13-like      98.6    6e-20   
ref|XP_009405589.1|  PREDICTED: basic helix-loop-helix protein A-...  98.2    7e-20   
ref|XP_009405588.1|  PREDICTED: truncated basic helix-loop-helix ...  97.8    1e-19   
ref|XP_010055004.1|  PREDICTED: transcription factor bHLH13           97.8    1e-19   
ref|XP_008352118.1|  PREDICTED: transcription factor bHLH13-like      97.8    1e-19   
ref|XP_009405587.1|  PREDICTED: basic helix-loop-helix protein A-...  97.8    1e-19   
ref|XP_009336762.1|  PREDICTED: transcription factor bHLH13 isofo...  97.4    1e-19   
ref|XP_009336761.1|  PREDICTED: transcription factor bHLH13 isofo...  97.4    1e-19   
gb|EPS71023.1|  hypothetical protein M569_03732                       97.1    1e-19   
ref|NP_199495.1|  calcium-binding transcription factor NIG1           96.7    1e-19   
ref|XP_008790988.1|  PREDICTED: basic helix-loop-helix protein A ...  97.4    2e-19   
emb|CAC14865.1|  transparent testa 8                                  96.7    2e-19   
ref|NP_192720.2|  transcription factor TT8                            96.7    2e-19   
ref|XP_006383662.1|  hypothetical protein POPTR_0005s23010g           94.7    2e-19   
gb|ABK28624.1|  unknown                                               96.3    2e-19   
sp|E3SXU4.1|BHLHW_PEA  RecName: Full=Basic helix-loop-helix prote...  96.7    2e-19   
ref|XP_010455373.1|  PREDICTED: transcription factor TT8-like         95.9    3e-19   
gb|AEJ88335.1|  putative MYC protein                                  95.5    3e-19   
ref|XP_008376082.1|  PREDICTED: transcription factor bHLH13           96.3    4e-19   
emb|CBY88797.1|  basic helix-loop-helix transcription factor          96.3    5e-19   
gb|KDP21472.1|  hypothetical protein JCGZ_21943                       95.9    5e-19   
ref|XP_003548357.1|  PREDICTED: transcription factor bHLH13-like      95.9    5e-19   
gb|AIF70439.1|  basic helix-loop-helix transcription factor           95.1    5e-19   
ref|XP_010100724.1|  hypothetical protein L484_023493                 95.5    6e-19   
emb|CEL26634.1|  bHLH3                                                95.5    7e-19   
ref|XP_002523332.1|  DNA binding protein, putative                    95.5    7e-19   
gb|KGN56417.1|  hypothetical protein Csa_3G119500                     95.1    7e-19   
ref|XP_004133809.1|  PREDICTED: transcription factor bHLH13-like      95.1    8e-19   
ref|XP_006479738.1|  PREDICTED: transcription factor TT8-like iso...  95.5    8e-19   
dbj|BAH28881.1|  bHLH transcription factor LjTT8                      95.1    9e-19   
ref|XP_010421888.1|  PREDICTED: transcription factor TT8              94.4    1e-18   
ref|XP_006444091.1|  hypothetical protein CICLE_v10019118mg           95.1    1e-18   
ref|XP_006444093.1|  hypothetical protein CICLE_v10019118mg           95.1    1e-18   
gb|AIT76559.1|  bHLH protein                                          94.7    1e-18   
ref|XP_008437879.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  94.7    1e-18   
ref|XP_004172828.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  94.4    1e-18   
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g           94.4    2e-18   
ref|XP_009382358.1|  PREDICTED: transcription factor EGL1-like        94.4    2e-18   
gb|AIE57508.1|  bHLH3                                                 94.4    2e-18   
ref|XP_007161224.1|  hypothetical protein PHAVU_001G052400g           91.7    2e-18   
ref|XP_008790987.1|  PREDICTED: basic helix-loop-helix protein A ...  94.4    2e-18   
gb|AIU98516.1|  bHLH transcription factor                             94.0    2e-18   
ref|XP_010906882.1|  PREDICTED: basic helix-loop-helix protein A ...  94.0    2e-18   
gb|ABY26936.1|  putative anthocyanin transcriptional regulator        94.0    2e-18   
gb|AIS24255.1|  basic helix-loop-helix regulatory protein             94.0    2e-18   
gb|KFK32044.1|  hypothetical protein AALP_AA6G192900                  93.2    2e-18   
gb|AFL02464.1|  transcription factor bHLH3-delta                      91.3    3e-18   
ref|XP_010255921.1|  PREDICTED: basic helix-loop-helix protein A-...  93.6    3e-18   
gb|AGP03675.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...  93.2    3e-18   
ref|XP_010278097.1|  PREDICTED: basic helix-loop-helix protein A-...  93.6    3e-18   
gb|AEO53065.1|  transcription factor TT8                              90.9    3e-18   
ref|XP_011079838.1|  PREDICTED: truncated basic helix-loop-helix ...  93.2    4e-18   
ref|XP_002960995.1|  hypothetical protein SELMODRAFT_73360            91.3    5e-18   
ref|XP_003553791.1|  PREDICTED: transcription factor bHLH13-like      92.8    5e-18   
ref|XP_008235271.1|  PREDICTED: basic helix-loop-helix protein A      93.2    5e-18   
ref|XP_010544844.1|  PREDICTED: transcription factor ABA-INDUCIBL...  92.4    5e-18   
emb|CBI32369.3|  unnamed protein product                              92.8    5e-18   
ref|XP_006575075.1|  PREDICTED: transcription factor TT8-like iso...  90.5    5e-18   
gb|AIN41653.1|  TT8                                                   92.4    5e-18   
gb|KCW58860.1|  hypothetical protein EUGRSUZ_H01487                   92.8    6e-18   
gb|ABY59772.1|  bHLH DNA-binding domain transcription factor          92.0    6e-18   
ref|XP_002872462.1|  hypothetical protein ARALYDRAFT_489834           92.0    6e-18   
gb|AGP03687.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...  92.0    6e-18   
gb|AGP03676.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...  92.0    6e-18   
gb|AJB28481.1|  bHLH3                                                 92.8    6e-18   
ref|XP_010070223.1|  PREDICTED: basic helix-loop-helix protein A      92.8    6e-18   
ref|XP_011032731.1|  PREDICTED: basic helix-loop-helix protein A ...  92.8    6e-18   
emb|CBI34590.3|  unnamed protein product                              90.1    6e-18   
gb|AGP03673.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...  92.0    6e-18   
gb|AGP03684.1|  basic helix-loop-helix (bHLH) DNA-binding superfa...  92.0    6e-18   
ref|XP_011032729.1|  PREDICTED: basic helix-loop-helix protein A ...  92.8    7e-18   
gb|AJB28482.1|  bHLH3                                                 92.8    7e-18   
ref|XP_007050639.1|  BHLH-like DNA binding protein                    92.4    7e-18   
ref|XP_010924915.1|  PREDICTED: transcription factor bHLH13-like      92.4    7e-18   
tpg|DAA52716.1|  TPA: hypothetical protein ZEAMMB73_145518            92.4    7e-18   
ref|XP_002447817.1|  hypothetical protein SORBIDRAFT_06g016380        92.0    7e-18   
ref|XP_003520564.1|  PREDICTED: transcription factor TT8-like         92.0    8e-18   
gb|KJB25920.1|  hypothetical protein B456_004G215900                  92.4    8e-18   
gb|EAY93035.1|  hypothetical protein OsI_14836                        92.0    8e-18   
ref|NP_001268182.1|  uncharacterized protein LOC100251098             92.4    8e-18   
gb|AGO58372.1|  basic helix-loop-helix protein                        92.4    9e-18   
ref|XP_010918535.1|  PREDICTED: transcription factor GLABRA 3         92.0    9e-18   
ref|XP_002454874.1|  hypothetical protein SORBIDRAFT_03g000570        92.0    9e-18   
gb|KJB25919.1|  hypothetical protein B456_004G215900                  92.0    1e-17   
ref|XP_010559123.1|  PREDICTED: transcription factor ABA-INDUCIBL...  91.7    1e-17   
ref|XP_003520875.1|  PREDICTED: transcription factor bHLH13-like      91.7    1e-17   
ref|NP_001146245.1|  uncharacterized protein LOC100279818             91.7    1e-17   
ref|XP_004290663.1|  PREDICTED: basic helix-loop-helix protein A ...  92.0    1e-17   



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 146/197 (74%), Gaps = 12/197 (6%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+ +   +   STLQQRLQF++++Q D WAYAIFWQTSND+ GRLFL 
Sbjct  1    MEELIISPSSSSSLVSFSQETPPSTLQQRLQFVIQSQQDWWAYAIFWQTSNDEHGRLFLT  60

Query  280  WGDGFFQGTK---AGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE----NGD  438
            WGDG FQGTK      G  +  +   ++     ER+KV+ GIQALIG   + +    +G 
Sbjct  61   WGDGHFQGTKDTSPKLGANISNIPGLNN-----ERRKVMKGIQALIGDNHDIDMSMIDGT  115

Query  439  LITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQT  618
             ITDAEWFYVMSL RSFSAGDG+PGKA S GSLVWL+GAH LQ YNCERA+EAQ+H I+T
Sbjct  116  DITDAEWFYVMSLTRSFSAGDGIPGKALSTGSLVWLTGAHELQFYNCERAREAQMHAIET  175

Query  619  LVCIPTGAGVVELGSLE  669
            LVCIPT  GV+ELGS E
Sbjct  176  LVCIPTSCGVLELGSSE  192



>ref|XP_009604694.1| PREDICTED: transcription factor MYC3-like [Nicotiana tomentosiformis]
Length=489

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 128/171 (75%), Gaps = 16/171 (9%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            STLQQ LQ+ILK QTDSW+YAIFWQTSN+DDGRLFLAWGDG F GTK  +G      V  
Sbjct  29   STLQQMLQYILKNQTDSWSYAIFWQTSNEDDGRLFLAWGDGHFHGTKVKKGE-----VNG  83

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGD------LITDAEWFYVMSLARSFSAGDGVP  510
             +     ERK VI GIQALI      ENGD       +TD EWFYVMSLA+SFS GDG+P
Sbjct  84   VNKASSLERKNVIKGIQALI-----CENGDGVVEGGDVTDIEWFYVMSLAQSFSIGDGIP  138

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            GKAFS GS+VWL+GA +LQ  +CERAKEAQ+HGI+TLVCIPT  GV+ELGS
Sbjct  139  GKAFSTGSIVWLTGAQQLQFCSCERAKEAQVHGIETLVCIPTSNGVLELGS  189



>ref|XP_006362125.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=457

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 139/192 (72%), Gaps = 12/192 (6%)
 Frame = +1

Query  100  MDELIVTssssssitasls-QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLF  273
            MDELIV+SSS    +         S LQQ+LQ ILK QTDSW+YAIFWQTSNDDD G LF
Sbjct  1    MDELIVSSSSFFIPSLLSQGTQTSSNLQQKLQNILKIQTDSWSYAIFWQTSNDDDDGHLF  60

Query  274  LAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGST--QNSENGDLIT  447
            LAWGDG F GTK+  G      VQ S   Q +ERK VI GIQALI     +  ++   +T
Sbjct  61   LAWGDGHFHGTKSKTG------VQASQ--QSTERKNVIKGIQALICENGEEKVDDAGEVT  112

Query  448  DAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVC  627
            DAEWFYVMSLA+SFS GDGVPGKAFS GS++WL+GA +LQ +NCERAKEA +HGIQT VC
Sbjct  113  DAEWFYVMSLAQSFSIGDGVPGKAFSTGSIIWLTGAQQLQFHNCERAKEAHVHGIQTFVC  172

Query  628  IPTGAGVVELGS  663
            IPT  GV+ELGS
Sbjct  173  IPTSNGVLELGS  184



>ref|XP_009776117.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=496

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 126/167 (75%), Gaps = 7/167 (4%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            STLQQ LQ +LK QTDSW+YAIFWQTSNDDDGRLFLAWGDG F GTK  +G      V  
Sbjct  29   STLQQMLQHVLKNQTDSWSYAIFWQTSNDDDGRLFLAWGDGHFHGTKVKKGE-----VNG  83

Query  349  SHSTQQSERKKVISGIQALIGSTQNS--ENGDLITDAEWFYVMSLARSFSAGDGVPGKAF  522
            ++     ERK VI GIQALI    +   E+G  +TD EWFYVMSLA+SFS GDG+PGKAF
Sbjct  84   ANKASSLERKNVIKGIQALICENGDGVVEDGGDVTDIEWFYVMSLAQSFSIGDGIPGKAF  143

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
              GS VWL+GA +LQ  +CERAKEAQ+HGI+TLVCIPT  GV+ELGS
Sbjct  144  CTGSFVWLNGAQQLQFCSCERAKEAQVHGIETLVCIPTSNGVLELGS  190



>ref|XP_010100678.1| hypothetical protein L484_023447 [Morus notabilis]
 gb|EXB83840.1| hypothetical protein L484_023447 [Morus notabilis]
Length=525

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 132/182 (73%), Gaps = 20/182 (11%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQRLQFI+K+Q D WAYAIFWQTSNDD+GRLFLAWGDG FQG K       P+   +S
Sbjct  26   TLQQRLQFIVKSQPDWWAYAIFWQTSNDDNGRLFLAWGDGHFQGVKDTIS---PINSNSS  82

Query  352  HSTQQ---------SERKKVISGIQALIGSTQNSE-------NGDLITDAEWFYVMSLAR  483
            ++            +ER+K++ GIQ+LI      +       NGD +TDAEWFYVMSL R
Sbjct  83   NNNNHYSAVSAGIHAERRKMLKGIQSLINDNNLPDIDNIMAINGD-VTDAEWFYVMSLTR  141

Query  484  SFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            SF AGDGVPGKAFS GSLVWL+G H LQ YNCERAKEAQ+HGI+TLVCIPT  GV+ELGS
Sbjct  142  SFLAGDGVPGKAFSTGSLVWLTGVHELQFYNCERAKEAQMHGIETLVCIPTSTGVLELGS  201

Query  664  LE  669
             E
Sbjct  202  SE  203



>gb|KJB24531.1| hypothetical protein B456_004G149500 [Gossypium raimondii]
Length=476

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 138/190 (73%), Gaps = 12/190 (6%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+ +   +   STLQQRLQ +L++Q D WAYAIFWQTSNDD GRL LA
Sbjct  1    MEELIISPSSSSSLVSFSHETPPSTLQQRLQHVLESQKDWWAYAIFWQTSNDDLGRLLLA  60

Query  280  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEW  459
            WGDG FQGT      G         +  Q ER+KV+ GIQALIG   + + G+    AEW
Sbjct  61   WGDGHFQGTNESSKPGA--------NHFQGERRKVMKGIQALIGDNHDIDMGE----AEW  108

Query  460  FYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            FY++SL R FSAGDG+PGK  + GSLVWL+GAH LQ YNCERAKEAQ+HGI+TLVCIPT 
Sbjct  109  FYMISLTRCFSAGDGIPGKCLTTGSLVWLTGAHELQFYNCERAKEAQLHGIETLVCIPTS  168

Query  640  AGVVELGSLE  669
             GV+ELGS E
Sbjct  169  CGVLELGSSE  178



>ref|XP_002529965.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF32408.1| DNA binding protein, putative [Ricinus communis]
Length=486

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 143/197 (73%), Gaps = 10/197 (5%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            MDELI++ SSSSS+ +   Q    TLQQRLQFIL++Q D WAYAIFWQT N D+GR+FLA
Sbjct  1    MDELIISPSSSSSLVSFS-QGTPPTLQQRLQFILQSQPDWWAYAIFWQTLNADNGRIFLA  59

Query  280  WGDGFFQGTKAGRGGGVPVVVQ--TSH--STQQSERKKVISGIQALIGSTQNS-----EN  432
            WGDG FQGT+        +  +   SH  S+  SERK+ + GIQALIGS  +       +
Sbjct  60   WGDGHFQGTRDTSPNQATINNKHIQSHRISSLNSERKRGMKGIQALIGSDNHDIDVSIMD  119

Query  433  GDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGI  612
            G   TDAEWFYVMSL RSFSAGDGVPGKA S GSLVWL+G   LQ YNCERAKEAQ+HGI
Sbjct  120  GSNATDAEWFYVMSLTRSFSAGDGVPGKALSTGSLVWLTGRQDLQFYNCERAKEAQMHGI  179

Query  613  QTLVCIPTGAGVVELGS  663
            +TLVCIPT  GV+ELGS
Sbjct  180  ETLVCIPTCDGVLELGS  196



>gb|KJB41602.1| hypothetical protein B456_007G111800 [Gossypium raimondii]
Length=495

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 126/171 (74%), Gaps = 12/171 (7%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            STLQQRLQF++++Q D WAYAIFWQT NDD G LFLAWGDG  Q TK       P +  +
Sbjct  24   STLQQRLQFVIQSQQDLWAYAIFWQTLNDDLGNLFLAWGDGHLQCTK----DASPRLSSS  79

Query  349  SHSTQQSERKKVISGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPGK  516
             HS    ER KV+ GIQALIG   + +    +G  ITD EW Y+MS+ RSFSAG+G+PGK
Sbjct  80   FHS----ERTKVMKGIQALIGDHHDVDMSMIDGTDITDVEWLYMMSMTRSFSAGEGIPGK  135

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            A S GSLVWL+GAH LQ YNCERA+EAQ+HG++TLVCIPT  GV+ELGS E
Sbjct  136  ALSTGSLVWLTGAHELQFYNCERAREAQMHGLETLVCIPTSCGVLELGSSE  186



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 130/188 (69%), Gaps = 23/188 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGG  327
            Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+GRLFL WGDG FQG K      
Sbjct  19   QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHQVDNGRLFLTWGDGHFQGPK----DA  74

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENG--DLI----------TDAEWFYVM  471
             P     +     SER+K++ GIQ+LI  T N +N   DLI          T+ EWFYV 
Sbjct  75   SPNNHHHNPYGGLSERRKILKGIQSLINDTNNPDNHHQDLILDNMGLNAXVTNVEWFYVT  134

Query  472  SLARSFSAGD----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            SLARSFS G+     VPGKAFS GSLVWL+G+H LQ YNCERAKEAQ+HGIQTLVCIPT 
Sbjct  135  SLARSFSVGESISTNVPGKAFSSGSLVWLTGSHELQFYNCERAKEAQMHGIQTLVCIPTP  194

Query  640  AGVVELGS  663
             GV+ELGS
Sbjct  195  TGVLELGS  202



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 129/188 (69%), Gaps = 23/188 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGG  327
            Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+G LFL WGDG FQG K      
Sbjct  19   QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDRQVDNGCLFLTWGDGHFQGPK----DA  74

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENG--DLI----------TDAEWFYVM  471
             P     +     SER+K++ GIQ+LI  T N +N   DLI          TD EWFYV 
Sbjct  75   SPNNHHHNPYGVLSERRKILKGIQSLINDTNNPDNHHQDLILDNMGLNADVTDVEWFYVT  134

Query  472  SLARSFSAGD----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            SLARSFS G+     VPGKAFS GSLVWL+G+H LQ YNCERAKEAQ+HGIQTLVCIPT 
Sbjct  135  SLARSFSVGESISTNVPGKAFSSGSLVWLTGSHELQFYNCERAKEAQMHGIQTLVCIPTP  194

Query  640  AGVVELGS  663
             GV+ELGS
Sbjct  195  TGVLELGS  202



>ref|XP_002301432.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE80705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=491

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 138/194 (71%), Gaps = 9/194 (5%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SS SS  +   Q    TLQQRLQFI++ Q D W+YAIFWQTSNDD GR+FL 
Sbjct  1    MEELIISPSSPSSPVSLS-QETPPTLQQRLQFIVQNQPDWWSYAIFWQTSNDDSGRIFLG  59

Query  280  WGDGFFQGTKAGRGGGVPVVVQTSHST-QQSERKKVI-SGIQALIGSTQNSE----NGDL  441
            WGDG FQG+K       P     S  T   SERK+V+  GIQ+LIG   + +    +G+ 
Sbjct  60   WGDGHFQGSKDT--SPKPNTFSNSRMTISNSERKRVMMKGIQSLIGECHDLDMSLMDGND  117

Query  442  ITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTL  621
             TD+EWFYVMSL RSFS GDG+ GKA++ GSL+WL+G H LQ YNCER KEAQ+HGI+TL
Sbjct  118  ATDSEWFYVMSLTRSFSPGDGILGKAYTTGSLIWLTGGHELQFYNCERVKEAQMHGIETL  177

Query  622  VCIPTGAGVVELGS  663
            VCIPT  GV+ELGS
Sbjct  178  VCIPTSCGVLELGS  191



>gb|ABK94979.1| unknown [Populus trichocarpa]
Length=491

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 126/175 (72%), Gaps = 8/175 (5%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q    TLQQRLQFI++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K       P 
Sbjct  19   QETPPTLQQRLQFIVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSKDT--SPKPN  76

Query  337  VVQTSHST-QQSERKKVI-SGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAG  498
                S  T   SERK+V+  GIQ+LIG   + +    +G+  TD+EWFYVMSL RSFS G
Sbjct  77   TFSNSRMTISNSERKRVMMKGIQSLIGECHDLDMSLMDGNDATDSEWFYVMSLTRSFSPG  136

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            DG+ GKA++ GSL+WL+G H LQ YNCER KEAQ+HGI+TLVCIPT  GV+ELGS
Sbjct  137  DGILGKAYTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLVCIPTSCGVLELGS  191



>gb|KJB09595.1| hypothetical protein B456_001G151700 [Gossypium raimondii]
Length=502

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 140/195 (72%), Gaps = 8/195 (4%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+     + + STLQQRLQF++++Q   W YAIFWQTSND+ GRL+L 
Sbjct  1    MEELIISPSSSSSLVYMTQETSPSTLQQRLQFVVQSQQIWWTYAIFWQTSNDEHGRLYLC  60

Query  280  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----I  444
            WGDG+FQGT  G     P ++  ++S  ++ER+K + G Q LI      +   +     +
Sbjct  61   WGDGYFQGTTKGTP---PKLLSANNSCLENERRKEMKGAQTLIRDNHEVDVSMMDGTTGV  117

Query  445  TDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLV  624
            +DA WFYVMSL RSF AG+G+PG A S GSLVWL+GAH LQ YNCERA EAQ+HGI+T+V
Sbjct  118  SDAVWFYVMSLTRSFPAGEGIPGMALSTGSLVWLTGAHALQFYNCERAIEAQMHGIETMV  177

Query  625  CIPTGAGVVELGSLE  669
            CIPT  GV+ELGS+E
Sbjct  178  CIPTSCGVLELGSVE  192



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 126/174 (72%), Gaps = 19/174 (11%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            +LQ+RLQFI+++Q + WAYAIFWQT NDD+GR+FLAWGDG FQG K    G VP   Q  
Sbjct  34   SLQERLQFIVQSQAEWWAYAIFWQTCNDDNGRIFLAWGDGHFQGGK----GMVPR--QLG  87

Query  352  HSTQQSE-----RKKVISGIQALIGSTQNSE-----NGDLITDAEWFYVMSLARSFSAGD  501
                QS      RKK I GIQALI  T+N +     +GD +TD EWFYVMSL R FSAGD
Sbjct  88   LRGDQSRAGLFTRKKAIKGIQALI--TENPDMDGLMDGD-VTDVEWFYVMSLTRCFSAGD  144

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            GVPGKA S GSLVWL+GA  L  YNCERAKEAQIHGI T VCIPTG GV+ELGS
Sbjct  145  GVPGKALSSGSLVWLTGAQELMFYNCERAKEAQIHGIDTFVCIPTGNGVLELGS  198



>ref|XP_009623534.1| PREDICTED: transcription factor MYC2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=487

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 123/165 (75%), Gaps = 5/165 (3%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQ  LQ+++K+Q D WAYAIFWQTS DD+G+ FLAWGDG+FQG K   GG       +S 
Sbjct  71   LQHMLQYVIKSQPDWWAYAIFWQTSTDDEGKPFLAWGDGYFQGAK---GGAAVNNKGSSS  127

Query  355  STQQSERKKVISGIQALI-GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKAFSM  528
               QSERKKVI GIQALI G   N  +   +TD EWFYVMSLARSFS  +G VPGKAFS 
Sbjct  128  DAAQSERKKVIRGIQALIDGDNNNLMDDGNVTDIEWFYVMSLARSFSVDNGSVPGKAFSS  187

Query  529  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+ VW +GA + Q+Y+CERAKEAQIHGIQTL+CIPT  GV+ELGS
Sbjct  188  GNFVWFTGAAQFQVYSCERAKEAQIHGIQTLLCIPTSNGVLELGS  232



>ref|XP_011023113.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=491

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 6/174 (3%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q    TLQQRLQF+++ Q D W+YAIFWQTSNDD GR+FL WGDG FQG+K      +  
Sbjct  19   QETPPTLQQRLQFMVQNQPDWWSYAIFWQTSNDDSGRIFLGWGDGHFQGSK-DTSPKLNT  77

Query  337  VVQTSHSTQQSERKKVI-SGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGD  501
               +  +   SERK+V+  GIQ+L+G   + +    +G+  TD+EWFYVMSL RSFS GD
Sbjct  78   FSNSRVTISNSERKRVMMKGIQSLVGECHDLDMSLMDGNDATDSEWFYVMSLTRSFSPGD  137

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+ GKA++ GSL+WL+G H LQ YNCER KEAQ+HGI+TLVCIPT  GV+ELGS
Sbjct  138  GILGKAYTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLVCIPTSCGVLELGS  191



>ref|XP_011094312.1| PREDICTED: transcription factor MYC2 [Sesamum indicum]
Length=473

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 125/171 (73%), Gaps = 22/171 (13%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQ+RLQ+IL+ Q D WAYAI WQTS DD+GR+ L+W DG FQGTK           +  
Sbjct  27   TLQKRLQYILQHQPDWWAYAILWQTSKDDNGRISLSWADGHFQGTKE----------KNP  76

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLARSFSAGDGVP  510
             S  Q ERKKV+ GIQALIG     EN D+       +TDAEWFYVMSLA+SFS GDGV 
Sbjct  77   KSGSQPERKKVMRGIQALIG-----ENPDITGPVDGDVTDAEWFYVMSLAQSFSLGDGVV  131

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            GKAF+ GSL+WLSG ++L+ YNC+RAKEAQIHG+QT+VCIPT  GV+ELGS
Sbjct  132  GKAFNSGSLIWLSGGNQLRFYNCQRAKEAQIHGMQTMVCIPTLNGVLELGS  182



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 125/175 (71%), Gaps = 23/175 (13%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLFLAWGDGFFQGTKAGRGGGVPVVVQ  345
            S LQQ+LQ ILK QTDSW+YAIFWQT+NDDD G LFLAWGDG F GTK+  G      VQ
Sbjct  26   SNLQQKLQNILKIQTDSWSYAIFWQTTNDDDDGHLFLAWGDGHFHGTKSKTG------VQ  79

Query  346  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITD---------AEWFYVMSLARSFSAG  498
            +S   Q +ERK VI GIQALI      ENGD   D         AEWFYVMSLA+SFS G
Sbjct  80   SSE--QSTERKNVIKGIQALI-----CENGDEKVDDDDDDEVTDAEWFYVMSLAQSFSIG  132

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            DGVPGKAFS  S++WL+G+  LQ + C+RAKEA +HGIQT VCIPT  GV+E+GS
Sbjct  133  DGVPGKAFSTASIIWLTGSQNLQFHTCKRAKEAHLHGIQTFVCIPTSNGVIEMGS  187



>ref|XP_011039030.1| PREDICTED: transcription factor MYC2 isoform X2 [Populus euphratica]
Length=500

 Score =   208 bits (529),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQRLQFI+++Q D W+YAIFWQ S DD G++FLAWGDG FQG+K      +     + 
Sbjct  24   TLQQRLQFIVQSQPDRWSYAIFWQASQDDSGQIFLAWGDGHFQGSK-DTSPKLSTTNNSR  82

Query  352  HSTQQSERKKVISGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPGKA  519
             ST  SERK+V+ GI +L+    + +    +G   TD EWFYVMSL RSFS GDG+ GKA
Sbjct  83   MSTSNSERKRVMKGIHSLLDECHDLDMSLMDGTDSTDIEWFYVMSLTRSFSPGDGILGKA  142

Query  520  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            ++ GSL+WL+G H LQ YNCER KEAQ+HGI+TL+CIPT  GV+ELGS
Sbjct  143  YTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLICIPTSCGVLELGS  190



>ref|XP_011039024.1| PREDICTED: transcription factor MYC2 isoform X1 [Populus euphratica]
Length=525

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQRLQFI+++Q D W+YAIFWQ S DD G++FLAWGDG FQG+K      +     + 
Sbjct  24   TLQQRLQFIVQSQPDRWSYAIFWQASQDDSGQIFLAWGDGHFQGSK-DTSPKLSTTNNSR  82

Query  352  HSTQQSERKKVISGIQALIGSTQNSE----NGDLITDAEWFYVMSLARSFSAGDGVPGKA  519
             ST  SERK+V+ GI +L+    + +    +G   TD EWFYVMSL RSFS GDG+ GKA
Sbjct  83   MSTSNSERKRVMKGIHSLLDECHDLDMSLMDGTDSTDIEWFYVMSLTRSFSPGDGILGKA  142

Query  520  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            ++ GSL+WL+G H LQ YNCER KEAQ+HGI+TL+CIPT  GV+ELGS
Sbjct  143  YTTGSLIWLTGGHELQFYNCERVKEAQMHGIETLICIPTSCGVLELGS  190



>gb|KJB49615.1| hypothetical protein B456_008G128800 [Gossypium raimondii]
Length=487

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 136/196 (69%), Gaps = 8/196 (4%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            M+ELI++ SSSSS+ +   +   STLQQRLQFI+++  +   YAIFWQTSNDD GRLFLA
Sbjct  1    MEELIISPSSSSSLVSFSQETPPSTLQQRLQFIVQSHQEWCTYAIFWQTSNDDHGRLFLA  60

Query  280  WGDGFFQGTKAGRGGGVPVVVQTS--HSTQ--QSERKKVISGIQALIGSTQNSE----NG  435
            W DG FQGTK       P     +  +S Q   +ER+ V+  +QALIG   +      +G
Sbjct  61   WEDGHFQGTKDTSPKSTPNNNNNNDMYSFQGLHNERRNVLKRLQALIGDNHDISGSLVDG  120

Query  436  DLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQ  615
              ITDAEWFYVMSL RSFS GDGV GK  S GSLVWL+GAH LQ   CERA+EAQ+HGI+
Sbjct  121  TDITDAEWFYVMSLTRSFSLGDGVLGKVLSTGSLVWLTGAHELQFNGCERAREAQLHGIR  180

Query  616  TLVCIPTGAGVVELGS  663
            TLVCIPT  GV+ELGS
Sbjct  181  TLVCIPTNRGVLELGS  196



>ref|XP_006357552.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=452

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 122/169 (72%), Gaps = 7/169 (4%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT-KAGRGGGVPVVVQTS  351
            LQQ LQ+++K+Q + WAYAIFWQTS DDDG+ FLAWGDG+FQG        G      + 
Sbjct  30   LQQMLQYVVKSQPEWWAYAIFWQTSTDDDGKNFLAWGDGYFQGDGVVNNNKGSSSSSSSL  89

Query  352  HSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKA  519
             S  QSERKKVI GIQAL+   G T   ++GD +TD EWFYVMSLARSFSAGDG V GKA
Sbjct  90   KSQAQSERKKVIKGIQALMDGNGDTDLVDDGD-VTDTEWFYVMSLARSFSAGDGSVTGKA  148

Query  520  FSMGSLVWLSGAHRLQM-YNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F     +W++G  + Q+ Y+CERAKEAQIHGIQTLVCIPT  GV ELGS
Sbjct  149  FGSDDFLWITGPAQFQLHYSCERAKEAQIHGIQTLVCIPTSNGVFELGS  197



>emb|CBI38690.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 116/169 (69%), Gaps = 33/169 (20%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            +LQ+RLQFI+++Q + WAYAIFWQT NDD+GR+FLAWGDG FQG K              
Sbjct  17   SLQERLQFIVQSQAEWWAYAIFWQTCNDDNGRIFLAWGDGHFQGGKG-------------  63

Query  352  HSTQQSERKKVISGIQALIGSTQNSE-----NGDLITDAEWFYVMSLARSFSAGDGVPGK  516
                         GIQALI  T+N +     +GD +TD EWFYVMSL R FSAGDGVPGK
Sbjct  64   ------------MGIQALI--TENPDMDGLMDGD-VTDVEWFYVMSLTRCFSAGDGVPGK  108

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            A S GSLVWL+GA  L  YNCERAKEAQIHGI T VCIPTG GV+ELGS
Sbjct  109  ALSSGSLVWLTGAQELMFYNCERAKEAQIHGIDTFVCIPTGNGVLELGS  157



>ref|XP_008233076.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2 [Prunus 
mume]
Length=483

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 126/188 (67%), Gaps = 26/188 (14%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQGTK--AGRGG  324
            Q    +LQQRLQFI+++Q D W+YAIFWQ SND  D+GRLFL WGDG FQG+K  + +  
Sbjct  19   QETSPSLQQRLQFIVQSQPDWWSYAIFWQPSNDHQDNGRLFLTWGDGHFQGSKDPSAKHH  78

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----------TDAEWFYVMS  474
              P  +        SER+K++ GIQ+LI       + D +          +D EWFYVMS
Sbjct  79   NNPYGIL-------SERRKILKGIQSLINDNNPDHHQDSVMDHMGLDADVSDGEWFYVMS  131

Query  475  LARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            LARSFS G+      VPGKAFS GS+VWL+GAH LQ YNC+RAKEAQ+HG QTLVCIPT 
Sbjct  132  LARSFSIGESAISASVPGKAFSSGSVVWLTGAHELQFYNCDRAKEAQMHGFQTLVCIPTP  191

Query  640  AGVVELGS  663
             GV+E+GS
Sbjct  192  TGVLEMGS  199



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 121/174 (70%), Gaps = 10/174 (6%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQT-SNDDDGRLFLAWGDGFFQGTKAGRGGG---VPVV  339
            TLQQRLQFI+++Q + WAYAIFWQT SNDD+G+LFLAWGDG +QGTK         +P  
Sbjct  25   TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAP  84

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSE------NGDLITDAEWFYVMSLARSFSAGD  501
               +      ERK+ IS I+ +  S    E      +G  +TD EWFYVMSL RSF AG 
Sbjct  85   APGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGV  144

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+PG+A S GSLVWL+G+H LQ YNCERAKEAQ HGI+T VCIPT  GV+ELGS
Sbjct  145  GIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGS  198



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 121/174 (70%), Gaps = 10/174 (6%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQT-SNDDDGRLFLAWGDGFFQGTKAGRGGG---VPVV  339
            TLQQRLQFI+++Q + WAYAIFWQT SNDD+G+LFLAWGDG +QGTK         +P  
Sbjct  25   TLQQRLQFIVQSQPEWWAYAIFWQTISNDDNGQLFLAWGDGHYQGTKDASPRARMSMPAP  84

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSE------NGDLITDAEWFYVMSLARSFSAGD  501
               +      ERK+ IS I+ +  S    E      +G  +TD EWFYVMSL RSF AG 
Sbjct  85   APGAALDNNMERKRAISSIRGIQQSFMGHEMDLSMMDGGDVTDTEWFYVMSLTRSFGAGV  144

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+PG+A S GSLVWL+G+H LQ YNCERAKEAQ HGI+T VCIPT  GV+ELGS
Sbjct  145  GIPGRAQSSGSLVWLTGSHELQFYNCERAKEAQSHGIETFVCIPTSCGVLELGS  198



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 126/188 (67%), Gaps = 26/188 (14%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND--DDGRLFLAWGDGFFQGTK--AGRGG  324
            Q    +LQQRLQFI+++Q D W+YAIFWQ SND  D+GRLFL WGDG FQG+K  + +  
Sbjct  19   QETSPSLQQRLQFIVQSQPDWWSYAIFWQPSNDHQDNGRLFLTWGDGHFQGSKDPSAKHH  78

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----------TDAEWFYVMS  474
              P  +        SER+K++ GIQ+LI       + D I          +D EWFYVMS
Sbjct  79   NNPYGIL-------SERRKILKGIQSLINDNNPDHHQDSIMDHMGLDADVSDGEWFYVMS  131

Query  475  LARSFSAGD-----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            LARSFS G+      VPGKAFS GS+VWL+G+H LQ YNC+RAKEAQ+HG QTLVCIPT 
Sbjct  132  LARSFSIGETTISASVPGKAFSSGSVVWLTGSHELQFYNCDRAKEAQMHGFQTLVCIPTP  191

Query  640  AGVVELGS  663
             GV+E+GS
Sbjct  192  TGVLEMGS  199



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2 [Fragaria vesca subsp. vesca]
Length=491

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 141/202 (70%), Gaps = 17/202 (8%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFL  276
            MD+LI++ +SSSS+ +   +P  +TLQQRLQFIL++Q + W+YAIFW  SND ++GRL L
Sbjct  1    MDDLIISPTSSSSLVSLPHEP--ATLQQRLQFILQSQPELWSYAIFWLASNDVENGRLLL  58

Query  277  AWGDGFFQGTKAGRGGGVPVVVQTSH-STQQSERKKVISGIQALIGSTQNSE--------  429
             WGDG FQG +         +  +   S   S+R+K++ GIQ+++  T N+         
Sbjct  59   GWGDGHFQGPEDPSPDLNNRLSSSGDGSLLHSDRRKILKGIQSILNDTNNNNPELDMDNF  118

Query  430  ---NGDLITDAEWFYVMSLARSFSAGDG-VPGKAFSMGSLVWLSGAHRLQMYNCERAKEA  597
               NGD ++DAEWFYVMSL RSF+ GDG VPGKAF  GS VWLSGAH LQ  +CERAKEA
Sbjct  119  MALNGD-VSDAEWFYVMSLTRSFAIGDGSVPGKAFGSGSFVWLSGAHELQFNSCERAKEA  177

Query  598  QIHGIQTLVCIPTGAGVVELGS  663
            QIHGI+TL+CIPT  GV+E+GS
Sbjct  178  QIHGIETLICIPTSNGVLEMGS  199



>ref|XP_009766909.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
 ref|XP_009766910.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
Length=444

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQ  LQ+++K+Q D WAYAIFWQ+S+DD+G+ FLAWGDG+FQG K G          +S 
Sbjct  27   LQHMLQYVIKSQPDWWAYAIFWQSSSDDEGKAFLAWGDGYFQGAKGGAAANNNGSNSSSS  86

Query  355  STQQSERKKVISGIQALIGSTQN-SENGDLITDAEWFYVMSLARSFSAGDG-VPGKAFSM  528
               QSERKKVI GIQALI    N  ++GD +TD EWFYVMSLARSF+  +G VPGKAFS 
Sbjct  87   EAAQSERKKVIRGIQALIDGDNNLIDDGD-VTDIEWFYVMSLARSFTVDNGSVPGKAFSG  145

Query  529  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+ VW++GA + Q+ +CERAKEAQIHGIQTL+CIPT  GV+ELGS
Sbjct  146  GNFVWITGAAQFQLSSCERAKEAQIHGIQTLLCIPTSNGVLELGS  190



>ref|XP_004230022.1| PREDICTED: transcription factor MYC2-like isoform X2 [Solanum 
lycopersicum]
Length=450

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 123/169 (73%), Gaps = 7/169 (4%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQQ LQ+++K+Q + WAYAIFWQTSNDD+G+ FLAWGDG+FQG              +S 
Sbjct  27   LQQMLQYVVKSQPEWWAYAIFWQTSNDDEGKNFLAWGDGYFQGDGVVINNKGGGGSSSSL  86

Query  355  STQ-QSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKA  519
             +Q QSERKKVI GIQAL+   G T   ++GD +TD EWFYVMSLARSFSAGDG V GKA
Sbjct  87   KSQAQSERKKVIKGIQALMDGNGDTDLVDDGD-VTDTEWFYVMSLARSFSAGDGSVTGKA  145

Query  520  FSMGSLVWLSGAHRLQM-YNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F     +W++G  + Q+ Y+CERAKEAQIHGIQTLV IPT  GV ELGS
Sbjct  146  FGSDDFLWITGPDQFQLHYSCERAKEAQIHGIQTLVSIPTSNGVFELGS  194



>ref|XP_004230021.1| PREDICTED: transcription factor MYC2-like isoform X1 [Solanum 
lycopersicum]
Length=451

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 123/169 (73%), Gaps = 7/169 (4%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQQ LQ+++K+Q + WAYAIFWQTSNDD+G+ FLAWGDG+FQG              +S 
Sbjct  27   LQQMLQYVVKSQPEWWAYAIFWQTSNDDEGKNFLAWGDGYFQGDGVVINNKGGGGSSSSL  86

Query  355  STQ-QSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPGKA  519
             +Q QSERKKVI GIQAL+   G T   ++GD +TD EWFYVMSLARSFSAGDG V GKA
Sbjct  87   KSQAQSERKKVIKGIQALMDGNGDTDLVDDGD-VTDTEWFYVMSLARSFSAGDGSVTGKA  145

Query  520  FSMGSLVWLSGAHRLQM-YNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F     +W++G  + Q+ Y+CERAKEAQIHGIQTLV IPT  GV ELGS
Sbjct  146  FGSDDFLWITGPDQFQLHYSCERAKEAQIHGIQTLVSIPTSNGVFELGS  194



>ref|XP_008345582.1| PREDICTED: transcription factor bHLH14-like [Malus domestica]
Length=492

 Score =   194 bits (493),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 123/186 (66%), Gaps = 23/186 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGG  327
            Q NH +LQQRLQFIL++Q D W+YAIFWQTSND   D+G LFL WGDG FQ  K      
Sbjct  19   QENHPSLQQRLQFILQSQPDWWSYAIFWQTSNDHLVDNGCLFLTWGDGHFQRPKDASPNN  78

Query  328  VPVVVQTSHSTQQ--SERKKVISGIQALIGSTQNSENGDL--------ITDAEWFYVMSL  477
                    H+  +  SER+K++ GIQ+LI  T N +N  L         T+ E F+V S 
Sbjct  79   ------HHHNPYEVLSERRKILKGIQSLINDTNNPDNHYLYNMGLNANTTNIEGFFVRSF  132

Query  478  ARSFSAGD----GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAG  645
            ARSFS G+     VP KAFS GSLVWL+G+H LQ Y CERAKEAQ+HGIQTLVCIPT  G
Sbjct  133  ARSFSVGESIXTNVPXKAFSSGSLVWLTGSHELQSYVCERAKEAQMHGIQTLVCIPTPTG  192

Query  646  VVELGS  663
            V+ELGS
Sbjct  193  VLELGS  198



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 118/178 (66%), Gaps = 28/178 (16%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG----TKAGRGGGVPVV  339
            TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG    T A R       
Sbjct  32   TLQQRLQLMVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGSTKLTLASR-------  84

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL--------ITDAEWFYVMSLARSFSA  495
                     S+R++++  +     +++     D+        +TDAEWFYVMSL RSFSA
Sbjct  85   ---------SDRRRLLQALPRDPSNSRPDAAADVPLPAPAGDVTDAEWFYVMSLTRSFSA  135

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            GDG+PGKA S GSLVWL+GA  L+ Y C+RAKEA++HGI+T+VCIPTG GV+ELGS +
Sbjct  136  GDGIPGKALSTGSLVWLTGARELESYKCDRAKEAELHGIRTMVCIPTGDGVLELGSCD  193



>ref|XP_002320222.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE98537.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=430

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 108/164 (66%), Gaps = 26/164 (16%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQRLQFI+++Q D W+Y+IFWQ S DD G++FLAWGDG FQG+K      +     + 
Sbjct  24   TLQQRLQFIVQSQPDRWSYSIFWQASKDDSGQIFLAWGDGHFQGSK-DTSPKLSTTNNSR  82

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  531
             ST  SERK+                         WFYVMSL RSFS GDG+ GKA++ G
Sbjct  83   MSTSNSERKR-------------------------WFYVMSLTRSFSPGDGILGKAYTTG  117

Query  532  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            SL+WL+G H LQ YNCER KEAQ+HGI+TL+CIPT  GV+ELGS
Sbjct  118  SLIWLTGGHELQFYNCERVKEAQMHGIETLICIPTSCGVLELGS  161



>gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = +1

Query  211  TDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVIS  390
            +D W+YAIFWQTSNDD+GR+FLAWGDG FQ ++      +  +     +    ERK  + 
Sbjct  38   SDRWSYAIFWQTSNDDNGRIFLAWGDGHFQSSRQT-PPKLTTINNRIPAINSGERKIAMK  96

Query  391  GIQALIGSTQNSENGDLI-TDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQ  567
            GI AL G+  + +   +  T+AEWFYVMSL RSFSAG+G+PGK  S GSLVWL+GA  L+
Sbjct  97   GIHALFGNNNDIDCSMMDDTNAEWFYVMSLTRSFSAGEGIPGKVLSTGSLVWLTGAQELR  156

Query  568  MYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             YNCERAKEAQ+HG++TLVCIPT  GV+ELGS +
Sbjct  157  YYNCERAKEAQMHGLETLVCIPTYNGVLELGSCD  190



>gb|KCW83845.1| hypothetical protein EUGRSUZ_B00713 [Eucalyptus grandis]
Length=490

 Score =   183 bits (464),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 125/201 (62%), Gaps = 21/201 (10%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHS-------TLQQRLQFILKTQTDSWAYAIFWQTSNDD  258
            MD+LI+ SSSSSS+      P  +       TLQQRLQ ++++Q   WAYAIFWQ  N D
Sbjct  1    MDKLIIASSSSSSLVFKPMSPTATPPPSLGLTLQQRLQLVVQSQPQWWAYAIFWQLLNHD  60

Query  259  DGRLFLAWGDGFFQG----TKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNS  426
            DGRL LAWGDG FQG    T A R     +     H    S R    + + A  G     
Sbjct  61   DGRLLLAWGDGHFQGSAKLTLASRSDCGKLFQALPHDPSNS-RPDAAADVPAPTGD----  115

Query  427  ENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIH  606
                 +TDAEWFYVMSL RSFSAGDG+PGKA   GSLVWL+GA  L  Y C+R KEA++H
Sbjct  116  -----VTDAEWFYVMSLTRSFSAGDGIPGKALGTGSLVWLTGARDLGSYECDRTKEAELH  170

Query  607  GIQTLVCIPTGAGVVELGSLE  669
            GI+TLVCIPTG GV+ELGS +
Sbjct  171  GIRTLVCIPTGHGVLELGSCD  191



>ref|XP_010031905.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=490

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 110/170 (65%), Gaps = 14/170 (8%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG----TKAGRGGGVPVV  339
            TLQQRLQ ++++Q   WAYAIFWQ  N DDGRL LAWGDG FQG    T A R     + 
Sbjct  32   TLQQRLQLVVQSQPQWWAYAIFWQLLNHDDGRLLLAWGDGHFQGSAKLTLASRSDCGKLF  91

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKA  519
                H    S R    + + A  G          +TDAEWFYVMSL RSFSAGDG+PGKA
Sbjct  92   QALPHDPSNS-RPDAAADVPAPTGD---------VTDAEWFYVMSLTRSFSAGDGIPGKA  141

Query  520  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
               GSLVWL+GA  L  Y C+R KEA++HGI+TLVCIPTG GV+ELGS +
Sbjct  142  LGTGSLVWLTGARDLGSYECDRTKEAELHGIRTLVCIPTGHGVLELGSCD  191



>ref|XP_010267440.1| PREDICTED: transcription factor MYC2 [Nelumbo nucifera]
Length=522

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 121/172 (70%), Gaps = 10/172 (6%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQ+RL+F+++++ + W YAIFW+TSND++G L LAW DG F+GT+  R           
Sbjct  28   TLQERLRFLVQSRPEWWVYAIFWRTSNDNNGHLVLAWADGLFRGTR-DRASSSSRYSNRL  86

Query  352  HSTQQS-----ERKKVISGIQALIGSTQN---SENGDLITDAEWFYVMSLARSFSAGDGV  507
               QQ      ERKKV+ GIQALI    +   S +GD +TDAEWFY++S+ RSF+ GDG+
Sbjct  87   QCQQQKLEIDWERKKVMKGIQALINDIPDIDASVDGD-VTDAEWFYMVSITRSFNIGDGL  145

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            PGKA S GS VWL+GA +L+  NCERAKEA +HGI+TLV IP  +GV+ELGS
Sbjct  146  PGKAISSGSPVWLTGAQQLRFCNCERAKEALVHGIETLVYIPISSGVLELGS  197



>gb|KJB52372.1| hypothetical protein B456_008G259000 [Gossypium raimondii]
Length=475

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 113/172 (66%), Gaps = 4/172 (2%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q    TLQQRL FI++++ + W Y+IFWQ S D DGR+ L+WGDG+F+GT+ G G  +  
Sbjct  14   QDASPTLQQRLHFIVQSRPEWWVYSIFWQASRDVDGRVVLSWGDGYFRGTRDGTGKSINR  73

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDGV  507
            +  +   +    ++     +QA      + +   +GD +TD EW+Y +S+ RSF+ GDG+
Sbjct  74   LSPSKLGSSFERKRSGKDQVQAYFNEVMDVDRMVDGD-VTDYEWYYTVSMTRSFAVGDGI  132

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             GKAF  GS +WL G H LQ+Y CER +EA++ GIQTLVC+PT  GVVELGS
Sbjct  133  LGKAFGSGSHIWLGGDHELQLYQCERVREARMRGIQTLVCLPTSFGVVELGS  184



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 111/174 (64%), Gaps = 33/174 (19%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            P   TLQQ+LQF+++TQ+++W YAI WQT+ D+ G+  L+WG+G+FQGTK          
Sbjct  21   PQTLTLQQKLQFLVQTQSENWVYAILWQTTKDEKGKPLLSWGEGYFQGTK----------  70

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----V  507
             +T++S +Q                  N  N     DAEWFYVMSL R FS G+     +
Sbjct  71   -ETTNSNKQ------------------NDSNTCANKDAEWFYVMSLTRIFSIGNASSISL  111

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PGK+F++ S++WL+  H LQ+YNCER+ EA +HGI+TL+CIPT  GV+E+GS +
Sbjct  112  PGKSFALDSVLWLNSKHELQIYNCERSNEAHVHGIETLICIPTTNGVIEMGSYD  165



>ref|XP_011081344.1| PREDICTED: transcription factor MYC2-like [Sesamum indicum]
Length=469

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 112/173 (65%), Gaps = 12/173 (7%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            +P  STLQ RLQFIL+++ + W YAIFWQ + D DGR  L+WGDG +QGTK+       V
Sbjct  17   EPPPSTLQNRLQFILQSRREWWNYAIFWQATKDADGRFVLSWGDGHYQGTKSAAN----V  72

Query  337  VVQTSHSTQQS----ERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG  504
             V   H+ Q S    E+ K+  GI+ L G    S  GD +T++EWFY+ S+ ++F A D 
Sbjct  73   TVTHGHTPQNSIPNIEKSKLALGIEVLFGE---SCGGD-VTESEWFYMASVTKTFEAADD  128

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +  +AFS  S VWL+G   LQ  +CER KEAQ+HGI TLV +PT  GVVELGS
Sbjct  129  LVFRAFSTASNVWLAGHQELQFSDCERTKEAQLHGITTLVWVPTSFGVVELGS  181



>ref|XP_007039384.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
 gb|EOY23885.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
Length=473

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 109/178 (61%), Gaps = 12/178 (7%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q    TLQQRLQFI++++ + W Y+IFWQ S D  G L L+WGDG+F+GT+   G     
Sbjct  14   QDASPTLQQRLQFIVQSRPEWWVYSIFWQASRDAHGHLVLSWGDGYFRGTRNFSGESCNK  73

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLARSFSA  495
            ++         ERK+    +QAL      SE  DL       +TD EW+Y +S+ RSF+ 
Sbjct  74   LISQPKLVSNLERKRSNKEMQALF-----SEEMDLDRMVDVDVTDYEWYYTVSITRSFAI  128

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            GDG+ G+AF  GS +WLSG    Q+Y CER ++A++ G QTLVC+ T  GVVELGS E
Sbjct  129  GDGILGRAFGSGSYIWLSGDEEFQLYECERVRDARMRGFQTLVCLSTSFGVVELGSSE  186



>gb|KDO76730.1| hypothetical protein CISIN_1g010053mg [Citrus sinensis]
Length=519

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 113/180 (63%), Gaps = 16/180 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-------AG  315
            Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K       AG
Sbjct  18   QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSKDFATRAAAG  77

Query  316  RGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARS  486
            + G               ERKKV   +Q   G   + +   +GD +TD EW+Y +S+ RS
Sbjct  78   KQGAG----NEPKFGFFLERKKVSKEVQVHFGEDMDLDRMVDGD-VTDGEWYYTVSVTRS  132

Query  487  FSAGDG-VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F+ GDG V G+ FS G  VWL+G H LQ+Y CER KEA++HGIQTLVC+ T  GVVELGS
Sbjct  133  FAIGDGSVLGRVFSSGDYVWLTGDHELQLYECERVKEARMHGIQTLVCVSTACGVVELGS  192



>ref|XP_006476285.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
Length=519

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 113/180 (63%), Gaps = 16/180 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-------AG  315
            Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K       AG
Sbjct  18   QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSKDFATRAAAG  77

Query  316  RGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARS  486
            + G               ERKKV   +Q   G   + +   +GD +TD EW+Y +S+ RS
Sbjct  78   KQGAG----NEPKFGFFLERKKVSKEVQVHFGEDMDLDRMVDGD-VTDGEWYYTVSVTRS  132

Query  487  FSAGDG-VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F+ GDG V G+ FS G  VWL+G H LQ+Y CER KEA++HGIQTLVC+ T  GVVELGS
Sbjct  133  FAIGDGSVLGRVFSSGDYVWLTGDHELQLYECERVKEARMHGIQTLVCVSTACGVVELGS  192



>ref|XP_006439218.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
 gb|ESR52458.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
Length=519

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 112/180 (62%), Gaps = 16/180 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-------AG  315
            Q    TLQQRLQFI++ + + W Y+IFWQ   D +GRL L+WGDG+F+G+K       AG
Sbjct  18   QETSPTLQQRLQFIVQNRPEWWVYSIFWQPLKDVNGRLVLSWGDGYFRGSKDFATRAAAG  77

Query  316  RGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARS  486
            + G               ERKKV   +Q   G   + +   +GD +TD EW+Y +S+ RS
Sbjct  78   KQGAG----NEPKFGFFLERKKVSKEVQVHFGEDMDLDRMVDGD-VTDGEWYYTVSVTRS  132

Query  487  FSAGDGVP-GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F+ GDG   G+ FS G  VWL+G H LQ+Y CER KEA++HGIQTLVC+ T  GVVELGS
Sbjct  133  FAIGDGSALGRVFSSGDYVWLTGDHELQLYECERVKEARMHGIQTLVCVSTACGVVELGS  192



>gb|ACF19982.1| MYC2 [Hevea brasiliensis]
Length=476

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 105/171 (61%), Gaps = 3/171 (2%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q +   LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK         
Sbjct  23   QDSSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTKEFAAKACNK  82

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSEN-GDL-ITDAEWFYVMSLARSFSAGDGVP  510
              Q        ERK +    Q L     + +   D+ + D EWFY +S+ RSF+  DG+ 
Sbjct  83   QNQPKFGFNL-ERKMINKESQTLFTDDMDMDRLADVDVIDYEWFYTVSVTRSFAIDDGIL  141

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+ F  G+ +WL+G + LQMY+CER KEA++HGIQTLVCI T   VVELGS
Sbjct  142  GRTFGSGAFIWLTGNNELQMYDCERVKEARMHGIQTLVCISTSCAVVELGS  192



>gb|ADK91082.1| LMYC2 [Hevea brasiliensis]
Length=475

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q +   LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK         
Sbjct  23   QDSSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFRGTKEFAAKACNK  82

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDGV  507
              Q        ERK +    Q L     + +   + D+I D EWFY +S+ RSF+  DG+
Sbjct  83   QNQPKFGFNL-ERKVINKESQTLFTDDMDMDRLPDVDVI-DYEWFYTVSVTRSFAIDDGI  140

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             G+ F  G+ +WL+G + LQMY+CER KEA++HGIQTLVCI T   VVELGS
Sbjct  141  LGRTFGSGAFIWLTGNNELQMYDCERVKEARMHGIQTLVCISTSCAVVELGS  192



>gb|AEG74013.1| lMYC3 [Hevea brasiliensis]
Length=475

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 103/171 (60%), Gaps = 3/171 (2%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q     LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F GTK         
Sbjct  18   QETSPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLSWGDGHFCGTKEFAAKACNK  77

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSEN-GDL-ITDAEWFYVMSLARSFSAGDGVP  510
            + Q        ERK +      L G   + +   D+ + D EWFY +S+ RSF+  DG+ 
Sbjct  78   LNQPKFGFNL-ERKMINKESPTLFGDDMDMDRLVDVEVIDYEWFYTVSVTRSFAVEDGIL  136

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+ F  G+ +WL+G H LQM+ CER KEA++HGIQTL CI T  GVVELGS
Sbjct  137  GRTFGSGAFIWLTGNHELQMFGCERVKEARMHGIQTLACISTTCGVVELGS  187



>gb|AEG74014.1| lMYC4 [Hevea brasiliensis]
Length=470

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 102/166 (61%), Gaps = 5/166 (3%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQQRLQFIL+++ + W YAIFWQ S D  GRL L+WGDG F+GTK           Q  H
Sbjct  24   LQQRLQFILQSRPEWWVYAIFWQASKDSTGRLVLSWGDGHFRGTK--EFAAKVCNKQNQH  81

Query  355  STQ-QSERKKVISGIQALIGSTQNSEN-GDL-ITDAEWFYVMSLARSFSAGDGVPGKAFS  525
                  ERK      Q L     + +   D+ + D EWFY +S+ RSF+  DG+ G+ F 
Sbjct  82   KFGFNLERKLTDKESQILFTDDMDMDRLADVNVIDYEWFYTVSVTRSFTVEDGILGRTFG  141

Query  526  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             G+ +WL+G H+LQMY CER KEA +HGIQTL C+ T  GVVELGS
Sbjct  142  SGAFIWLTGNHQLQMYECERVKEASMHGIQTLTCVSTSCGVVELGS  187



>ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43447.1| DNA binding protein, putative [Ricinus communis]
Length=479

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 111/173 (64%), Gaps = 18/173 (10%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQQRLQ+IL+++ + W YAIFWQ S + +GRL L+WGDG F+ +K        + V+ S+
Sbjct  25   LQQRLQYILQSRPEWWVYAIFWQASKEPNGRLVLSWGDGDFRDSKG-------LAVKPSN  77

Query  355  STQQS-------ERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDG  504
            + Q         ERKKV    Q+L G   + E   + D +T+  WFY +S+ +SF+ G+G
Sbjct  78   NKQNQLKYGFNLERKKVTRDFQSLFGDEMDLERLADAD-VTNYGWFYTVSVTQSFNVGEG  136

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            + G+ F  G+  WL+G H LQ+Y C R KEA++HGIQTLVCI T  GVVELGS
Sbjct  137  ILGQTFGSGTFTWLTGDHELQLYECGRVKEARMHGIQTLVCIATSTGVVELGS  189



>gb|ADK56287.1| LMYC1 [Hevea brasiliensis]
Length=476

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 114/191 (60%), Gaps = 7/191 (4%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            MDEL  TS SSSS   S  Q ++  LQQRLQFIL+++ + W YAIFWQ S D  GRL L+
Sbjct  6    MDEL--TSPSSSSSFMSFCQDSYPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLS  63

Query  280  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITD  450
            WGDG F+GT+           Q        ERK      Q L       +   + D I D
Sbjct  64   WGDGHFRGTEEFAAKACCKQNQLKFGFNL-ERKMTNKESQTLFSDDMEMDRLADVDAI-D  121

Query  451  AEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  630
             EWFY +S+ RSF+  DG+ GK F   + +WL+G H LQMY CER KEA++HG+QTLVCI
Sbjct  122  YEWFYTVSVTRSFAVEDGILGKTFGSWAFIWLTGNHELQMYECERVKEARMHGVQTLVCI  181

Query  631  PTGAGVVELGS  663
             T  GVVELGS
Sbjct  182  STTCGVVELGS  192



>gb|KJB25303.1| hypothetical protein B456_004G184800 [Gossypium raimondii]
Length=676

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  +LQQRLQ +++   +SW YAIFWQ+S D      L WGDG+++G +    G   +  
Sbjct  78   NQESLQQRLQALIEGARESWTYAIFWQSSYDCSATTVLGWGDGYYKGEE--DKGKAKLKA  135

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI GS   +++   + +TD EWF+++S+ +SF  G G+PG
Sbjct  136  PSSSVAEQEHRKKVLRELNSLISGSAAPTDDAVDEEVTDTEWFFLVSMTQSFVDGSGLPG  195

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S VW++G  RL+   CERAK+AQ+ G+QTLVCIP+  GVVELGS E
Sbjct  196  QAFFNSSPVWVAGPDRLESSMCERAKQAQVFGLQTLVCIPSANGVVELGSTE  247



>ref|XP_004244656.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=452

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 15/169 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            QPN  TLQ+ LQ+I+  + + W YAIFWQ S D + RL L+WGDG F+GTK   G     
Sbjct  14   QPN--TLQKTLQYIIHNRQEWWVYAIFWQASKDVNNRLILSWGDGHFRGTKDTTGS----  67

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  516
              +T H      +KK         G    SE  + +TD EWFY++S+ + F A D +  +
Sbjct  68   -TKTGHGQYHQFQKK--------FGFNDISETNNNVTDTEWFYMVSMPQCFVADDDLVIR  118

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            A++  S VWL+  + LQ+YNCERAKEA +HGI+T+VCI T +GVVELGS
Sbjct  119  AYTSASHVWLASYYELQIYNCERAKEANLHGIRTIVCISTTSGVVELGS  167



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 116/172 (67%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G +  +G G  +  
Sbjct  69   NQETLQQRLQALIEGARENWTYAIFWQSSYDYSGTAVLGWGDGYYKGEE-DKGKG-KLKA  126

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S + +Q  RKKV+  + +LI GST  +++   + +TD EWF+++S+ +SF  G G+PG
Sbjct  127  SSSTAAEQEHRKKVLRELNSLISGSTSPTDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPG  186

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S VW++G+ RL    CERA++ Q+ G+QT+VCIP+  GVVELGS E
Sbjct  187  QAFFNSSPVWVAGSDRLATSICERARQGQVFGLQTMVCIPSANGVVELGSTE  238



>gb|KJB24138.1| hypothetical protein B456_004G129600 [Gossypium raimondii]
Length=463

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 109/171 (64%), Gaps = 13/171 (8%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK--AGRGGGVPVVVQ  345
            TLQQRLQFI++++ + W Y+IFWQ S D  GRL  +WGDG+FQGTK  AG+ G       
Sbjct  20   TLQQRLQFIVQSRPEWWVYSIFWQASRDAHGRLVFSWGDGYFQGTKGFAGKSG-------  72

Query  346  TSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITDAEWFYVMSLARSFSAGDGVPGK  516
               S  +  R++    IQ++     + E   +GD +TD EW+Y +S+ RSF+ GD + GK
Sbjct  73   NKLSQPRFGRRRSGEEIQSVFCEEIDIERMVDGD-VTDYEWYYTVSVNRSFAIGDDILGK  131

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            AF  GS +WL G   LQ+Y CER  EA++ GIQTLV + T  GVVELGS E
Sbjct  132  AFGSGSYIWLCGDQELQLYECERVTEARMRGIQTLVFLSTSFGVVELGSSE  182



>ref|XP_007209110.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
 gb|EMJ10309.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
Length=466

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 114/180 (63%), Gaps = 10/180 (6%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  327
            Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++   + R   
Sbjct  14   QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSRDLASKRSNK  73

Query  328  VPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAG  498
            +    Q       +ERKKV++  ++AL     + + GD +TD+EWFY   +SL +SF A 
Sbjct  74   LVHNYQPKSGFISTERKKVVNREVEALFNEDMDLDGGD-VTDSEWFYFYTVSLTQSFGAC  132

Query  499  DG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  133  HGTGNILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIQTSCGVLELASLD  192



>ref|XP_011026782.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=471

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 109/177 (62%), Gaps = 24/177 (14%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q   STLQQRLQF L ++ + W Y+IFWQ S D  GRL L+ GDG F+G K         
Sbjct  18   QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRLVLSLGDGHFRGNKK--------  69

Query  337  VVQTSHSTQQS--------ERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFS  492
               +  S +Q+        ERK + S    +    +    GD+   AEW+Y +S+ R+F+
Sbjct  70   -YASKDSNKQNHSKFGFNLERKSLFSEDMDMDRLVE----GDV---AEWYYTVSVTRAFA  121

Query  493  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             GDG+ G+AFS G+ +WL+G H LQ+Y+CER KEA++HGIQT VC+ T +GV+ELGS
Sbjct  122  VGDGILGRAFSSGAFIWLTGDHELQIYDCERVKEARMHGIQTFVCVSTPSGVLELGS  178



>ref|XP_008245836.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=492

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  327
            Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++   + R   
Sbjct  14   QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSRDLASKRSNK  73

Query  328  VPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAG  498
            +    Q       +ERKKV++  ++AL     + + GD +TD+EWFY   +SL +SF+A 
Sbjct  74   LVHNYQPKSGFISTERKKVVNREVEALFHEDMDLDGGD-VTDSEWFYFYTVSLTQSFAAC  132

Query  499  DG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  133  HGTGNILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIQTSCGVLELASLD  192



>ref|XP_008245834.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=493

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 10/180 (6%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  327
            Q N +TLQQRLQFI++ + + W Y+IFWQ S D +G++ L+W  G F+ ++   + R   
Sbjct  14   QENSATLQQRLQFIVQNRPEWWVYSIFWQASKDSNGQVALSWAGGHFRSSRDLASKRSNK  73

Query  328  VPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAG  498
            +    Q       +ERKKV++  ++AL     + + GD +TD+EWFY   +SL +SF+A 
Sbjct  74   LVHNYQPKSGFISTERKKVVNREVEALFHEDMDLDGGD-VTDSEWFYFYTVSLTQSFAAC  132

Query  499  DG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  133  HGTGNILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIQTSCGVLELASLD  192



>ref|XP_010100202.1| hypothetical protein L484_015347 [Morus notabilis]
 gb|EXB81873.1| hypothetical protein L484_015347 [Morus notabilis]
Length=506

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 111/172 (65%), Gaps = 8/172 (5%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSND----DDGRLFLAWGDGFFQGTK---AGRGGGV  330
            T+QQRLQFIL+T+ + W Y+IFWQ   D      G + L+W  G+F+GTK   A +G  V
Sbjct  27   TIQQRLQFILQTRPEWWVYSIFWQAYKDVTIGSKGDVSLSWNGGYFRGTKNDVARKGNDV  86

Query  331  PVVVQTSHSTQQSERKKVISGIQALIGSTQNSE-NGDLITDAEWFYVMSLARSFSAGDGV  507
               V      +++     +  IQAL G+    E + D+++D EWFY +SL+R+F+A  G 
Sbjct  87   VETVFGFDLEKKASTTSRVGDIQALFGNDSGQEMDVDVLSDIEWFYTVSLSRTFAAESGA  146

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             G++FS G+ VWL+G+  L +Y CER KEA++HGIQTLVCI T  GV+ELGS
Sbjct  147  IGRSFSSGAYVWLTGSEELLLYECERVKEARMHGIQTLVCIATPNGVLELGS  198



>ref|XP_011028179.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=659

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   +SW YAIFWQ+S D+ G   L WGDG+++G +  +G G  +  
Sbjct  65   NQETLQQRLQALIEGARESWTYAIFWQSSYDNSGASVLGWGDGYYKG-EEDKGKGR-MKN  122

Query  343  QTSHSTQQSERKKVISGIQALIG---STQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  513
              S + +Q  RKKV+  + +LI    S  +    + +TD EWF+++S+ +SF  G G+PG
Sbjct  123  SASSAAEQEHRKKVLRELNSLIAGPSSVADDAVDEEVTDTEWFFLVSMTQSFVNGSGLPG  182

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A   G  VW++G+ RL    CERA++ Q+ G+QTLVCIP+  GVVELGS E
Sbjct  183  QALFNGRPVWVAGSERLGTSPCERARQGQVFGLQTLVCIPSANGVVELGSTE  234



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 111/169 (66%), Gaps = 5/169 (3%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            +LQQRLQ +++   +SW YAIFWQ+S D      L WGDG+++G +    G   +   +S
Sbjct  81   SLQQRLQALIEGARESWTYAIFWQSSYDYSATTVLGWGDGYYKGEE--DKGKAKLKASSS  138

Query  352  HSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPGKAF  522
               +Q  RKKV+  + +LI GS   +++   + +TD EWF+++S+ +SF  G G+PG+AF
Sbjct  139  SVAEQEHRKKVLRELNSLISGSAAPTDDAVDEEVTDTEWFFLVSMTQSFVDGSGLPGQAF  198

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
               S VW++G  RL+   CERAK+AQ+ G+QTLVCIP+  GVVELGS E
Sbjct  199  FNSSPVWVAGPDRLESSMCERAKQAQVFGLQTLVCIPSANGVVELGSTE  247



>ref|XP_002280253.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=663

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 110/173 (64%), Gaps = 9/173 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  339
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G +  G+    P  
Sbjct  63   NQETLQQRLQALIEGARESWTYAIFWQSSVDFSGASLLGWGDGYYKGEEDKGKRKMTPSS  122

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVP  510
            V     ++Q  RKKV+  + +LI  T +S +    + +TD EWF+++S+ +SF  G G+P
Sbjct  123  V-----SEQEHRKKVLRELNSLISGTASSSDDAVDEEVTDTEWFFLVSMTQSFVNGAGLP  177

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+A    S VW+ G  RL    CERA++AQ+ G+QT+VCIP+  GVVELGS E
Sbjct  178  GQALFNSSPVWVVGTERLMSSPCERARQAQVFGLQTMVCIPSANGVVELGSTE  230



>ref|XP_002299425.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
 gb|EEE84230.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
Length=471

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 24/177 (14%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q   STLQQRLQF L ++ + W Y+IFWQ S D  GRL L+ GDG F+G K         
Sbjct  18   QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRLVLSLGDGHFRGNKK--------  69

Query  337  VVQTSHSTQQS--------ERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFS  492
               +  S +Q+        ERK + +    +    +    GD+   AEW+Y +S+ R+F+
Sbjct  70   -YASKESNKQNHSKFGFNLERKSLFNEDMDMDRLVE----GDV---AEWYYTVSVTRAFA  121

Query  493  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             GDG+ G+AFS G+ +WL+G H LQ+Y+CER KEA++HGIQT VC+ T +GV+ELGS
Sbjct  122  VGDGILGRAFSSGAFIWLTGDHELQIYDCERVKEARMHGIQTFVCVSTPSGVLELGS  178



>ref|XP_010104300.1| hypothetical protein L484_023250 [Morus notabilis]
 gb|EXB99720.1| hypothetical protein L484_023250 [Morus notabilis]
Length=683

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 114/176 (65%), Gaps = 11/176 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  339
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G +  GRG      
Sbjct  79   NQETLQQRLQALIEGARESWTYAIFWQSSYDYSGASVLGWGDGYYKGDEEKGRGKSK---  135

Query  340  VQTSHSTQQSERKKVISGIQALI-GSTQNSENG-----DLITDAEWFYVMSLARSFSAGD  501
              TS + +Q  RKKV+  + +LI GS  ++++      + +TD EWF+++S+ +SF  G 
Sbjct  136  -TTSSAAEQEHRKKVLRELNSLISGSAPSADDSVDAVDEEVTDTEWFFLVSMTQSFVNGG  194

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+PG+AF   S VW++GA  L    CERA++ QI G+QT+VCIP+  GVVELGS E
Sbjct  195  GLPGQAFFNSSPVWVAGADSLGSSTCERARQGQIFGLQTIVCIPSENGVVELGSTE  250



>ref|XP_010275210.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=666

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 8/172 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G +      V V  
Sbjct  62   NQDTLQQRLQTLIEGARESWTYAIFWQSSVDMSGASLLGWGDGYYKGEEDKMKRRVTV--  119

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSEN---GDLITDAEWFYVMSLARSFSAGDGVPG  513
                  +Q  RKKV+  + +LI     S +    + +TD EWF+++S+ +SF  G G+PG
Sbjct  120  ---SPAEQEHRKKVLRELNSLISGVPASADEPVDEEVTDTEWFFLVSMTQSFINGSGLPG  176

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S VWL+G  RL   +CERA++ QI G++T+VCIP+  GVVELGS E
Sbjct  177  QAFFASSPVWLAGGERLASSSCERARQGQIFGLRTMVCIPSANGVVELGSTE  228



>gb|ACF05947.1| MYC1 [Hevea brasiliensis]
Length=476

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 113/191 (59%), Gaps = 7/191 (4%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLA  279
            MDEL  TS SSSS   S  Q ++  LQQRLQFIL+++ + W YAIFWQ S D  GRL L+
Sbjct  6    MDEL--TSPSSSSSFMSFCQDSYPPLQQRLQFILQSRPEWWVYAIFWQASKDATGRLVLS  63

Query  280  WGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLITD  450
            WGDG F+GT+           Q        ERK      Q L       +   + D I D
Sbjct  64   WGDGHFRGTEEFAAKACCKQNQLKFGFNL-ERKMTNKESQTLFSDDMEMDRLADVDAI-D  121

Query  451  AEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  630
             EWFY +S+ RSF+  DG+ GK F   + + L+G H LQMY CER KEA++HG+QTLVCI
Sbjct  122  YEWFYTVSVTRSFAVEDGILGKTFGSWAFIXLTGNHELQMYECERVKEARMHGVQTLVCI  181

Query  631  PTGAGVVELGS  663
             T  GVVELGS
Sbjct  182  STTCGVVELGS  192



>ref|XP_006368399.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP64968.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=647

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 108/173 (62%), Gaps = 7/173 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + WAYAIFWQ+S D  G   L WGDG+++G +    G      
Sbjct  60   NQETLQQRLQTLIEGACEGWAYAIFWQSSYDYSGASVLGWGDGYYKGEEDK--GKTRTRN  117

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  510
              S + +Q  RK V+  + +LI    NS   D I    TD EWF+++S+ +SF  G G+P
Sbjct  118  SASSAVEQEHRKTVLRKLNSLIAGP-NSVTDDAIDEEVTDTEWFFLVSMTQSFVNGSGLP  176

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+A   GS VW++G+ RL    CERA++ Q+ G+QTLVCIP+ +GVVELGS E
Sbjct  177  GQALFNGSPVWVAGSERLGASPCERARQGQVFGLQTLVCIPSASGVVELGSTE  229



>ref|XP_006385657.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
 gb|ERP63454.1| phaseolin G-box binding protein PG2 [Populus trichocarpa]
Length=630

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 110/172 (64%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG++ G +  +G G  +  
Sbjct  64   NQETLQQRLQALIEGARESWTYAIFWQSSYDCSGASVLGWGDGYYIG-EEDKGKGR-MKN  121

Query  343  QTSHSTQQSERKKVISGIQALIG---STQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  513
              S + +Q  RKKV+  + +LI    S  +    + +TD EWF+++S+ +SF  G G+PG
Sbjct  122  SASSAAEQEHRKKVLRELNSLIAGPSSVTDDAVDEEVTDTEWFFLVSMTQSFVNGSGLPG  181

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A   GS VW++G+ RL    CERA++ Q+ G+QTLVCIP+  GVVELGS E
Sbjct  182  QALFNGSPVWVAGSERLGTSPCERARQGQVFGLQTLVCIPSANGVVELGSTE  233



>gb|KJB37703.1| hypothetical protein B456_006G216700 [Gossypium raimondii]
Length=656

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 113/172 (66%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   D W YAIFWQ+S D  G   L WGDG+++G +  +G G     
Sbjct  75   NQETLQQRLQALIEGARDCWTYAIFWQSSYDYSGATVLGWGDGYYKGEE-DKGKGESKAC  133

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S + +Q  RKKV+  + +LI GST  +++   + +TD EWF+++S+ +SF  G G+PG
Sbjct  134  SSSVA-EQEHRKKVLRELNSLISGSTATADDAVDEEVTDTEWFFLVSMTQSFVTGSGLPG  192

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A    S VW++G+ RL    CERA++ Q+ G+QT+VCIP+  GVVELGS E
Sbjct  193  QALFNSSPVWVAGSDRLASSMCERARQGQLFGLQTIVCIPSVNGVVELGSTE  244



>ref|XP_010273162.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
 ref|XP_010273163.1| PREDICTED: transcription factor MYC2-like [Nelumbo nucifera]
Length=658

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 108/172 (63%), Gaps = 8/172 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G +      V V  
Sbjct  62   NQETLQQRLQTLIEGARESWTYAIFWQSSVDISGASLLGWGDGYYKGEEDKMKRKVTV--  119

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVPG  513
                  +Q  RKKV+  + +LI     S +  +   +TD EWF+++S+ +SF  G G+PG
Sbjct  120  ---SPAEQEHRKKVLRELNSLISGAPPSADDTVDEEVTDTEWFFLVSMTQSFINGAGLPG  176

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S +WL+G+ RL   +CERA++ QI G+QT+VCIP+  GV+ELGS E
Sbjct  177  QAFFASSPLWLAGSERLASSSCERARQGQIFGLQTMVCIPSANGVLELGSTE  228



>gb|KDP25207.1| hypothetical protein JCGZ_20363 [Jatropha curcas]
Length=482

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 103/177 (58%), Gaps = 10/177 (6%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            P+   +QQRLQ+IL+   + W YAIFWQ S D  GRL L+WGDG F+G+        P  
Sbjct  17   PHPLPIQQRLQYILQNHPEWWLYAIFWQASKDASGRLVLSWGDGSFRGSNKDFAATRPNK  76

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLARSFSAG  498
                    Q ERK+  S +         SEN DL       +T+ +WFY +S+ RSFS G
Sbjct  77   HNQFKFGFQLERKR--SSVNKDQLQYLFSENVDLDRLGDVDVTEDDWFYTVSVTRSFSVG  134

Query  499  DGVPGKAFSMGS-LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSL  666
            DG+ G+AF   S  +WLSG   LQ+Y CER KEA +HGI+TL CI T  GVVELGS 
Sbjct  135  DGILGRAFITPSGFIWLSGDRDLQLYECERVKEASMHGIKTLACISTSCGVVELGSF  191



>ref|XP_006830285.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
 gb|ERM97701.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
Length=459

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 104/169 (62%), Gaps = 8/169 (5%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL-FLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            LQQ L  +L T+T+ W YAIFW+ S+D   +   L WG+GFF+G   G          T 
Sbjct  24   LQQSLHHLLNTRTEWWEYAIFWEASHDSLPQAPVLVWGEGFFRGPTDGCNPSQ----MTK  79

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVPGKAF  522
               QQ ERKKV+  +QA++    + +   L   ++D EWFY++SL +SF   +G+P   F
Sbjct  80   SEAQQMERKKVLRDLQAMMEVDPDGDGFSLDSDVSDLEWFYMVSLTKSFMGAEGLPAHVF  139

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
              G  +WL+G+H +Q YNCER KEA +HGIQ++ CIP   GV+ELGS++
Sbjct  140  VAGRPIWLTGSHSIQSYNCERTKEAHLHGIQSMACIPIANGVLELGSMD  188



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 100/159 (63%), Gaps = 27/159 (17%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  393
            D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  41   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  83

Query  394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG-------VPGKAFSMGSLVWLSG  552
             + +   T ++ N   I DAEWFYV+SL R+F+  +        +PGK+F++GS++WL+ 
Sbjct  84   KKFMRAPTNDTNN---INDAEWFYVVSLTRTFAVNNNASSSSSSLPGKSFALGSVLWLNN  140

Query  553  AHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             H LQ YNCER+ EAQ+HGI+TL+CIPT  GVVE+GS +
Sbjct  141  MHELQFYNCERSNEAQVHGIETLICIPTQNGVVEMGSYD  179



>ref|XP_003516794.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=637

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 111/174 (64%), Gaps = 8/174 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ +++   +SW YAIFWQ+S D   G   L WGDG+++G   K    G  P
Sbjct  60   NQETLQQRLQTLIEGARESWTYAIFWQSSYDYSSGTSLLGWGDGYYKGEEDKVKAKGKTP  119

Query  334  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGV  507
               +T+ S +Q  RKKV+  + +LI G + + ++ D  +TD EWF+++S+ +SF  G G+
Sbjct  120  ---KTTSSAEQDHRKKVLRELNSLISGPSASVDDVDEEVTDTEWFFLVSMTQSFVNGSGL  176

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+AF   S VW++G  RL    CERA + Q+ G+QTLVCIP+  GVVEL S E
Sbjct  177  PGQAFFNSSPVWVAGPDRLSESVCERAHQGQMFGLQTLVCIPSANGVVELASTE  230



>ref|XP_004148739.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 ref|XP_004164415.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN55759.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=661

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 111/172 (65%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ ++    +SW YAIFWQ+S D  G   L WGDG+++G +    G   +V 
Sbjct  69   NQETLQQRLQALIDGARESWTYAIFWQSSYDYSGGSVLGWGDGYYKGEEDKGKGKAKMV-  127

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
              S + +Q+ RKKV+  + +LI GS    ++   + +TD EWF+++S+ +SF  G G+P 
Sbjct  128  --SSAAEQAHRKKVLRELNSLISGSAAGPDDAVDEEVTDTEWFFLVSMTQSFVNGVGLPS  185

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   + +W+SGA RL    CERA++ ++ G+QT+VCIP+  GVVE+GS E
Sbjct  186  QAFYHSTPIWVSGADRLSASACERARQGRVFGLQTMVCIPSPNGVVEMGSTE  237



>ref|XP_003531962.1| PREDICTED: transcription factor MYC2 [Glycine max]
Length=654

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 111/172 (65%), Gaps = 4/172 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ +++   +SW YAIFWQ+S D   G   L WGDG+++G +  +       
Sbjct  67   NQETLQQRLQTLIEGACESWTYAIFWQSSYDYSSGTSLLGWGDGYYKG-EEDKDKVKTKA  125

Query  340  VQTSHSTQQSERKKVISGIQALI-GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGVPG  513
             +T  S +Q  RKKV+  + +LI G + ++++ D  +TD EWF+++S+ +SF  G G+PG
Sbjct  126  PKTRSSAEQDHRKKVLRELNSLISGPSASADDIDEEVTDTEWFFLVSMTQSFVNGSGLPG  185

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S VW++G  RL    CERA++ Q+ G+QTLVCIP+  GVVEL S E
Sbjct  186  QAFFNSSPVWVAGPERLSESACERARQGQLFGLQTLVCIPSANGVVELASAE  237



>emb|CDP08631.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 94/165 (57%), Gaps = 48/165 (29%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            S+LQ  LQ+IL+TQ+D WAYAIFWQ+SND              Q       G V   V  
Sbjct  32   SSLQLNLQYILQTQSDCWAYAIFWQSSND--------------QTDGQNDDGSVDCDV--  75

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  528
                                            TDAEWFYVMSLA+SF A DG PGKAFS 
Sbjct  76   --------------------------------TDAEWFYVMSLAQSFFADDGAPGKAFSS  103

Query  529  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+LVWL+G  +LQ YNC+RA+EAQIHGI+TLVCIPT  GV+ELGS
Sbjct  104  GNLVWLTGGQQLQFYNCQRAREAQIHGIETLVCIPTAGGVLELGS  148



>ref|XP_011018569.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=647

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G +    G      
Sbjct  60   NQETLQQRLQTLIEGACEGWTYAIFWQSSYDYSGASVLGWGDGYYKGDEDK--GKTRTKN  117

Query  343  QTSHSTQQSERKKVISGIQALIG---STQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  513
              S + +Q  RK V+  + +LI    S  +    + +TD EWF+++S+ +SF  G G+PG
Sbjct  118  SASSAVEQEHRKTVLRKLNSLIAGPSSVTDDAIDEEVTDTEWFFLVSMTQSFVNGSGLPG  177

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A   GS VW++G+ RL    CERA++ Q+ G+QTLVCIP+ +GVVELGS E
Sbjct  178  QALFNGSPVWVAGSERLGASPCERARQGQVFGLQTLVCIPSASGVVELGSTE  229



>ref|XP_008448683.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=662

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 111/172 (65%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ ++    +SW YAIFWQ+S D  G   L WGDG+++G +    G   +V 
Sbjct  69   NQETLQQRLQALIDGARESWTYAIFWQSSYDYSGGSVLGWGDGYYKGEEDKGKGKAKMV-  127

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
              S + +Q+ RKKV+  + +LI GS    ++   + +TD EWF+++S+ +SF  G G+P 
Sbjct  128  --SSAAEQAHRKKVLRELNSLISGSAAGPDDAVDEEVTDTEWFFLVSMTQSFVNGVGLPS  185

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   + +W+SGA RL    CERA++ ++ G+QT+VCIP+  GVVE+GS E
Sbjct  186  QAFYHSTPIWVSGADRLSASACERARQGRVFGLQTMVCIPSPNGVVEMGSTE  237



>ref|XP_002519814.1| Transcription factor AtMYC2, putative [Ricinus communis]
 gb|EEF42418.1| Transcription factor AtMYC2, putative [Ricinus communis]
Length=663

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   +SW YAIFWQ+S D  G   L WGDG+++G +    G      
Sbjct  69   NQETLQQRLQALIEGARESWTYAIFWQSSYDYSGASVLGWGDGYYKGEEDKGKGKS--KS  126

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI G T  +++   + +TD EWF+++S+ +SF  G G+PG
Sbjct  127  TSSSIAEQEHRKKVLRELNSLISGPTAITDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPG  186

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF  GS VW++G  RL   +CERA++ QI G+QTLVCIP+  GVVELGS E
Sbjct  187  QAFFNGSPVWVAGLERLASSSCERARQGQIFGLQTLVCIPSANGVVELGSTE  238



>ref|XP_004148475.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
Length=688

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G +     G     
Sbjct  73   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKGEE---DKGKEKAK  129

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI  +  SE     +++TD EWFY++S+ +SF +G G+PG
Sbjct  130  SSSSIAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFISGVGLPG  189

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +AF   + +W++G+ RL    CERA++ Q+ G+QT+VCIP+  GVVELGS
Sbjct  190  QAFFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGS  239



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 104/173 (60%), Gaps = 7/173 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ ++    +SW YAIFWQ+S D  G   L WG+GF+   K  R        
Sbjct  78   NQETLMQRLQALIDGARESWTYAIFWQSSYDYSGAAVLGWGEGFY---KDERDKVKAKAK  134

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  510
             T+ + +Q  RKKV+  + +LI     S + D +    TD EWF+++S+ +SF  G G+P
Sbjct  135  TTTSAAEQEYRKKVLRDLNSLISGADTSADDDAVDQEVTDTEWFFLVSMTQSFVNGGGLP  194

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+AF   + VW++G  RL    CERA++ Q+ G+QT+VC+PT  GVVELGS E
Sbjct  195  GQAFFHSTPVWVAGPDRLAASPCERARQGQVFGLQTMVCVPTANGVVELGSTE  247



>ref|XP_004166734.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC4-like 
[Cucumis sativus]
Length=686

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G +     G     
Sbjct  72   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKGEE---DKGKEKAK  128

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI  +  SE     +++TD EWFY++S+ +SF +G G+PG
Sbjct  129  SSSSIAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFISGVGLPG  188

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +AF   + +W++G+ RL    CERA++ Q+ G+QT+VCIP+  GVVELGS
Sbjct  189  QAFFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGS  238



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G +     G     
Sbjct  64   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKGEE---DKGKEKAK  120

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI  +  SE     +++TD EWFY++S+ +SF +G G+PG
Sbjct  121  SSSSIAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFISGVGLPG  180

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +AF   + +W++G+ RL    CERA++ Q+ G+QT+VCIP+  GVVELGS
Sbjct  181  QAFFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGS  230



>gb|ACN21638.1| putative basic helix-loop-helix protein BHLH22 [Lotus japonicus]
Length=641

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   ++W YAIFWQ S D  G   L WGDG+++G +           
Sbjct  30   NQDTLQQRLQALIEGARETWTYAIFWQPSYDYSGTSLLGWGDGYYKGEEDKAKAKAKAKA  89

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  510
            + + S +Q  R+KV+  + +LI  +    + D +    TD EWF+++S+ +SF  G G+ 
Sbjct  90   KATSSAEQEHRRKVLRDLNSLISGSSAPASDDAVDEEVTDTEWFFLVSMTQSFVNGGGLA  149

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+A+   + VW++GA RL    CERA++ Q+ GIQTLVC+P+  GVVELGS E
Sbjct  150  GQAYFNSTPVWVAGADRLAASACERARQGQLFGIQTLVCVPSANGVVELGSTE  202



>ref|XP_006352213.1| PREDICTED: transcription factor ATR2-like [Solanum tuberosum]
Length=456

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 107/169 (63%), Gaps = 15/169 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            QPN  TLQ+ LQ+I+  + + W YAIFWQ S D + RL L+WGDG F+GTK   G    +
Sbjct  13   QPN--TLQKILQYIIHNRQEWWVYAIFWQASKDVNNRLILSWGDGHFRGTKDTIGSA-KI  69

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  516
                 H   Q ++K   +GI        N  N + +TD EWFY++S+ + F A D +  +
Sbjct  70   GYDQYH---QLQKKFGFNGI--------NDTNNN-VTDTEWFYMVSMPQCFVAEDELVLR  117

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            A++  S VWL+  + LQ+YNCERAKEA +HGI+T+VCI T +GVVELGS
Sbjct  118  AYTSASHVWLASYYELQLYNCERAKEANLHGIRTIVCISTTSGVVELGS  166



>gb|ABR16623.1| unknown [Picea sitchensis]
Length=582

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 112/179 (63%), Gaps = 10/179 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            +  TLQQRLQ +++T +  W YAIFWQ S +  G + L WGDG+++G++         + 
Sbjct  15   SQETLQQRLQTLVETASIVWTYAIFWQVSYESSGAIQLCWGDGYYKGSRNTEEDERLRMR  74

Query  343  Q--TSHSTQQSERKKVISGIQALI-----GSTQNSEN---GDLITDAEWFYVMSLARSFS  492
               T     Q  RKKV+  + ++I     G+ Q++ +    + +TDAEWFY++S+ +SF 
Sbjct  75   SRLTVSPADQELRKKVLRDLHSMISGSDEGNQQDNSSVSVDEEVTDAEWFYLISMMQSFL  134

Query  493  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +G GVPG AFS G+ VW+ GA RL++  CERA++A   GIQTLVC+P   GVVE GS E
Sbjct  135  SGFGVPGTAFSTGAPVWIVGAERLRVSTCERARQAHDLGIQTLVCVPIQGGVVEFGSTE  193



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 104/173 (60%), Gaps = 7/173 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF+   K  R  G     
Sbjct  78   NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGGTVLGWGEGFY---KDERDKGKAKAK  134

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  510
             T+ +  Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+P
Sbjct  135  TTTSAADQEYRKKVLRELNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVPGGGLP  194

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+AF   + VW++G  RL    CERA++ Q  G+QTLVC+PT  GVVELGS E
Sbjct  195  GQAFFHSTPVWVAGPDRLAASPCERARQGQAFGLQTLVCVPTANGVVELGSTE  247



>ref|XP_008803328.1| PREDICTED: transcription factor MYC3-like [Phoenix dactylifera]
Length=438

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 105/169 (62%), Gaps = 24/169 (14%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
             TLQ RLQ +L ++ + WAYAI W+ S  +D    L+WGDG+F+G    R   +P     
Sbjct  31   PTLQLRLQCLLHSRPEWWAYAILWRPSAAEDRPAVLSWGDGYFRGP---RDADLP-----  82

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--VPGKAF  522
                +++ R + I           ++ +G  +TD EWFYV+SL RSF+AGD   VP  AF
Sbjct  83   ----RKAARNEPIG----------SAADGCGVTDMEWFYVLSLTRSFAAGDTATVPTSAF  128

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
               S VWL+GAH LQ+  CERA+EAQ+HGI+TLVC+P G GV+ELGS E
Sbjct  129  GSLSPVWLAGAHALQVCGCERAREAQLHGIETLVCVPAGEGVLELGSAE  177



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 111/175 (63%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KAGR   V 
Sbjct  78   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPFVLGWGDGYYKGEEDKAGRKLAVS  137

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  138  ---SPAYIAEQEHRKKVLRELNSLISCTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  194

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  195  LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  249



>ref|XP_006601141.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=293

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 115/168 (68%), Gaps = 5/168 (3%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            LQ+RLQ +L+   +SW YAIFW++S+D+  G   L WGDG++QG +  +  G     +T+
Sbjct  38   LQRRLQTLLEGARESWTYAIFWESSHDNFSGATLLRWGDGYYQGEEEDKAKGK--APKTT  95

Query  352  HSTQQSERKKVISGIQALI-GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGVPGKAFS  525
             S +Q+ RKKV+  + +LI G + ++++ D  +TD  WF+++S+ +SF+ G  +PG+AF 
Sbjct  96   TSAEQARRKKVLLELNSLISGPSVSADDVDEEVTDTVWFFLLSMTQSFANGTTLPGQAFF  155

Query  526  MGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
              + VW++G+ RL    CERA++ +++G++TLVCIP+  GVVEL S E
Sbjct  156  NSTPVWVAGSDRLSELACERARQGRMYGLRTLVCIPSANGVVELASTE  203



>ref|XP_009775258.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=425

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 110/191 (58%), Gaps = 51/191 (27%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN--DDDGRLF  273
            MDELI  SS S+SI+    QP  ST QQRLQ+ILK+QT+ WAYAIFWQT++  D++G  F
Sbjct  1    MDELIFPSSFSASISQEN-QP--STFQQRLQYILKSQTNCWAYAIFWQTTSNKDNNGSFF  57

Query  274  LAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDA  453
            L  GDG FQG+                                               D 
Sbjct  58   LTCGDGHFQGSNK---------------------------------------------DV  72

Query  454  EWFYVMSLARSFSAGDGVPGKAF-SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  630
            EWFYV+SLA+S+S  +GV GKAF S  S VWL+GA  LQ  +CERAKEAQ +G++TLVC+
Sbjct  73   EWFYVLSLAKSYSGNEGVIGKAFTSTASFVWLTGAQLLQFCSCERAKEAQYNGVKTLVCV  132

Query  631  PTGAGVVELGS  663
            P   GV+ELGS
Sbjct  133  PISNGVLELGS  143



>ref|XP_007156435.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
 gb|ESW28429.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
Length=642

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 112/172 (65%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL-FLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ +++   +SW YAIFWQ+S D       L WGDG+++G +    G  P  
Sbjct  68   NQETLQQRLQTLIEGAEESWTYAIFWQSSYDYSSSTSLLGWGDGYYKGEEDKGKGKAP--  125

Query  340  VQTSHSTQQSERKKVISGIQALI-GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGVPG  513
             +   S +Q  RKKV+  + +LI G + ++++ D  ++D EWF+++S+ +SF +G G+PG
Sbjct  126  -KEMSSAEQDHRKKVLRELNSLISGPSASADDVDEEVSDTEWFFLVSMTQSFLSGSGLPG  184

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S VW++GA RL    CERA++ Q+ G+QTLVCIP+  GVVEL S E
Sbjct  185  QAFLNSSPVWVAGADRLSDSTCERARQGQVFGLQTLVCIPSANGVVELASTE  236



>gb|KJB21076.1| hypothetical protein B456_003G182100 [Gossypium raimondii]
Length=549

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 109/172 (63%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  +LQQRLQ +L+   + W YAIFWQ+S D  G   L WGDG+++G +          +
Sbjct  43   NQDSLQQRLQALLEGVRNCWTYAIFWQSSYDYAGAAVLGWGDGYYKGEEDKEKAKSKASL  102

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             T    +Q  R+KV+  + +LI GST  +++   + +TD EWF+++S+ +SF  G+G+PG
Sbjct  103  STI--AEQQHRRKVLRELNSLISGSTATTDDAVDEEVTDTEWFFLVSMTQSFVNGNGLPG  160

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF     VW++G+ RL    CERAK+ ++ G+QT+VCIP   GVVELGS E
Sbjct  161  QAFFNSCPVWVAGSDRLANSTCERAKQGRVFGLQTIVCIPLANGVVELGSSE  212



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 111/174 (64%), Gaps = 7/174 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            +  TLQQRLQ +++   +SW Y IFWQTS D   G  FL WGDG+++G +  +      V
Sbjct  58   SQETLQQRLQALIEGARESWTYGIFWQTSVDGATGAYFLGWGDGYYKGCEEDKRKQR--V  115

Query  340  VQTSHSTQQSERKKVISGIQALI---GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGV  507
                 + +Q  R++V+  + +LI   GS+   E  D  +TD EWF+++S+ +SF  G G 
Sbjct  116  ANAVSAVEQEHRRRVLRELHSLISGGGSSAPDETVDEEVTDTEWFFLVSMTQSFVNGGGF  175

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A   G+ VW++GA RL    CERA++AQ+ G+QT+VC+P G+GV+ELGS +
Sbjct  176  PGQALFAGAPVWVAGADRLASAPCERARQAQLFGLQTMVCVPVGSGVLELGSTD  229



>gb|ACM48567.1| JAMYC [Taxus cuspidata]
Length=660

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 110/183 (60%), Gaps = 16/183 (9%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-------AGRG  321
            N  TLQQRLQ +++  + SW YAIFWQ S+D +  + L WGDG+++G +       A + 
Sbjct  63   NQDTLQQRLQALVEGASASWTYAIFWQISSDPENAMVLGWGDGYYKGPRDLTDEESASKR  122

Query  322  GGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-------ITDAEWFYVMSLA  480
                     + ++ Q  RKKV+  +  LI    + E  D+       +TD EWFY++S+ 
Sbjct  123  VSASSSAFEATASDQELRKKVLRDLHTLINP--DIEMTDISSTVDGEVTDEEWFYLVSMM  180

Query  481  RSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELG  660
            +SF  G GVPG+AF   + +W++G   L  YNC+RA++AQ  GI+TLVCIP+  GVVELG
Sbjct  181  QSFVNGCGVPGQAFFTATPIWITGPETLHAYNCDRARQAQQFGIRTLVCIPSPNGVVELG  240

Query  661  SLE  669
            S +
Sbjct  241  STD  243



>ref|XP_009592442.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=439

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 110/190 (58%), Gaps = 47/190 (25%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNH-STLQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLF  273
            M+E+I  ++SS S  A +SQ N  STLQQ+L++IL +QTDSWAY IFWQTSN+D+ G L 
Sbjct  1    MNEVIFPATSSFSTPALISQENQPSTLQQKLKYILNSQTDSWAYTIFWQTSNEDNNGSLL  60

Query  274  LAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDA  453
            L WGDG FQGT                                               D 
Sbjct  61   LTWGDGHFQGTNK---------------------------------------------DI  75

Query  454  EWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIP  633
            EWFYV+SLA+S+S  +GV GK FS  + VWL+GA ++Q  +CERAKEAQ +G++TLV + 
Sbjct  76   EWFYVLSLAQSYSVNEGVIGKVFSTATFVWLTGAQQVQFCSCERAKEAQNNGVKTLVYVS  135

Query  634  TGAGVVELGS  663
               GV+ELGS
Sbjct  136  ISNGVLELGS  145



>gb|KJB51639.1| hypothetical protein B456_008G226300 [Gossypium raimondii]
Length=646

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 109/172 (63%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G +     G   + 
Sbjct  80   NQETLQQRLQALIEGAHECWTYAIFWQSSYDYSGPAVLGWGDGYYKGEE---DKGKRKLK  136

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI GST  +++   + +TD EWF+++S+ +SF  G G+PG
Sbjct  137  TSSAVAEQEHRKKVLRELNSLISGSTAPTDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPG  196

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A    + VW+ G+ RL    CER ++ Q+ G+QT+VCIP+  GVVELGS E
Sbjct  197  QALFNSTPVWVVGSERLASSTCERVRQGQVFGLQTMVCIPSANGVVELGSTE  248



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/178 (42%), Positives = 113/178 (63%), Gaps = 17/178 (10%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR------LFLAWGDGFFQGT---KAGRGG  324
            TLQQRLQ +++   +SW YA+FWQ S+D  G         L+WGDG+++G    K+ +  
Sbjct  61   TLQQRLQALIEGARESWTYAVFWQLSHDFAGEDISNTAALLSWGDGYYKGEEERKSRKRK  120

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSEN--GDL-ITDAEWFYVMSLARSFSA  495
              PV      + +Q  RK+VI  + +LI          GD  ++D EWF+++S+ +SF+ 
Sbjct  121  PNPV-----SAAEQEHRKRVIRELNSLISGGGGGGGTAGDEDVSDTEWFFLVSMTQSFAN  175

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G G+PG+AFS    +WLSG++ L   +CERA++ Q++G++T+VCIPT  GVVELGSLE
Sbjct  176  GSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVELGSLE  233



>ref|XP_009623539.1| PREDICTED: transcription factor MYC3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=448

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 97/163 (60%), Gaps = 40/163 (25%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQ  LQ+++K+Q D WAYAIFWQTS DD+G+ FLAWGDG+FQG K   GG       +S 
Sbjct  71   LQHMLQYVIKSQPDWWAYAIFWQTSTDDEGKPFLAWGDGYFQGAK---GGAAVNNKGSSS  127

Query  355  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  534
               QSERKKVI GIQALI    + +N +L+ D                            
Sbjct  128  DAAQSERKKVIRGIQALI----DGDNNNLMDD----------------------------  155

Query  535  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
                 GA + Q+Y+CERAKEAQIHGIQTL+CIPT  GV+ELGS
Sbjct  156  -----GAAQFQVYSCERAKEAQIHGIQTLLCIPTSNGVLELGS  193



>ref|XP_011022409.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=463

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 103/171 (60%), Gaps = 12/171 (7%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q   STLQ+RLQF L ++ + W Y+IFWQ S D  GR  L+WGDG F+G K         
Sbjct  18   QETSSTLQKRLQFFLYSRPEWWVYSIFWQASKDASGRPVLSWGDGHFRGNKK--------  69

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD--AEWFYVMSLARSFSAGDGVP  510
                S  + +    K    I+     T++++   L+    AEW+Y +S+ R F+ GDG+ 
Sbjct  70   --YASKDSNKQNHPKFGFNIERKSLFTEDTDMDRLVDGDVAEWYYTVSVTRVFAVGDGIL  127

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+AF+ GS +WL+G   LQ+Y CER  EA++HGIQT VC+ T +GV+ELGS
Sbjct  128  GRAFTSGSSIWLTGDPELQIYECERVTEARMHGIQTFVCVSTPSGVLELGS  178



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 109/170 (64%), Gaps = 6/170 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G +     G     
Sbjct  75   NQETLMQRLQTLIEGAQENWTYAIFWQSSYDYSGGTVLGWGDGYYKGEE---DKGKEKAK  131

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S   +Q  RKKV+  + +LI  +  SE     +++TD EWFY++S+ +SF +G G+PG
Sbjct  132  SSSSKAEQEHRKKVLRELNSLISGSPTSEADAVDEVVTDTEWFYLVSMTQSFVSGLGLPG  191

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +AF   + +W++G+ RL    CERA++ Q+ G+QT+VCIP+  GVVELGS
Sbjct  192  QAFFDSNPIWVAGSDRLASSFCERARQGQVFGLQTMVCIPSANGVVELGS  241



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 110/178 (62%), Gaps = 12/178 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G       G    +
Sbjct  65   NQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGEGEK---GKSSKI  121

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSF-----SA  495
            +TS + +Q  RKKV+  + +LI  + +S   D +    TD EWF+++S+ +SF       
Sbjct  122  KTSSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGG  181

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G G+PG+A+   S VW+SGA RL    C+RA++ Q+ G+QTLVCIP+  GVVELGS E
Sbjct  182  GGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTE  239



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 110/178 (62%), Gaps = 12/178 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ+S D  G   L WGDG+++G       G    +
Sbjct  65   NQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGEGEK---GKSSKI  121

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSF-----SA  495
            +TS + +Q  RKKV+  + +LI  + +S   D +    TD EWF+++S+ +SF       
Sbjct  122  KTSSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGG  181

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G G+PG+A+   S VW+SGA RL    C+RA++ Q+ G+QTLVCIP+  GVVELGS E
Sbjct  182  GGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTE  239



>ref|XP_007208833.1| hypothetical protein PRUPE_ppa025417mg [Prunus persica]
 gb|EMJ10032.1| hypothetical protein PRUPE_ppa025417mg [Prunus persica]
Length=474

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 111/188 (59%), Gaps = 17/188 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  327
            Q   +T QQRLQFI++ + + W YA FWQ S D + ++ L+W  G F+ +K   + R   
Sbjct  15   QETSATCQQRLQFIVQNRPEWWVYATFWQASKDSNDQISLSWAGGHFKSSKDLASKRSNK  74

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFYV--MS  474
            V    Q        ERKKVI+   A     ++ E+ D+         +TD+EWFY   +S
Sbjct  75   VMNNYQPKFGFNNVERKKVINRGCAESLFPEDLEDLDMRLVDHGVGDVTDSEWFYFYSVS  134

Query  475  LARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAG  645
            L +SF+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  G
Sbjct  135  LTQSFAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCG  194

Query  646  VVELGSLE  669
            V+EL SL+
Sbjct  195  VLELASLD  202



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  86   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANRKLAVS  145

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  146  ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  202

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  203  LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  257



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  87   NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANRKLAVS  146

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  147  ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  203

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  204  LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  258



>ref|XP_003612908.1| Transcription factor MYC2 [Medicago truncatula]
 gb|AES95866.1| basic helix loop helix (BHLH) family transcription factor [Medicago 
truncatula]
Length=236

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +        +V 
Sbjct  24   NQDTLQQRLQALIEGVKEIWTYAIFWQPSYDYSGSSLLGWGDGYYKGEEDKTKVKKSIVT  83

Query  343  QTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  513
              +   +Q  R+KV+  + +LI     T+ S   + +TD EWF+++S+ +SF    G+PG
Sbjct  84   SPA---EQEHRRKVLRELYSLISGNPVTEESPVDEEVTDMEWFFLVSMTQSFVNDGGLPG  140

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A+   + VWL G   L + +CERA++ Q HG++TLVC+P+  GV+ELGS E
Sbjct  141  QAYFNSTPVWLVGGENLVLSHCERARQGQEHGLETLVCVPSANGVLELGSTE  192



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  87   NQETLQQRLQTLIDGARETWTYAIFWQSSAVDLTSPFVLGWGDGYYKGEEDKANRKLAVS  146

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  147  ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  203

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  204  LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  258



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF+   K  R        
Sbjct  78   NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGSAILGWGEGFY---KDERDKVKAKAK  134

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  510
             T+ + +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+P
Sbjct  135  TTTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLISMTQSFVNGGGLP  194

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+AF   + VW++G  RL    CERA++ ++ G+QT+VC+PT  GVVELGS E
Sbjct  195  GQAFFHSTPVWVAGPDRLAASPCERARQGKVFGLQTMVCVPTANGVVELGSTE  247



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    F L WGDG+++G   KA R   V 
Sbjct  86   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLSSPFVLGWGDGYYKGEEDKANRKLAVS  145

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI  TQ   +  +   +TD EWF+++S+ +SF  G G
Sbjct  146  ---SPAYIAEQEHRKKVLRELNSLISGTQTGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  202

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  203  LPGQALYNSSPIWVAGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  257



>ref|NP_193522.1| transcription factor MYC4 [Arabidopsis thaliana]
 sp|O49687.1|MYC4_ARATH RecName: Full=Transcription factor MYC4; Short=AtMYC4; AltName: 
Full=Basic helix-loop-helix protein 4; Short=AtbHLH4; Short=bHLH 
4; AltName: Full=Transcription factor EN 37; AltName: 
Full=bHLH transcription factor bHLH004 [Arabidopsis thaliana]
 emb|CAA17131.1| bHLH protein-like [Arabidopsis thaliana]
 emb|CAB78790.1| bHLH protein-like [Arabidopsis thaliana]
 dbj|BAD94748.1| putative transcription factor BHLH4 [Arabidopsis thaliana]
 gb|AEE83960.1| transcription factor MYC4 [Arabidopsis thaliana]
Length=589

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 114/183 (62%), Gaps = 17/183 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTS-------NDDDGRLFLAWGDGFFQGT--K  309
            Q N   LQQRLQ +++   ++W YA+FWQ+S       N+++  + L WGDG+++G   K
Sbjct  57   QVNEDNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKGEEEK  116

Query  310  AGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQN--SENGDL-ITDAEWFYVMSLA  480
            + +    P     + + +Q  RK+VI  + +LI        E GD  +TD EWF+++S+ 
Sbjct  117  SRKKKSNP-----ASAAEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMT  171

Query  481  RSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELG  660
            +SF  G G+PG+AFS    +WLSG++ L   +CERA++ QI+G+QT+VC+ T  GVVELG
Sbjct  172  QSFVKGTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELG  231

Query  661  SLE  669
            S E
Sbjct  232  SSE  234



>gb|AAL55711.1|AF251689_1 putative transcription factor BHLH4 [Arabidopsis thaliana]
Length=589

 Score =   145 bits (367),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 114/183 (62%), Gaps = 17/183 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTS-------NDDDGRLFLAWGDGFFQGT--K  309
            Q N   LQQRLQ +++   ++W YA+FWQ+S       N+++  + L WGDG+++G   K
Sbjct  57   QVNEDNLQQRLQALIEGANENWTYAVFWQSSHGFAGEDNNNNNTVLLGWGDGYYKGEEEK  116

Query  310  AGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQN--SENGDL-ITDAEWFYVMSLA  480
            + +    P     + + +Q  RK+VI  + +LI        E GD  +TD EWF+++S+ 
Sbjct  117  SRKKKSNP-----ASAAEQEHRKRVIRELNSLISGGVGGGDEAGDEEVTDTEWFFLVSMT  171

Query  481  RSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELG  660
            +SF  G G+PG+AFS    +WLSG++ L   +CERA++ QI+G+QT+VC+ T  GVVELG
Sbjct  172  QSFVKGTGLPGQAFSNSDTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATENGVVELG  231

Query  661  SLE  669
            S E
Sbjct  232  SSE  234



>ref|XP_008786336.1| PREDICTED: transcription factor MYC2-like [Phoenix dactylifera]
Length=680

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 110/175 (63%), Gaps = 10/175 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRL  +++   ++W YAIFWQ+S D   G   L WGDGF++G +  +       
Sbjct  61   NQETLQQRLLTLIEGARETWTYAIFWQSSVDVASGASLLGWGDGFYKGCEEDKRKQKAAA  120

Query  340  VQTSHSTQQSERKKVISGIQALIG-----STQNSENGDLITDAEWFYVMSLARSFSAGDG  504
             +     +Q  RK+V+  + +LI      S+ +    + +TD EWF+++S+A+SF  GDG
Sbjct  121  SRE----EQEHRKRVLRELNSLISGGAGVSSPDEAVEEEVTDTEWFFLVSMAQSFGVGDG  176

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    +  W++GA RL M  CERA++AQ+ G+QT+VC+P G+GV+ELGS +
Sbjct  177  LPGQALFAEAPTWIAGADRLAMAPCERARQAQLFGLQTMVCVPVGSGVLELGSTD  231



>ref|XP_010058366.1| PREDICTED: transcription factor MYC4-like [Eucalyptus grandis]
 gb|KCW72576.1| hypothetical protein EUGRSUZ_E01045 [Eucalyptus grandis]
Length=453

 Score =   144 bits (364),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 101/171 (59%), Gaps = 20/171 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQ +  IL+T+ + W Y+IFW+ S DD GRL L WGDG F+GT        P      
Sbjct  23   TLQQLVPLILQTRPEDWVYSIFWRPSIDDHGRLVLTWGDGHFRGTTRDPFPSKPTT----  78

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  531
                    K+V+   Q   G       G  I D EW+Y+ S+ RS+S+ DG+ G+AF  G
Sbjct  79   --------KRVLKEAQCPGGKLT---PGSDIDDPEWYYIFSVTRSYSSEDGILGRAFRSG  127

Query  532  SLVWLSGA--HRLQMYNC-ERAKEAQIHGIQTLVCI--PTGAGVVELGSLE  669
              +WLSG   H L+MY C ER KEA++HGIQ++VCI  P G+GV+ELGS E
Sbjct  128  GHIWLSGENRHELEMYECDERVKEARMHGIQSIVCISVPNGSGVLELGSSE  178



>gb|KEH27718.1| basic helix loop helix (BHLH) family transcription factor [Medicago 
truncatula]
Length=258

 Score =   140 bits (354),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 105/172 (61%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +        +V 
Sbjct  24   NQDTLQQRLQALIEGVKEIWTYAIFWQPSYDYSGSSLLGWGDGYYKGEEDKTKVKKSIV-  82

Query  343  QTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAGDGVPG  513
              +   +Q  R+KV+  + +LI     T+ S   + +TD EWF+++S+ +SF    G+PG
Sbjct  83   --TSPAEQEHRRKVLRELYSLISGNPVTEESPVDEEVTDMEWFFLVSMTQSFVNDGGLPG  140

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A+   + VWL G   L + +CERA++ Q HG++TLVC+P+  GV+ELGS E
Sbjct  141  QAYFNSTPVWLVGGENLVLSHCERARQGQEHGLETLVCVPSANGVLELGSTE  192



>gb|ADH04262.1| bHLH1 transcription factor [Nicotiana benthamiana]
Length=680

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 108/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D    + L WGDG+++G   KA R   V 
Sbjct  86   NQETLQQRLQTLIDGARETWTYAIFWQSSVVDLTSPILLVWGDGYYKGEEDKANRKLAV-  144

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI  TQ   N  +   +TD EWF+++S+  SF  G G
Sbjct  145  --SSPAYIAEQEHRKKVLRELNSLISGTQTGTNDAVDEEVTDTEWFFLISMTPSFVNGSG  202

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W+ GA +L   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  203  LPGQALYNSSPIWVFGAEKLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  257



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 98/170 (58%), Gaps = 31/170 (18%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TL+Q+LQF+L+ Q + W YAIFWQT+ D+   +FL WG+G F  TK         V    
Sbjct  34   TLEQKLQFLLQAQPNHWVYAIFWQTTKDERDNIFLTWGEGHFHDTKETTTTSSETVNDND  93

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----VPGKA  519
              T                       NGD    A  FY+MSL+R+FS G+     +PGKA
Sbjct  94   TCT-----------------------NGD----ALLFYIMSLSRTFSVGNSSSNSLPGKA  126

Query  520  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            F++ S++WL+  H LQ YNC+R+ EA +HGI+TL+CIPT  GV+E+GS E
Sbjct  127  FALNSVLWLNSKHELQFYNCDRSNEAHVHGIETLICIPTTNGVIEMGSYE  176



>ref|XP_008245386.1| PREDICTED: transcription factor bHLH14-like [Prunus mume]
Length=495

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 112/188 (60%), Gaps = 17/188 (9%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  327
            Q   +T QQRLQFI++ + + W YAIFWQ S D + ++ L+W  G F+ +K   + R   
Sbjct  15   QETAATCQQRLQFIVQNRPEWWVYAIFWQASKDSNDQISLSWAGGHFKSSKDLASKRSNK  74

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFYV--MS  474
            V    Q        +RKKVI+   A     ++ E+ D+         +TD+EWFY   +S
Sbjct  75   VMNNYQPKFGFNNVQRKKVINRGCAESLFHEDLEDLDMRLVDHGVGDVTDSEWFYFYSVS  134

Query  475  LARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAG  645
            L +SF+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  G
Sbjct  135  LTQSFAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCG  194

Query  646  VVELGSLE  669
            V+EL SL+
Sbjct  195  VLELASLD  202



>gb|KDP34321.1| hypothetical protein JCGZ_12669 [Jatropha curcas]
Length=674

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 113/172 (66%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRL  +++   +SW YAIFWQ+S D +G + L WGDG+++G +    G      
Sbjct  65   NQETLQQRLLTLIEGARESWTYAIFWQSSYDYNGSV-LGWGDGYYKGEEDKGKGKS--KS  121

Query  343  QTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
             +S + +Q  RKKV+  + +LI GS   +++   + +TD EWF+++S+ +SF  G G+PG
Sbjct  122  TSSSAVEQEHRKKVLRELNSLISGSNTVTDDAVDEEVTDTEWFFLVSMTQSFVNGGGLPG  181

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             AF  GS VW++G+ RL    CERA++ Q+ G+QTLVCIP+  GVVELGS E
Sbjct  182  HAFFNGSPVWVAGSDRLSASPCERARQGQVFGLQTLVCIPSANGVVELGSTE  233



>ref|XP_002303693.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
 gb|EEE78672.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
Length=465

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 104/171 (61%), Gaps = 12/171 (7%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q   STLQQRLQF L ++ + W Y+IFWQ S D  GR  L+WGDG F+G K        V
Sbjct  18   QETSSTLQQRLQFFLHSRPEWWVYSIFWQASKDASGRPVLSWGDGHFRGNKKYSSK---V  74

Query  337  VVQTSHSTQ--QSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVP  510
              + +H       ERK + +    L    +   +GD+   AEW+Y  S+ R F+ GDG+ 
Sbjct  75   SNKQNHPKFGFNIERKSLFNEDMDL----ERLVDGDV---AEWYYTASVTRVFAVGDGIL  127

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+AF+ GS +WL+G   LQ++ CER  EA++HGIQT VC+ T +GV+ELGS
Sbjct  128  GRAFTSGSSIWLTGDRELQIFECERVTEARMHGIQTFVCVSTPSGVLELGS  178



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 114/190 (60%), Gaps = 22/190 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND----DDG------RLFLAWGDGFFQGT  306
            Q N  TLQQRLQ +++   +SW YA+FWQ+S D    DDG         L WGDG+++G 
Sbjct  60   QFNEDTLQQRLQALIEGANESWTYAVFWQSSYDFAGEDDGGGESRNTAVLGWGDGYYKGE  119

Query  307  KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQ--------NSENGDL-ITDAEW  459
            +             + + +Q  R++VI  + ALI            + E GD  +TD EW
Sbjct  120  EEN---SRKKKSNPASAAEQEHRRRVIRELNALISGGGGVVNNGGGSDEAGDEEVTDTEW  176

Query  460  FYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            F+++S+ +SF +G G+PG+AFS  + +WLSG++ L   +CERA++ QI+G+QT+VC+P  
Sbjct  177  FFLVSMTQSFVSGTGLPGQAFSNSNTIWLSGSNALAGSSCERARQGQIYGLQTMVCVPCE  236

Query  640  AGVVELGSLE  669
             GVVELGS E
Sbjct  237  NGVVELGSSE  246



>ref|XP_003612909.1| BHLH transcription factor [Medicago truncatula]
 gb|AES95867.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=677

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 106/176 (60%), Gaps = 14/176 (8%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG----TKAGRGGGV  330
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G    TKA +    
Sbjct  41   NQDTLQQRLQALIEGAKEIWTYAIFWQPSYDYSGSSLLGWGDGYYKGEEDKTKAKKS---  97

Query  331  PVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAGD  501
                + +   +Q  R+KV+  + +LI     T  S   + +TD EWF+++S+ +SF  G 
Sbjct  98   ----KVTSPAEQEHRRKVLRELNSLISGNPVTDESPVDEEVTDTEWFFLVSMTQSFVNGT  153

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+PG+A+   + VWL+GA  L +  CERA++ Q HGIQTL CI +  GV+ELGS E
Sbjct  154  GLPGQAYYNSAPVWLTGAENLALSACERARQGQEHGIQTLACIRSADGVLELGSTE  209



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 113/185 (61%), Gaps = 24/185 (13%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR------LFLAWGDGFFQGT---KAGRGG  324
            TLQQRLQ +++   +SW YA+FWQ S+D  G         L+WGDG+++G    K+ +  
Sbjct  61   TLQQRLQALIEGARESWTYAVFWQLSHDFAGEDISNTAALLSWGDGYYKGEEERKSRKRK  120

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQN---------SENGDL-ITDAEWFYVMS  474
              PV      + +Q  RK+VI  + +LI               E GD  ++D EWF+++S
Sbjct  121  PNPV-----SAAEQEHRKRVIRELNSLISGGGGTVSSSGGSSDEAGDEDVSDTEWFFLVS  175

Query  475  LARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVE  654
            + +SF  G G+PG+AFS    +WLSG++ L   +CERA++ Q++G++T+VCIPT  GVVE
Sbjct  176  MTQSFVNGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVE  235

Query  655  LGSLE  669
            LGSLE
Sbjct  236  LGSLE  240



>ref|XP_009139989.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=297

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 113/189 (60%), Gaps = 28/189 (15%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSND------DDGRLFLAWGDGFFQGT---KAGRGG  324
            TLQQRLQ +++   +SW YA+FWQ S+D       D    L+WGDG ++G    K+ +  
Sbjct  61   TLQQRLQALIEGARESWTYAVFWQLSHDFAGAEIGDTAALLSWGDGCYKGEEERKSRKRK  120

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQN-------------SENGDL-ITDAEWF  462
              PV      + +Q  RK+VI  + +LI                   E GD  ++D EWF
Sbjct  121  PNPV-----SAAEQEHRKRVIRELNSLISGGGGGGGTVSSSGGGSSDEAGDEDVSDTEWF  175

Query  463  YVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  642
            +++S+ +SF+ G G+PG+AFS    +WLSG++ L   +CERA++ Q++G++T+VCIPT  
Sbjct  176  FLVSMTQSFANGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQN  235

Query  643  GVVELGSLE  669
            GVVELGSLE
Sbjct  236  GVVELGSLE  244



>ref|XP_010556617.1| PREDICTED: transcription factor bHLH14 [Tarenaya hassleriana]
Length=439

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 115/191 (60%), Gaps = 23/191 (12%)
 Frame = +1

Query  100  MDELIVTssssssitaslsQPNHS-TLQQRLQFILKTQT-DSWAYAIFWQT-SNDDDGRL  270
            MDEL V+ SSS+S+     +P  + +LQQ+L+ +++T + D WAY IFWQ  S+D  GR 
Sbjct  1    MDELRVSPSSSTSLVTVTEEPPATGSLQQKLRSVIETSSPDRWAYVIFWQKLSDDQSGRC  60

Query  271  FLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD  450
            FLAWGDG F+G               +H + Q+     +    A+ G       GD + D
Sbjct  61   FLAWGDGHFRGVH-------------NHKSHQNLTNDNMECEAAVDG-------GDSVCD  100

Query  451  AEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCI  630
             EWFYVMSL  SF  GD  P K F+ GSL+WL+GA  L++++C+RAKEA +HG+QT V +
Sbjct  101  LEWFYVMSLTSSFHDGDESPRKDFTGGSLLWLTGADDLRLHDCDRAKEASLHGVQTFVSV  160

Query  631  PTGAGVVELGS  663
            P    ++ELGS
Sbjct  161  PLRNSIIELGS  171



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 112/185 (61%), Gaps = 24/185 (13%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR------LFLAWGDGFFQGT---KAGRGG  324
            TLQQRLQ +++   +SW YA+FWQ S+D  G         L WGDG+++G    K+ +  
Sbjct  61   TLQQRLQALIEGARESWTYAVFWQLSHDFAGEDISNTAALLTWGDGYYKGEEERKSRKRK  120

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQN---------SENGDL-ITDAEWFYVMS  474
              PV      + +Q  RK+VI  + +LI               E GD  ++D EWF+++S
Sbjct  121  PNPV-----SAAEQEHRKRVIRELNSLISGGGGTVSSSGGSSDEAGDEDVSDTEWFFLVS  175

Query  475  LARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVE  654
            + +SF  G G+PG+AFS    +WLSG++ L   +CERA++ Q++G++T+VCIPT  GVVE
Sbjct  176  MTQSFVNGSGLPGRAFSSSRTIWLSGSNALAGSSCERARQGQVYGLETMVCIPTQNGVVE  235

Query  655  LGSLE  669
            LGSLE
Sbjct  236  LGSLE  240



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 97/165 (59%), Gaps = 33/165 (20%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  393
            D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  39   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  81

Query  394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG-------------VPGKAFSMGS  534
                +  T  ++N   I DAEWFYVMSL RSF+  +              +PGK+F++GS
Sbjct  82   KNKFLMKTPTNDN---INDAEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSLPGKSFALGS  138

Query  535  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            ++W +  H LQ YNCER+ EA +HGI+TL+CIPT  GVVE+GS +
Sbjct  139  VLWQNNRHELQFYNCERSNEAHVHGIETLICIPTQNGVVEMGSYD  183



>ref|XP_007210224.1| hypothetical protein PRUPE_ppa015634mg [Prunus persica]
 gb|EMJ11423.1| hypothetical protein PRUPE_ppa015634mg [Prunus persica]
Length=425

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGG  327
            Q N ST Q+RLQFI + + + W Y+IFWQ SND + ++ L+W  G F+  +     R   
Sbjct  15   QENSSTFQKRLQFIFRNRPEWWLYSIFWQASNDSNDQVSLSWAGGDFRINRDLATKRSNK  74

Query  328  VPVVVQTSHSTQQSERKKVIS-GIQAL----IGSTQNSENGDLITDAEWFYV--MSLARS  486
            V             ER+KV++  ++ L    +      ++GD +TD+EWFY   +SL ++
Sbjct  75   VVNNYNPKFGFNNVERRKVVNKDVEDLFHEDLVDLAMVDHGD-VTDSEWFYFYSVSLTQT  133

Query  487  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  657
            F AG   + V G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  134  FVAGHASNNVLGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCGVLEL  193

Query  658  GSLE  669
             SL+
Sbjct  194  ASLD  197



>ref|XP_009388411.1| PREDICTED: transcription factor MYC2 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 112/174 (64%), Gaps = 7/174 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            +  TLQQRLQ +++   +SW Y IFWQ+S D   G  FL WGDG+++G +  +      V
Sbjct  73   SQETLQQRLQALIEGARESWTYGIFWQSSVDAATGASFLGWGDGYYKGYEEDKRKQR--V  130

Query  340  VQTSHSTQQSERKKVISGIQALI---GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGV  507
               + + +Q  RK V+  + +LI   GS+   E  D  +TD EWF+++S+ +SF  G G+
Sbjct  131  AGAASAAEQEHRKCVLRELHSLISGGGSSAPDEAVDEEVTDTEWFFLVSMTQSFVNGGGL  190

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+AF  G+  W++GA RL    C+RA++AQ+ G+QT+VC+P G+GV+ELGS +
Sbjct  191  PGQAFYTGAPAWVTGADRLAAAPCDRARQAQLFGLQTMVCVPVGSGVLELGSTD  244



>gb|ACU18071.1| unknown [Glycine max]
Length=245

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 96/166 (58%), Gaps = 34/166 (20%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  393
            D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  39   DWWVYAIFWQASHDDNGSLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  81

Query  394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--------------VPGKAFSMG  531
                +  T  ++N   I DAEWFYVMSL RSF+  +               +PGK+F++G
Sbjct  82   KNKFLMKTPTNDN---INDAEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSSLPGKSFALG  138

Query  532  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            S++W +  H LQ YNCER+ EA +HGI+TL+CIPT  G VE+GS +
Sbjct  139  SVLWQNNRHELQFYNCERSNEAHMHGIETLICIPTQNGAVEMGSYD  184



>ref|XP_002868032.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44291.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 113/186 (61%), Gaps = 22/186 (12%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND----DDG-------RLFLAWGDGFFQGT-  306
            N   LQQRLQ +++   +SW YA+FWQ+S+D    DDG          L WGDG+++G  
Sbjct  58   NEDNLQQRLQALIEGANESWTYAVFWQSSHDFAGEDDGVRTNNNNTTLLGWGDGYYKGEE  117

Query  307  -KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL----ITDAEWFYVM  471
             K+ +    P     + + +Q  RK+VI  + +LI         +     +TD EWF+++
Sbjct  118  EKSRKKKSNP-----ASAAEQEHRKRVIRELNSLISGGGGGGGDEAGDEEVTDTEWFFLV  172

Query  472  SLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVV  651
            S+ +SF  G G+PG+AFS  + +WLSG++ L   +CERA++ QI+G+QT+VC+ TG GVV
Sbjct  173  SMTQSFVNGIGLPGQAFSNSNTIWLSGSNALAGSSCERARQGQIYGLQTMVCVATGNGVV  232

Query  652  ELGSLE  669
            ELGS E
Sbjct  233  ELGSSE  238



>emb|CDP13028.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 108/174 (62%), Gaps = 5/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTK-AGRGGGVPV  336
            N  TLQQRLQ ++    + W YAIFWQ+S  D  G   L WGDG+++G +  G+      
Sbjct  82   NQETLQQRLQTLIDGAQEYWTYAIFWQSSVVDYGGPSVLGWGDGYYRGEEDKGKRKNPLS  141

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENG---DLITDAEWFYVMSLARSFSAGDGV  507
               T+   +Q  RKKV+  + +LI   Q S +    + +TD EWF+++S+ +SF  G G+
Sbjct  142  SSSTNSLLEQEHRKKVLRELNSLIAGPQGSSDDAVDEEVTDTEWFFLISMTQSFVNGSGL  201

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A    S VW++GA RL   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  202  PGQALYNSSPVWVAGADRLASTHCERAQQAQGFGLQTVVCIPSANGVVELGSTE  255



>gb|KEH18599.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=454

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 93/157 (59%), Gaps = 43/157 (27%)
 Frame = +1

Query  211  TDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVIS  390
            +++W Y I WQT+ D+ G+ FL+WG+G+FQGTK           +T+ S +         
Sbjct  35   SENWIYGILWQTTKDEKGKPFLSWGEGYFQGTK-----------ETTTSNK---------  74

Query  391  GIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG----VPGKAFSMGSLVWLSGAH  558
                               DAEWFYVMSL R FS G+     +PGKAF++ S++WL+  H
Sbjct  75   -------------------DAEWFYVMSLTRKFSIGNASSISLPGKAFALDSVLWLNSKH  115

Query  559  RLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             LQ+YNCER+ EA +HGI+TL+CIPT  GV+E+GS +
Sbjct  116  ELQIYNCERSNEAHMHGIETLICIPTTNGVIEMGSYD  152



>gb|ADH04263.1| bHLH2 transcription factor [Nicotiana benthamiana]
Length=657

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 105/174 (60%), Gaps = 6/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  +LQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G +  +       
Sbjct  70   NQESLQQRLQTLIDGAREAWTYAIFWQSSVVDFTTHSVLGWGDGYYKG-EEDKNKRKTAS  128

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
                  T+Q+ RKKV+  +  LI  TQ     D +    TD EWF+++S+ +SF  G G+
Sbjct  129  FSPDFITEQAHRKKVLRELNCLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGL  188

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG A    S +W++GA RL   +CERA++AQ  G+QT+VCIP+G GVVELGS E
Sbjct  189  PGLAMYSSSPIWVTGAERLAASHCERARQAQGFGLQTIVCIPSGNGVVELGSTE  242



>ref|XP_009401251.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=690

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 108/174 (62%), Gaps = 7/174 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ ++    ++W Y IFWQ+S D   G  FL WGDG+++G +  +       
Sbjct  59   NQETLQQRLQTLIDGAGENWTYGIFWQSSVDAASGASFLGWGDGYYKGCEEDKRKQR--A  116

Query  340  VQTSHSTQQSERKKVISGIQALIG----STQNSENGDLITDAEWFYVMSLARSFSAGDGV  507
               + + +Q  RK+V+  + +LI     S Q+    + +TD EWF+++S+ +SF  GDG+
Sbjct  117  ASAASAAEQEHRKRVLRELNSLISGGGSSAQDETVEEEVTDTEWFFLVSMTQSFVNGDGL  176

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A   G+  W++G  RL    CERA++AQ+ GIQT+VC P G+GV+ELGS +
Sbjct  177  PGQALYAGAPSWVAGCDRLAAAPCERARQAQLFGIQTMVCYPVGSGVLELGSTD  230



>ref|XP_010463090.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=462

 Score =   142 bits (357),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  65   NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRSSS  124

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  125  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  180

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E
Sbjct  181  AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTE  237



>gb|AAB00686.1| phaseolin G-box binding protein PG1 [Phaseolus vulgaris]
Length=642

 Score =   143 bits (360),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 111/172 (65%), Gaps = 6/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL-FLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ +++   +SW YAIFWQ+S D       L WGDG+++G +    G  P  
Sbjct  68   NQETLQQRLQTLIEGAEESWTYAIFWQSSYDYSSSTSLLGWGDGYYKGEEDKGKGKAP--  125

Query  340  VQTSHSTQQSERKKVISGIQALI-GSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGVPG  513
             +   S +Q  RKKV+  + +LI G  +++++ D  ++D EWF+++S+ +SF +G G+PG
Sbjct  126  -KEMSSAEQDHRKKVLRELNSLISGPFRSADDVDEEVSDTEWFFLVSMTQSFLSGSGLPG  184

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   S VW++GA RL     ERA++ Q+ G+QTLVCIP+  GVVEL S E
Sbjct  185  QAFLNSSPVWVAGADRLSDSTSERARQGQVFGVQTLVCIPSANGVVELASTE  236



>ref|XP_009384727.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 108/174 (62%), Gaps = 7/174 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ +++   +SW Y IFWQ+S D   G  FL WGDG+++G +  +       
Sbjct  65   NQETLQQRLQALIEGARESWTYGIFWQSSVDAATGTSFLGWGDGYYKGCEEDKRKQR--A  122

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
              T+ +  Q  RK+V+  + +LI    +    +++    TD EWF+++S+ +SF  G G+
Sbjct  123  ASTASAADQDHRKRVLRELNSLISGGVSLAPDEIVEEEVTDTEWFFLVSMTQSFVNGAGL  182

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A   G+  W++GA RL   +CERA+ AQ+ GIQT+VC P G+GV+ELGS +
Sbjct  183  PGQALCAGAPYWIAGAGRLSAASCERARHAQLFGIQTMVCAPVGSGVLELGSTD  236



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 97/166 (58%), Gaps = 34/166 (20%)
 Frame = +1

Query  214  DSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHSTQQSERKKVISG  393
            D W YAIFWQ S+DD+G L+L++G+G FQGTK                 + S +   I  
Sbjct  39   DWWVYAIFWQASHDDNGNLYLSFGEGHFQGTK-----------------ETSPKSLTIPT  81

Query  394  IQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--------------VPGKAFSMG  531
                +  T  ++N   I DAEWFYVMSL RSF+  +               +PGK+F++G
Sbjct  82   KNKFLMKTPTNDN---INDAEWFYVMSLTRSFAVNNNSSSNSTSCSSSSSSLPGKSFALG  138

Query  532  SLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            S++W +  H LQ YNCER+ EA +HGI+TL+CIPT  GVVE+GS +
Sbjct  139  SVLWQNNRHELQFYNCERSNEAHMHGIETLICIPTQNGVVEMGSYD  184



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TL QRLQ +++   +SW YAIFWQ+S D  G   L WG+GF+   K  R        
Sbjct  74   NQETLMQRLQALIEGARESWTYAIFWQSSYDMSGASVLGWGEGFY---KDERDKVKTKPK  130

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVP  510
             T+   +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ ++F  G G+P
Sbjct  131  TTTSLVEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQNFVNGGGLP  190

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+AF   + VW++G  RL   +CERA++ Q+ G+QT+VC+PT  GVVELGS E
Sbjct  191  GQAFFHSNPVWVAGPDRLAASSCERARQGQVFGLQTMVCVPTANGVVELGSTE  243



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  65   NQETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRSSS  124

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  125  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  180

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E
Sbjct  181  AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTE  237



>ref|XP_008245388.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=493

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 109/185 (59%), Gaps = 17/185 (9%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA---GRGGGVP  333
            N +T QQRLQFI++ + + WAY+IFWQ S D + ++ L+W  G F+ ++     R   + 
Sbjct  17   NSATFQQRLQFIVQNRPEWWAYSIFWQASKDSNDQVVLSWAGGHFKSSRDFAFKRSNKMT  76

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFY--VMSLA  480
               Q        ERKKV +    ++   ++  + D+         +TD+EWFY   +SL 
Sbjct  77   NNYQPKFGFSNVERKKVNNREVEVLFDEEDMVDLDMSLVDHGVGDVTDSEWFYFYTVSLT  136

Query  481  RSFSAGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVV  651
            +SF+AG G   + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVC+ T  GV+
Sbjct  137  QSFAAGHGNNSILGRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCVATPCGVL  196

Query  652  ELGSL  666
            EL SL
Sbjct  197  ELASL  201



>gb|AEG74015.1| lMYC5 [Hevea brasiliensis]
Length=475

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 99/171 (58%), Gaps = 4/171 (2%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q +  +LQQRL  IL++    W YAIFWQ S +  G L  +WGDG F+G+K       P 
Sbjct  18   QESSPSLQQRLHVILQSCPGWWIYAIFWQVSKNASGHLVFSWGDGNFRGSKEFFTK--PS  75

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAE--WFYVMSLARSFSAGDGVP  510
                 H +  +  +K    +QAL     + +      D++  WFY  S  R+F+ G+G+ 
Sbjct  76   NTLNQHKSGFNLERKASKELQALFSDDMDMDRLADAYDSDYGWFYNASATRTFAVGEGIV  135

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+ F  G   WL+G HRLQ+Y CER KEA++HGIQTLVC+ T  GVVELGS
Sbjct  136  GQTFGSGGFTWLTGDHRLQLYRCERVKEARMHGIQTLVCVSTSCGVVELGS  186



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 107/176 (61%), Gaps = 10/176 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  333
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +     R    P
Sbjct  52   NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRTSP  111

Query  334  VVVQTSHSTQQSERKKVISGIQALI----GSTQNSENGDLITDAEWFYVMSLARSFSAGD  501
                T     Q  RKKV+  + +LI    G T ++ + + +TD EWF+++S+ +SF+ G 
Sbjct  112  PPFSTP--ADQEYRKKVLRELNSLISGGCGPTDDAVD-EEVTDTEWFFLVSMTQSFACGS  168

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+ GKAFS G+ VW+ G+ +L    CERAK+  + G+QT+ CIP+  GVVELGS E
Sbjct  169  GLAGKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGSTE  224



>gb|AIT39751.1| transcription factor MYC2, partial [Chrysanthemum boreale]
Length=648

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 108/174 (62%), Gaps = 10/174 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRLQ ++ T  +SW YAIFWQ+S  +  G   L WGDG+++G         P  
Sbjct  56   NQDTLQQRLQGLIDTAHESWTYAIFWQSSVLEYSGPPILGWGDGYYKGEP-----NKPKQ  110

Query  340  VQTSHS-TQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGV  507
            V ++ S  +Q  RKKV+  + ++I  TQ  EN  +   +TD EWF+++S+ +SF  G G+
Sbjct  111  VMSATSLAEQQYRKKVLRELNSMISGTQAPENDAVDEEVTDTEWFFLISMTQSFVNGVGL  170

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A      VW++G  RL   +CERA++ +  G+QT+VCIP+  GV+ELGS E
Sbjct  171  PGQAMVANQPVWVAGRERLMTSHCERARQGEGFGLQTIVCIPSADGVIELGSTE  224



>emb|CDP12229.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 95/164 (58%), Gaps = 28/164 (17%)
 Frame = +1

Query  178  QQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSHS  357
            +QRLQFI++ Q + W Y+IFWQ S D DGRL L+WGDG F+G K                
Sbjct  25   KQRLQFIMQNQREWWVYSIFWQASRDRDGRLVLSWGDGHFRGPK----------------  68

Query  358  TQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSL  537
               S+R K           +    +G  + D+EWFY++SL R F +G+ +  + F+ GS 
Sbjct  69   -DCSQRAK-----------SDGFGDGRDVADSEWFYMLSLTRCFVSGEDLLVRTFNSGSY  116

Query  538  VWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             WL G H+L  YNCERAKEA  HG++T VCI T  G++ELGS E
Sbjct  117  AWLVGDHQLLFYNCERAKEAHSHGVKTFVCISTSGGILELGSSE  160



>gb|AGL98100.1| transcription factor MYC2 [Nicotiana attenuata]
Length=656

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 105/174 (60%), Gaps = 6/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  +LQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G +  +       
Sbjct  70   NQESLQQRLQTLIDGAREAWTYAIFWQSSVVDFASPSVLGWGDGYYKG-EEDKNKRKTAS  128

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
                  T+Q+ RKKV+  + +LI  TQ     D +    TD EWF+++S+ +SF  G G+
Sbjct  129  FSPDFITEQAHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGL  188

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG A    S +W++GA RL   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  189  PGLAMYSSSPIWVTGAERLAASHCERARQAQGFGLQTIVCIPSANGVVELGSTE  242



>ref|XP_010434608.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=623

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 114/199 (57%), Gaps = 33/199 (17%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----------------DDGRLFLAWG  285
            Q N  TLQQRLQ +++   +SW YA+FWQ S D                 ++    L WG
Sbjct  61   QVNEDTLQQRLQALIEGANESWTYAVFWQLSYDFAGEDVEEGGVGGGGLTNNNTALLGWG  120

Query  286  DGFFQGT--KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQ--------NSENG  435
            DG+++G   K+ +    P     + + +Q  RK+V+  + ALI            + E G
Sbjct  121  DGYYKGEEEKSRKKKTKP-----ASAAEQEHRKRVVRELNALISGGGGEVVNNGGSDEAG  175

Query  436  DL-ITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGI  612
            D  +TD EWF+++S+ +SF  G G+PG+AFS  + +WLSG++ L   +CERA++ QI+G+
Sbjct  176  DEEVTDTEWFFLVSMTQSFINGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQIYGL  235

Query  613  QTLVCIPTGAGVVELGSLE  669
            QT+VC+P   GVVELGS E
Sbjct  236  QTMVCVPCENGVVELGSSE  254



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  66   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKLRQRSSS  125

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  126  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  181

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E
Sbjct  182  AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTE  238



>ref|XP_009590627.1| PREDICTED: transcription factor bHLH14-like [Nicotiana tomentosiformis]
Length=425

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 102/167 (61%), Gaps = 28/167 (17%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            +TLQ+ LQ+I+ +  + W YAIFWQ S D +GRL  +WGDG F+GTK             
Sbjct  8    NTLQKHLQYIIHSSQEWWVYAIFWQASKDANGRLIFSWGDGHFRGTKD------------  55

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  528
                        +S + A +G+T+   N   I+D E FY++S+ + F A + +  +A++ 
Sbjct  56   ------------LSNL-AKVGTTKVDNN---ISDTELFYMVSVPKYFVADNELIVRAYNP  99

Query  529  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             S +WL+  H LQ+YN +RAKEA +HGI+TLVCIPT +GVVELGS E
Sbjct  100  TSYIWLNNYHELQLYNYDRAKEAHLHGIRTLVCIPTPSGVVELGSSE  146



>ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera]
Length=468

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 108/177 (61%), Gaps = 14/177 (8%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQ---GTKAGRGGG  327
            Q N  +LQQRL FI++ + + WAYAIFWQ + D +G   L+W DG+     G+K      
Sbjct  18   QENTPSLQQRLHFIIQNRPEWWAYAIFWQPAKDPNGNHVLSWADGYCNKDLGSKDCNKLS  77

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGSTQN---SENGDLITDAEWFYVMSLARSFSAG  498
             P+           ERKKV  GI AL   +     S +GD+ T  EW+Y++S+ +SF  G
Sbjct  78   QPLF------GFDLERKKVNRGIHALFHDSSEIDGSMDGDVAT-WEWYYMVSVTKSFVVG  130

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            DGV G+ FS G+ VWL+    LQ Y+CER  EA+++GI+TL+C+ T  GV+ELGSL+
Sbjct  131  DGVLGRVFSSGAFVWLTD-RELQCYDCERVTEARMNGIRTLLCVSTSCGVLELGSLD  186



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  68   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRSSS  127

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  128  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  183

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E
Sbjct  184  AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTE  240



>gb|AAQ14332.1|AF283507_1 MYC2 [Catharanthus roseus]
Length=699

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 108/173 (62%), Gaps = 6/173 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N   LQQRLQ ++    +SW YAIFWQ+S  +  G   L WGDG+++G +    G     
Sbjct  84   NQENLQQRLQTLIDGARESWTYAIFWQSSVVEFAGPSVLGWGDGYYKGEEDK--GKRKNS  141

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVP  510
               S   +Q  RKKV+  + +LI   Q + +  +   +TD EWF+++S+ +SF +G G+P
Sbjct  142  SSASSFAEQEHRKKVLRELNSLIAGPQGTADDAVDEEVTDTEWFFLISMTQSFVSGSGLP  201

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+A    + VW++GA RL + +C+RA++AQ  G+QTLVCIP+  GVVELGS E
Sbjct  202  GQALYNSNPVWVTGAGRLAVSHCDRARQAQSFGLQTLVCIPSANGVVELGSTE  254



>ref|XP_009359541.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=481

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 107/179 (60%), Gaps = 14/179 (8%)
 Frame = +1

Query  166  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  345
            +S  QQRLQF+L+ + + W Y+IFW+ S   +  + L+W  G FQ T+           +
Sbjct  17   NSPTQQRLQFLLQNRPERWIYSIFWEASKHSNDLVSLSWAGGHFQSTRDLTSQ--KTYNK  74

Query  346  TSHSTQQS-----ERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAGD  501
             SH   +      ERK+ IS  ++AL     + + GD +TDAEWFY   +SL +SF+AG 
Sbjct  75   ISHHQPKLGFDVLERKRAISREVEALFHEDMDVDGGD-VTDAEWFYFYTVSLTQSFTAGH  133

Query  502  G---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G   + G+ F  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL SL+
Sbjct  134  GNSNILGRTFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIATSCGVLELASLD  192



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 108/179 (60%), Gaps = 12/179 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  +LQQRLQ ++    +SWAYAIFWQ+S  D   +  L WGDG+++G   K  R G   
Sbjct  56   NQESLQQRLQALIDGARESWAYAIFWQSSVVDFASQTVLGWGDGYYKGEEDKNKRRGSSS  115

Query  334  VVVQTSHSTQQSERKKV-------ISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFS  492
                 +   +Q  RKKV       ISG+QA  G+  +    + +TD EWF+++S+ +SF 
Sbjct  116  SAA--NFVAEQEHRKKVLRELNSLISGVQASAGNGTDDAVDEEVTDTEWFFLISMTQSFV  173

Query  493  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+G+PG A    S +W++G  +L    CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  174  NGNGLPGLAMYSSSPIWVTGTEKLAASQCERARQAQGFGLQTIVCIPSANGVVELGSTE  232



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 110/177 (62%), Gaps = 12/177 (7%)
 Frame = +1

Query  166  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD---GRLFLAWGDGFFQGTKAGRGGGVPV  336
            + TLQQRLQ +++   ++W YAIFWQ S D D   G   L WGDG+++G +    G   +
Sbjct  70   NETLQQRLQALIEGAPETWTYAIFWQLSYDFDAAGGTALLGWGDGYYKGEE--DKGKSNI  127

Query  337  VVQTSHSTQQSERKKVISGIQALI------GSTQNSENGDLITDAEWFYVMSLARSFSAG  498
                  + +Q  RK+VI  + ALI      G+++++ + + +TD EWF+++S+ +SF  G
Sbjct  128  RCSPESAAEQEHRKRVIRELNALISGGAVAGASEDAGD-EEVTDTEWFFLVSMTQSFLNG  186

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G PG+AF     +WLSG+  L    CERA++ QI+G+ TLVCIP+  GVVELGS E
Sbjct  187  TGFPGQAFLNSRTIWLSGSDVLAGSGCERARQGQIYGLHTLVCIPSENGVVELGSTE  243



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 109/174 (63%), Gaps = 6/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT--KAGRGGGVPV  336
            N  TLQQRLQ +++    SW YAIFWQ S D  G   L WGDG+++G   KA      P 
Sbjct  51   NQETLQQRLQALIEGAPKSWTYAIFWQLSYDFSGAAVLGWGDGYYKGEEDKAQPSRRSPR  110

Query  337  VVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGV  507
               +S + +Q  RK+++S + +LI G    S++   + +TD EWF+++S+ +SF +G G+
Sbjct  111  TFFSSPA-EQEHRKRILSELNSLISGGAVPSDDAVNEEVTDTEWFFLVSMTQSFPSGSGL  169

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             GKA+S  + VW+ G+ +L    CERA++  + G+QT+ CIP+  GVVELGS E
Sbjct  170  AGKAYSTSNPVWVIGSDQLSSSGCERARQGGVFGLQTIACIPSANGVVELGSTE  223



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 106/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAG-----RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +       R   
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGDEDKAKPRQRSSS  123

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI--GSTQNSENGDL-ITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI  G   + E  D  +TD EWF+++S+ +SF+ G
Sbjct  124  PPY----STPADQEYRKKVLRELNSLISGGVAPSDEAVDEEVTDTEWFFLVSMTQSFACG  179

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ G+AFS G+ VW+SG+ +L    CERAK+  + G+QT+ CIP+  GVVE+GS E
Sbjct  180  AGLAGRAFSTGNAVWVSGSDQLSGSGCERAKQGGVFGMQTIACIPSANGVVEVGSTE  236



>ref|XP_010909816.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=437

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 23/172 (13%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            PN   LQQRLQ++L  +++ WAYAIFW+ S D      L++G+G F+GT+         V
Sbjct  32   PN---LQQRLQYLLHARSEWWAYAIFWRASPDHH---LLSFGEGHFRGTRD--------V  77

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD---AEWFYVMSLARSFSAGDGV-  507
             +  H  +       + GIQAL+     +  GD+ +D    EWFYV+SL RSF+A + V 
Sbjct  78   DRKPHGLRSR-----VGGIQALLSEVTGTTAGDIASDGDDVEWFYVVSLTRSFAAQEPVL  132

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            P +A+   + VW++GAH LQ   C+RA+EAQ+HGI+TLVC+P   GV+ELGS
Sbjct  133  PARAYGSLAPVWVAGAHALQTCGCDRAREAQLHGIETLVCVPLSGGVLELGS  184



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 103/175 (59%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK---AGRGGGVP  333
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +     R    P
Sbjct  52   NEETLQQRLQALIEGTNEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKAKPRQRTSP  111

Query  334  VVVQTSHSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDG  504
                T     Q  RKKV+  + +LI   G   +    + +TD EWF+++S+ +SF+ G G
Sbjct  112  PPFSTP--ADQEYRKKVLRELNSLISGGGGPTDDAVDEEVTDTEWFFLVSMTQSFACGSG  169

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            + GKAFS G+ VW+ G+ +L    CERAK+  + G+QT+ CIP+  GVVELG  E
Sbjct  170  LAGKAFSTGNAVWVYGSDQLTGSGCERAKQGGVFGMQTIACIPSANGVVELGPTE  224



>ref|XP_008370020.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=481

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  TLQ RLQF+L+ + + W Y+IFW+ S   +  + L+W  G FQ T+         
Sbjct  15   QENSPTLQ-RLQFLLQNRPERWVYSIFWEASKHSNDLVSLSWAGGHFQSTRDLTSQ--KT  71

Query  337  VVQTSHSTQQS-----ERKKVISG-IQALIGSTQNSENGDLITDAEW--FYVMSLARSFS  492
              + SH   +      ERK+ IS  ++AL     + + GD +TDAEW  FY +SL +SF+
Sbjct  72   YNKVSHHQPKLGFDVLERKRAISREVEALFHEDMDLDGGD-VTDAEWVYFYTVSLTQSFT  130

Query  493  AGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            AG G   + G+ F  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL S
Sbjct  131  AGQGNSNILGRTFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIATSCGVLELAS  190

Query  664  LE  669
            L+
Sbjct  191  LD  192



>ref|XP_004509726.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=657

 Score =   140 bits (354),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 106/175 (61%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQ RLQ +++   +SW YAIFWQ S+D   G   L WGDG+++G      G    V
Sbjct  61   NQETLQHRLQSLIEGSRESWTYAIFWQPSHDYSSGAPLLGWGDGYYKGEDEKEKGKK--V  118

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVP  510
            ++T+   +Q+ RKKV+  + +LI  +  S +  +   +TD EWF++ S+ +SF    G  
Sbjct  119  IKTTSPEEQAHRKKVLRELNSLISGSSGSPDDAVEEDVTDTEWFFLTSMTQSFVNSSGSL  178

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA--GVVELGSLE  669
             +A+   + VW+SG  RL +  CERA++AQ  G+QTLVCIPT +  GVVEL S E
Sbjct  179  SQAYFNSTPVWISGPDRLSISACERARQAQFLGLQTLVCIPTPSSNGVVELASTE  233



>ref|XP_001754025.1| predicted protein [Physcomitrella patens]
 gb|EDQ81347.1| predicted protein [Physcomitrella patens]
Length=576

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 103/170 (61%), Gaps = 4/170 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N S L +RL  +++  T  W YAIFWQ S   +G + L WGDG+F+  K         + 
Sbjct  43   NESVLLRRLHSLVEESTVDWTYAIFWQLSALREGEMMLGWGDGYFRSAKENEINDARNMK  102

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAF  522
              S    Q  R+KV+  +QAL+  +++ +  D +TD EWFY++S++ S++AG G PG+A 
Sbjct  103  GGSQEEDQQMRRKVLRELQALVNGSED-DVSDYVTDTEWFYLVSMSHSYAAGVGTPGRAL  161

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHG---IQTLVCIPTGAGVVELGS  663
            +    VWL GA++    NC R + A++H    +QT++CIP+ +GVVELGS
Sbjct  162  ASDRPVWLIGANKAPDNNCSRVQLAKVHSSMILQTILCIPSKSGVVELGS  211



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 104/174 (60%), Gaps = 8/174 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-LFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TL QRLQ +++   +SW YAIFWQ+S D  G    L WG+GF+   K  R       
Sbjct  78   NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGAGAVLGWGEGFY---KDERDKVKAKA  134

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
              T+ + +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+
Sbjct  135  KTTTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVNGGGL  194

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+AF   + VW++G  RL    CERA++  + G+QT+VC+PT  GVVELGS E
Sbjct  195  PGQAFFHSTPVWVAGPDRLAASACERARQGHVFGLQTMVCVPTANGVVELGSTE  248



>ref|XP_010058370.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
 gb|KCW72579.1| hypothetical protein EUGRSUZ_E01049 [Eucalyptus grandis]
Length=450

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 105/172 (61%), Gaps = 22/172 (13%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQ +  IL+T+T+ W Y+IFWQ S D+ G L L WGDG F+GT        P      
Sbjct  23   TLQQLVHLILQTRTEGWVYSIFWQPSRDEHGGLVLTWGDGHFRGTTKDPSASKP------  76

Query  352  HSTQQSERKKVISGIQALIGS-TQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  528
                    K+V+   Q L G  +  S+NG    D EW+Y+ S+ RS+S+ DG+ G+AF  
Sbjct  77   ------SPKRVLEEAQFLDGKLSHGSDNG----DPEWYYIFSVTRSYSSEDGILGRAFRS  126

Query  529  GSLVWLSGAHR--LQMY-NCERAKEAQIHGIQTLVCI--PTGAGVVELGSLE  669
            G  VWLSG  R  L+MY + ER KEA+++GI+++VCI  P G+GV+ELGS E
Sbjct  127  GGHVWLSGEDRPELEMYEHDERVKEARMYGIKSIVCISVPNGSGVLELGSAE  178



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 104/174 (60%), Gaps = 8/174 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-LFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TL QRLQ +++   +SW YAIFWQ+S D  G    L WG+GF+   K  R       
Sbjct  78   NQETLMQRLQALIEGARESWTYAIFWQSSYDYSGAGAVLGWGEGFY---KDERDKVKAKA  134

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
              T+ + +Q  RKKV+  + +LI     S +  ++    TD EWF+++S+ +SF  G G+
Sbjct  135  KTTTSAAEQEYRKKVLRDLNSLISGADTSADDAVVDQEVTDTEWFFLVSMTQSFVNGGGL  194

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+AF   + VW++G  RL    CERA++  + G+QT+VC+PT  GVVELGS E
Sbjct  195  PGQAFFHSTPVWVAGPDRLAASACERARQGHVFGLQTMVCVPTANGVVELGSTE  248



>ref|XP_008245390.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=483

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 110/184 (60%), Gaps = 14/184 (8%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N S  Q+RLQFI + + + W Y+IFWQ SND + ++ L+W  G F+  +         
Sbjct  15   QENSSIFQKRLQFIFQNRPEWWLYSIFWQASNDSNDQVSLSWAGGDFRINRDLATKKSNK  74

Query  337  VVQTSHST---QQSERKKVIS-GIQALIGSTQNS----ENGDLITDAEWFYV--MSLARS  486
            VV   +        ER+KV++  ++ L           ++GD +TD+EWFY   +SL ++
Sbjct  75   VVNNYNPKFGFNSVERRKVVNKDVEDLFHEDMVDLAMVDHGD-VTDSEWFYFYSVSLTQT  133

Query  487  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  657
            F+AG   + V G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  134  FAAGHATNNVLGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCGVLEL  193

Query  658  GSLE  669
             SL+
Sbjct  194  ASLD  197



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 105/170 (62%), Gaps = 4/170 (2%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVVVQT  348
            +LQQRLQ +++   +SW YA+FWQ S D  G   L WGDG+++G +   R    P     
Sbjct  51   SLQQRLQALIEGAHESWTYAMFWQLSCDFSGAAVLGWGDGYYKGEEDKARAKQRPRSSMF  110

Query  349  SHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPGKA  519
            S   +Q  RKKV+  + +LI G    +E+   + +TD EWF+++S+ +SF +G G+ GKA
Sbjct  111  SSPAEQEHRKKVLRELNSLISGGAVTTEDAIDEEVTDMEWFFLVSMTQSFPSGSGLTGKA  170

Query  520  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            FS  + VW+ G+ +L    CERA++  + G+QT+ CIP   GVVELGS E
Sbjct  171  FSTSNPVWVVGSDQLSGSGCERARQGGVFGLQTIACIPLANGVVELGSTE  220



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 105/172 (61%), Gaps = 5/172 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQ RLQ +++   +SW YAIFWQ S D  G   L WGDG+++G             
Sbjct  114  NQDTLQHRLQALIEGARESWTYAIFWQHSYDYSGSALLGWGDGYYKGDDDKAKAKA--KA  171

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGVPG  513
            + + + +Q  RKKV+  + +LI  +  + + D+   +TD EWF+++S+ +SF  G G+PG
Sbjct  172  KATSAAEQDHRKKVLRELNSLISGSSAASSDDVDEEVTDTEWFFLVSMTQSFVNGAGLPG  231

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +AF   + VW+ G  RL    CERA++ Q+ G+QTLVCIP+  GVVELGS E
Sbjct  232  QAFFNSNPVWVIGGDRLSTSPCERARQGQVFGLQTLVCIPSANGVVELGSTE  283



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 108/174 (62%), Gaps = 11/174 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTK-AGRGGGVPV  336
            N  TLQQRL  +++   +SW YAIFWQ+S  D  G   L WGDG+++G +  G+      
Sbjct  92   NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEENTGKRK----  147

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGV  507
                S   +Q  RKKV+  + +LI   Q + +  +   +TD EWF+++S+ ++F  G G+
Sbjct  148  --TASSPAEQEHRKKVLRELNSLISGPQATTDDAVDEEVTDTEWFFLISMTQNFVNGSGL  205

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A    S VW++G+ RL   +CERA++AQ  G+QTLVCIP+  GVVELGS E
Sbjct  206  PGQALYSSSPVWVTGSDRLAASHCERARQAQGFGLQTLVCIPSSNGVVELGSTE  259



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 108/179 (60%), Gaps = 11/179 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD--GRLFLAWGDGFFQGTKAGRGGGVPV  336
            N  +LQQRLQ ++    +SWAYAIFWQ+S+  D      L WGDG+++G +  +      
Sbjct  57   NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKG-EENKNKRRAS  115

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENG--------DLITDAEWFYVMSLARSFS  492
               T+   +Q  RKKV+  + +LI   Q +  G        + +TD EWF+++S+ +SF+
Sbjct  116  SSSTNFVAEQEHRKKVLRELNSLISGVQATGAGSGGDDAVDEEVTDTEWFFLISMTQSFA  175

Query  493  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+G+PG A    S +W++G  +L    CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  176  NGNGLPGLAMYSSSPIWVTGTEKLAGSQCERARQAQGFGLQTIVCIPSANGVVELGSTE  234



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT--KAG---RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G   KA    R   
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSS  123

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  124  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  179

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+ T+ CIP+  GVVE+GS E
Sbjct  180  AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTE  236



>ref|XP_010445298.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=612

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 115/201 (57%), Gaps = 35/201 (17%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND-------------------DDGRLFLA  279
            Q N  TLQQRLQ +++   +SWAYA+FWQ S D                   ++    L 
Sbjct  61   QVNEDTLQQRLQALIEGANESWAYAVFWQLSYDFAGEDVEGGGVGGVGLTNNNNNTALLG  120

Query  280  WGDGFFQGT--KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALIGSTQ--------NSE  429
            WGDG+++G   K+ +    P     + + +Q  RK+V+  + ALI            + E
Sbjct  121  WGDGYYKGEEEKSRKKKTNP-----ASAAEQEHRKRVVRELNALISGGGGEVVNNGGSDE  175

Query  430  NGDL-ITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIH  606
             GD  +TD EWF+++S+ +SF  G G+PG+AFS  + +WLSG++ L   +CERA++ QI+
Sbjct  176  AGDEEVTDTEWFFLVSMTQSFVYGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQIY  235

Query  607  GIQTLVCIPTGAGVVELGSLE  669
            G+QT+VC+P   GVVELGS E
Sbjct  236  GLQTMVCVPCENGVVELGSSE  256



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 106/173 (61%), Gaps = 4/173 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK-AGRGGGVPVV  339
            +  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G +  G+       
Sbjct  60   SQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKGKPRQKSSS  119

Query  340  VQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVP  510
               S    Q  RKKV+  + +LI G    +++   + +TD EWF+++S+ +SF+ G G+ 
Sbjct  120  PPFSTPADQEYRKKVLRELNSLISGGAGPADDAVDEEVTDTEWFFLVSMTQSFACGSGLA  179

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            GKAFS  + VW+SG+ +L    CERAK+  I G+QT+ CIP+  GVVELGS E
Sbjct  180  GKAFSTANAVWVSGSDQLSGSGCERAKQGGIFGMQTIACIPSANGVVELGSTE  232



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT--KAG---RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G   KA    R   
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSS  123

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  124  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  179

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+ T+ CIP+  GVVE+GS E
Sbjct  180  AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTE  236



>ref|XP_010933462.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=677

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 110/175 (63%), Gaps = 10/175 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQ+RL  +++   ++W YAIFWQ+S D   G   L WGDG+++G +  +       
Sbjct  61   NQETLQRRLLTVIEGARETWTYAIFWQSSVDVASGASLLGWGDGYYKGCEEDKRKQK---  117

Query  340  VQTSHSTQQSERKKVISGIQALI-----GSTQNSENGDLITDAEWFYVMSLARSFSAGDG  504
               + + +Q  RK+V+  + +LI     GS+ +    + +TD EWF+++S+ +SF  G G
Sbjct  118  -ANASAEEQEHRKRVLRELNSLISGGAAGSSPDEAVEEEVTDTEWFFLVSMTQSFVDGAG  176

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S  W++GA+ L M  CERA++AQ+ G+QT+VC+P G+GV+ELGS +
Sbjct  177  LPGQALFSESPTWITGANLLAMAPCERARQAQVFGLQTMVCVPVGSGVLELGSTD  231



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 104/169 (62%), Gaps = 3/169 (2%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQRL  +++   + W YAIFWQ S D  G   L WGDG+++G +             S
Sbjct  61   TLQQRLHALIEGAHEGWTYAIFWQLSYDFSGAAVLGWGDGYYKGEEDKACPRPRATTSFS  120

Query  352  HSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPGKAF  522
             S  Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF++G G+ GKAF
Sbjct  121  SSADQEHRKKVLRELNSLISGGALPSDDAVDEEVTDTEWFFLVSMTQSFASGSGLAGKAF  180

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            S  + VW++G+ +L   +CERA +  + G+QT+ CIP+  GVVELGS E
Sbjct  181  STSNPVWVAGSDQLSGSDCERAGQGGVFGLQTIACIPSANGVVELGSTE  229



>ref|XP_009587276.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
 gb|ADH04270.1| MYC2b transcription factor [Nicotiana tabacum]
Length=658

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 103/174 (59%), Gaps = 6/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  +LQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G +  +       
Sbjct  69   NQESLQQRLQTLIDGAREAWTYAIFWQSSVVDFVSPSVLGWGDGYYKG-EEDKNKRKTAA  127

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
                  T+Q  RKKV+  + +LI  TQ     D +    TD EWF+++S+ +SF  G G+
Sbjct  128  FSPDFITEQEHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGL  187

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG A    S +W++G  RL   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  188  PGLAMYSSSPIWVTGRERLAASHCERARQAQGFGLQTMVCIPSANGVVELGSTE  241



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 107/177 (60%), Gaps = 12/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG--TKAG---RGGG  327
            N  TLQQRLQ +++   + W YAIFWQ S D  G   L WGDG+++G   KA    R   
Sbjct  64   NQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRRSSS  123

Query  328  VPVVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAG  498
             P     S    Q  RKKV+  + +LI G    S++   + +TD EWF+++S+ +SF+ G
Sbjct  124  PPF----STPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACG  179

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+ GKAF+ G+ VW+SG+ +L    CERAK+  + G+ T+ CIP+  GVVE+GS E
Sbjct  180  AGLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTE  236



>ref|XP_008374122.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=467

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 103/175 (59%), Gaps = 9/175 (5%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  TLQ RLQFI++ + + W Y+IFWQ S D +G ++L+W  G F+ T   R      
Sbjct  15   QENSLTLQ-RLQFIIQNRPEWWVYSIFWQASKDSNGLVYLSWAGGHFRST---RDLASKR  70

Query  337  VVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARSFSAGDG-  504
                ++     ERKK I   ++AL     + + GD +TDAEWFY    SL +SF+A  G 
Sbjct  71   SYNKANDFDXVERKKGIRKEVEALFYEHMDLDGGD-VTDAEWFYFYTASLTQSFTASHGN  129

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            + G  F  G  VWL+G H LQ Y CER KEA++HGI TLVCI T  GV+EL S +
Sbjct  130  ILGGTFCSGDFVWLAGDHELQFYECERVKEARMHGIHTLVCIATSCGVLELASFD  184



>ref|XP_009800420.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=659

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 103/174 (59%), Gaps = 6/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  +LQQRLQ ++    + W YAIFWQ+S  D      L WGDG+++G +  +       
Sbjct  70   NQESLQQRLQTLIDGAREGWTYAIFWQSSVVDFASPSVLGWGDGYYKG-EEDKNKRKTAS  128

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
                  T+Q+ RKKV+  + +LI  TQ     D +    TD EWF+++S+ +SF  G G+
Sbjct  129  FSPDFITEQAHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGL  188

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG A    S +W++G  RL   +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  189  PGLAMYSSSPIWVTGTERLAASHCERARQAQGFGLQTIVCIPSANGVVELGSTE  242



>gb|ADH04269.1| MYC2a transcription factor [Nicotiana tabacum]
Length=659

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 103/174 (59%), Gaps = 6/174 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  +LQQRLQ ++      W YAIFWQ+S  D      L WGDG+++G +  +       
Sbjct  70   NQESLQQRLQTLIDGARKGWTYAIFWQSSVVDFASPSVLGWGDGYYKG-EEDKNKRKTAS  128

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGV  507
                  T+Q+ RKKV+  + +LI  TQ     D +    TD EWF+++S+ +SF  G G+
Sbjct  129  FSPDFITEQAHRKKVLRELNSLISGTQTGGENDAVDEEVTDTEWFFLISMTQSFVNGSGL  188

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG A    S +W++G  RL + +CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  189  PGLAMYSSSPIWVTGTERLAVSHCERARQAQGFGLQTIVCIPSANGVVELGSTE  242



>ref|XP_010530031.1| PREDICTED: transcription factor MYC4 [Tarenaya hassleriana]
Length=653

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 14/181 (8%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTS-------NDDDGRLFLAWGDGFFQGTKAGRG  321
            N  TLQQRLQ +++   ++W YAI+WQ S        D +G  FL WGDG+++G +    
Sbjct  68   NEDTLQQRLQALIEGARETWTYAIYWQLSYDSIAGGGDGEGTAFLGWGDGYYKGEEDK--  125

Query  322  GGVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENG-----DLITDAEWFYVMSLARS  486
            G       + ++ +Q  RK+VI  + ALI     +        + +TD EWF+++S+ +S
Sbjct  126  GKSKKRCSSVNAVEQEHRKRVIRELNALISGGAVAGAADDAGDEEVTDTEWFFLVSMTQS  185

Query  487  FSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSL  666
            F  G G+PG+AF     +WLSG+  L    CERA++ QI+G++TLVCIP+  GVVELGS 
Sbjct  186  FLNGTGLPGQAFLHCRTIWLSGSGALAGSGCERAQQGQIYGLRTLVCIPSDNGVVELGST  245

Query  667  E  669
            +
Sbjct  246  D  246



>ref|XP_009412473.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 102/172 (59%), Gaps = 20/172 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            +P  S LQ RLQ +L ++ + W YAIFW+ S D      LA+GDG F+G +   G  VP 
Sbjct  55   RPATSALQHRLQCLLGSRPEWWTYAIFWRASPDHH---LLAFGDGHFRGNRELDGRRVP-  110

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG-VPG  513
                        R     G+ A++   +   +GD   DAEWFYV+SL R F+AG+  VP 
Sbjct  111  -----------PRSGSGGGVHAVL-IDEACTDGD---DAEWFYVVSLTRCFAAGEAAVPA  155

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            + +   +LVWL+GAH LQ   C+R +EAQ+HGI+T+VC+P   GV+ELGS E
Sbjct  156  RVYGTLALVWLTGAHALQTCGCDRTREAQLHGIETIVCVPVAGGVLELGSSE  207



>ref|XP_003534274.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=731

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 6/173 (3%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQ RLQ +++   ++W YAIFWQ+S D  G   L WGDG+++G             
Sbjct  113  NQDTLQHRLQALIEGARETWTYAIFWQSSYDYSGSTLLGWGDGYYKGDDDKAKAKA--KS  170

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGD----LITDAEWFYVMSLARSFSAGDGVP  510
            + + + +Q  RKKV+  + +LI  + ++   D     +TD EWF+++S+ +SF  G G+P
Sbjct  171  KATSAAEQDHRKKVLRELNSLISGSSSASASDDVDEEVTDTEWFFLVSMTQSFVNGGGLP  230

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G+AF   + VW++G+ RL    CERA++  + G+QTLVCIP+  GVVELGS E
Sbjct  231  GQAFFNSTPVWVTGSDRLSASPCERARQGHMFGLQTLVCIPSANGVVELGSTE  283



>dbj|BAJ33793.1| unnamed protein product [Thellungiella halophila]
Length=606

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  L L WGDG+++G +      
Sbjct  47   NEDTLQQRLQALIESAEENWTYAIFWQISHDFDSPTGDNTLILGWGDGYYRGEEDKD---  103

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                  +S+  +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF+ G
Sbjct  104  KKKKSSSSNPAEQEHRKRVIRELNSLISGGIGVSDEANDEEVTDTEWFFLVSMTQSFANG  163

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++     ++WLSG+  L    CERA + QI+G+QT+VCI    GVVELGS E
Sbjct  164  VGLPGESLLNSRVIWLSGSGALTGSGCERAHQGQIYGLQTMVCIAAENGVVELGSSE  220



>ref|XP_008346662.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=475

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 107/178 (60%), Gaps = 12/178 (7%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQ-TSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  333
            Q N  TLQ RLQFI++ +   W Y+IFWQ +S D D  + L+W  G F+ T   R     
Sbjct  15   QENSPTLQ-RLQFIIQNRPVRWVYSIFWQASSKDSDDLVSLSWAGGHFRST---RDLASI  70

Query  334  VVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFYVM--SLARSFSAGDG  504
                 ++  +  ERKK IS  ++AL     + + GD +TDAEWFY    SL +SF+AG G
Sbjct  71   QSYNKANVFEVVERKKGISREVEALFYEGMDLDGGD-VTDAEWFYFYTDSLTQSFTAGHG  129

Query  505  ---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
               + G+ F  G  VWL+G H LQ Y CER K+A++HGIQTLVCI T  GVVEL SL+
Sbjct  130  NSNILGRTFCSGGFVWLAGDHELQFYECERVKKARMHGIQTLVCIATSCGVVELASLD  187



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 107/179 (60%), Gaps = 11/179 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD--GRLFLAWGDGFFQGTKAGRGGGVPV  336
            N  +LQQRLQ ++    +SWAYAIFWQ+S+  D      L WGDG+++G +  +      
Sbjct  57   NQESLQQRLQALIDGARESWAYAIFWQSSSTSDFATPSVLGWGDGYYKG-EENKNKRRAS  115

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENG--------DLITDAEWFYVMSLARSFS  492
                +   +Q  RKKV+  + +LI   Q +  G        + +TD EWF+++S+ +SF+
Sbjct  116  SSSANFVAEQEHRKKVLRELNSLISGVQAAGAGSGGDDAVDEEVTDTEWFFLISMTQSFA  175

Query  493  AGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+G+PG A    S +W++G  +L    CERA++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  176  NGNGLPGLAMYSSSPIWVTGTEKLAGSQCERARQAQGFGLQTIVCIPSANGVVELGSTE  234



>ref|XP_010691764.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=457

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 109/177 (62%), Gaps = 25/177 (14%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTS--NDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQ  345
            T QQ+L+F+L+ Q   W YAIFWQTS  N D+  + L WG+G F G K+           
Sbjct  22   TQQQKLEFLLQNQQQWWNYAIFWQTSTNNVDNSSISLVWGEGHFHGMKSP----------  71

Query  346  TSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSF-----SAGDGVP  510
               S++  ++  +   ++  +    +S +  ++TDAEWFY+ S  RS+     + G G P
Sbjct  72   ---SSKPKKKPNLFVQVEDELDEGVSSMDDVVVTDAEWFYMTSPPRSYPLKQRNGGSG-P  127

Query  511  G----KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G    KA++ GSLVWLSGAH L++YNCERAKEA  HG+QTLVCIP   GV+ELGS+E
Sbjct  128  GNTLAKAYTTGSLVWLSGAHYLRLYNCERAKEAHSHGLQTLVCIPVPNGVLELGSVE  184



>ref|XP_009360191.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=476

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/184 (45%), Positives = 109/184 (59%), Gaps = 24/184 (13%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQ-TSNDDDGRLFLAWGDGFFQGT------KAG  315
            Q N  TLQ RLQFI++ + + W Y+IFWQ +S D D  + L+W  G F+ T      ++ 
Sbjct  15   QENSPTLQ-RLQFIIQNRPERWVYSIFWQASSKDSDDLVSLSWAGGHFRSTGDLASKQSY  73

Query  316  RGGGVPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARS  486
                V  VV         ERKK IS  + AL     + + GD +TDAEWFY   +SL +S
Sbjct  74   NKANVFEVV---------ERKKGISREVDALFYEGMDLDGGD-VTDAEWFYFYTVSLTQS  123

Query  487  FSAGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  657
            F+AG G   + G+ F  G  VWL+G H LQ Y CER K+A++HGIQTLVCI T  GV+EL
Sbjct  124  FTAGHGNSNILGRTFCSGGFVWLAGDHELQFYECERVKKARMHGIQTLVCIATSCGVLEL  183

Query  658  GSLE  669
             SL+
Sbjct  184  ASLD  187



>ref|XP_006398371.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
 gb|ESQ39824.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
Length=665

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  L L WGDG+++G +      
Sbjct  106  NEDTLQQRLQALIESAEENWTYAIFWQISHDFDSPTGDNTLILGWGDGYYRGEEDKDKK-  164

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                  +S+  +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF+ G
Sbjct  165  --KKSSSSNPAEQEHRKRVIRELNSLISGGIGVSDEANDEEVTDTEWFFLVSMTQSFANG  222

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++     ++WLSG+  L    CERA + QI+G+QT+VCI    GVVELGS E
Sbjct  223  VGLPGESLLNSRVIWLSGSGALTGSGCERAHQGQIYGLQTMVCIAAENGVVELGSSE  279



>ref|XP_008374121.1| PREDICTED: transcription factor MYC3-like [Malus domestica]
Length=500

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 108/184 (59%), Gaps = 22/184 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  TLQ RLQFI++ + + W Y+IFWQ S  +   + L+W  G F+ T+        +
Sbjct  40   QENSPTLQ-RLQFIVQNRPEWWVYSIFWQPSKHBSDLVSLSWAGGHFRSTR-------DL  91

Query  337  VVQTSHSTQQS-------ERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARS  486
              + S+   Q        E+K+ IS  ++AL     + + GD +TDA+WFY    SL +S
Sbjct  92   ASKRSYHKHQPGFGFNVVEKKRAISREVEALFHEDVDLDGGD-VTDAQWFYFYTASLTQS  150

Query  487  FSAGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  657
            F+AG G   + G+ F  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  151  FTAGHGNSNILGRTFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCIATSCGVLEL  210

Query  658  GSLE  669
             SL+
Sbjct  211  ASLD  214



>ref|XP_008796257.1| PREDICTED: transcription factor MYC4 [Phoenix dactylifera]
Length=687

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 106/175 (61%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQ RL  +++   +SW YAIFWQ+S D   G   L WGDG+++G +  +      V
Sbjct  60   NQETLQHRLLTLIEGARESWTYAIFWQSSVDMASGVSLLGWGDGYYKGCEEDKRKQR--V  117

Query  340  VQTSHSTQQSERKKVISGIQALIG-----STQNSENGDLITDAEWFYVMSLARSFSAGDG  504
               + + +Q  RK+V+  + +LI      S+ +    + +TD EWF+++S+ +SF  G G
Sbjct  118  TNPASAEEQEHRKRVLRELNSLISGGAGVSSPDETVEEEVTDTEWFFLVSMMQSFENGSG  177

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    +  W+ GA RL +  CERA++AQ  G+QT+ C+P G+GV+ELGS +
Sbjct  178  LPGQALFADAPTWIPGADRLALAPCERARQAQALGLQTMACVPVGSGVLELGSTD  232



>ref|XP_009765330.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=423

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 98/169 (58%), Gaps = 26/169 (15%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            QPN   LQ+ LQ+I+ ++ + W Y+IFWQ + D + R  L+WGD  F+GTK         
Sbjct  13   QPN--ALQKILQYIVHSRQEWWVYSIFWQATKDVNNRFILSWGDAHFRGTKDISSA----  66

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  516
              +T H  Q+              G   N      +TD+EWFY++S+ + F A D +  +
Sbjct  67   --KTGHQLQKK------------FGFETN------VTDSEWFYMVSMPQCFVAEDELVVR  106

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            A+S  + VWL+  + LQ+YNCERAKEA  HGI+TLVCI T  GVVELGS
Sbjct  107  AYSSATHVWLASHYELQLYNCERAKEADSHGIRTLVCIATPCGVVELGS  155



>emb|CAF74710.1| MYC transcription factor [Solanum tuberosum]
Length=692

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R   V 
Sbjct  92   NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLAV-  150

Query  334  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  151  --SSPAYIAEQEHRKKVLRELNSLISGAPAGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  208

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  209  LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTE  263



>ref|XP_010449546.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=622

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/202 (37%), Positives = 116/202 (57%), Gaps = 36/202 (18%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSND------DDGRL-----------FLAWG  285
            Q N  TLQQRLQ +++   +SW YA+FWQ S +      ++GR+            L WG
Sbjct  61   QVNEDTLQQRLQALIEGANESWTYAVFWQLSYEFAGEDVEEGRVGGGLTNNNNMALLGWG  120

Query  286  DGFFQGT--KAGRGGGVPVVVQTSHSTQQSERKKVISGIQALI------------GSTQN  423
            DG+++G   K+ +    P     + + +Q  RK+V+  + ALI            G   +
Sbjct  121  DGYYKGEEEKSRKKKTNP-----ASAAEQEHRKRVVRELNALITGVGGEVVNSGGGGGSD  175

Query  424  SENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQI  603
                + +TD EWF+++S+ +SF  G G+PG+AFS  + +WLSG++ L   +CERA++ QI
Sbjct  176  EAGDEEVTDTEWFFLVSMTQSFINGTGLPGQAFSSSNTIWLSGSNALAGSSCERARQGQI  235

Query  604  HGIQTLVCIPTGAGVVELGSLE  669
            +G+QT+VC+P   GVVELGS E
Sbjct  236  YGLQTMVCVPCENGVVELGSSE  257



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 109/175 (62%), Gaps = 8/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-DDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRL  +++   ++W YAIFWQ+S D   G   L WGDG+++G +  +       
Sbjct  64   NQETLQQRLLTLIEGARETWTYAIFWQSSVDVASGVSLLGWGDGYYKGCEEDKRKQK--T  121

Query  340  VQTSHSTQQSERKKVISGIQALI-----GSTQNSENGDLITDAEWFYVMSLARSFSAGDG  504
               + + +Q  RK+V+  + +LI     GS+ +    + +TD EWF+++S+ +SF  G G
Sbjct  122  TNPATAAEQEHRKRVLRELNSLISGGAGGSSPDETVEEEVTDTEWFFLVSMTQSFVNGAG  181

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+AF   +  W++GA RL +  C+RA++A+  G+QT+VC+P G GV+ELGS +
Sbjct  182  LPGQAFFADAPNWIAGADRLALAPCDRARQARELGLQTMVCVPVGTGVLELGSTD  236



>ref|XP_001765254.1| predicted protein [Physcomitrella patens]
 gb|EDQ69982.1| predicted protein [Physcomitrella patens]
Length=800

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 104/169 (62%), Gaps = 2/169 (1%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            + + L +RL  +++  + +W Y IFWQ S    G L L WGDG+F+G K        +  
Sbjct  100  SETVLLRRLHTLVEETSSNWTYGIFWQLSRSPSGELMLGWGDGYFKGPKENEISEKRIDQ  159

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAF  522
              S   QQ  R+KV+  +Q+L+ +T+  +  D +TD EWFY++S++ SF+ G G PG+A 
Sbjct  160  GGSEEDQQL-RRKVLRELQSLVSNTEE-DVSDYVTDTEWFYLVSMSHSFAYGVGTPGQAL  217

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +  S VWL+ A++   + C RA  A++ GIQT+VC+PT  GVVELGS +
Sbjct  218  ATESPVWLTEANKAPNHICTRAHLAKMAGIQTIVCVPTRTGVVELGSTD  266



>ref|XP_006352856.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=702

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R   V 
Sbjct  98   NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLAV-  156

Query  334  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  157  --SSPAYIAEQEHRKKVLRELNSLISGAPAGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  214

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  215  LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTE  269



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R   V 
Sbjct  90   NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLSVS  149

Query  334  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  150  ---SPAYIAEQEHRKKVLRELNSLISGAPPGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  206

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  207  LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTE  261



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 109/175 (62%), Gaps = 9/175 (5%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGT--KAGRGGGVP  333
            N  TLQQRLQ ++    ++W YAIFWQ+S  D      L WGDG+++G   KA R   V 
Sbjct  90   NQETLQQRLQALIDGARETWTYAIFWQSSVVDFSSPSVLGWGDGYYKGEEDKAKRKLSVS  149

Query  334  VVVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDG  504
                 ++  +Q  RKKV+  + +LI G+   +++   + +TD EWF+++S+ +SF  G G
Sbjct  150  ---SPAYIAEQEHRKKVLRELNSLISGAPPGTDDAVDEEVTDTEWFFLISMTQSFVNGSG  206

Query  505  VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +PG+A    S +W++G  +L   +CER ++AQ  G+QT+VCIP+  GVVELGS E
Sbjct  207  LPGQALYSSSPIWVAGTEKLAASHCERVRQAQGFGLQTIVCIPSANGVVELGSTE  261



>ref|XP_008780029.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=440

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 99/172 (58%), Gaps = 23/172 (13%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            PN   LQ RLQ +L    + W YAIFW+ + D      L++G+G F+GT+          
Sbjct  34   PN---LQHRLQHLLHAHPEWWVYAIFWRATPDHH---LLSFGEGHFRGTRD---------  78

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITD---AEWFYVMSLARSFSAGD-GV  507
            V   H   Q      + GIQAL+        GD+ +D   AEWFYVMSL RSF+ G+  V
Sbjct  79   VDRKHRGPQGS----VGGIQALLSDVSGPAAGDIASDGDDAEWFYVMSLTRSFAVGEPAV  134

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            P +A+     VW++GA  LQ   C+RA+EAQ+HGI+TLVCIP   GV+ELGS
Sbjct  135  PARAYGSLVPVWVAGADALQTCGCDRAREAQLHGIETLVCIPLSGGVLELGS  186



>ref|XP_007210924.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
 gb|EMJ12123.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
Length=478

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 109/189 (58%), Gaps = 18/189 (10%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTK---AGRGG  324
            Q N +T  QRLQFI++ + + WAY+IFWQ S D+ D ++ L+W  G F+ ++   + R  
Sbjct  15   QENSATFHQRLQFIVQNRPEWWAYSIFWQASKDNNDDQVVLSWAGGHFKSSRDFASKRSN  74

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL---------ITDAEWFY--VM  471
             +    Q        ERK V +    ++   ++  + D          +TD+EWFY   +
Sbjct  75   KMTNNYQPKFGFSSVERKNVNNREVEVLFDEEDMVDLDTSLVDHGVGDVTDSEWFYFYTV  134

Query  472  SLARSFSAGDG---VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  642
            SL +SF+AG G   +  +AF  G  VWL+G H LQ Y CER KEA++HGIQTLVC+ T  
Sbjct  135  SLTQSFAAGHGNNSILDRAFCSGGFVWLAGDHELQFYECERVKEARMHGIQTLVCVATPC  194

Query  643  GVVELGSLE  669
            GV+EL SL+
Sbjct  195  GVLELASLD  203



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 108/177 (61%), Gaps = 13/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  48   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  102

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                   +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  103  KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNG  162

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG+  L    CERA + QI+G++T+VCI T  GVVELGS E
Sbjct  163  VGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSE  219



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 108/177 (61%), Gaps = 13/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  48   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  102

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                   +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  103  KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNG  162

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG+  L    CERA + QI+G++T+VCI T  GVVELGS E
Sbjct  163  VGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIATQNGVVELGSSE  219



>ref|XP_008245385.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=475

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 106/187 (57%), Gaps = 22/187 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G F+  +         
Sbjct  15   QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHFESPRDLASKRSNK  74

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----------ITDAEW--FYVMSL  477
            +V   H     ERKKVI+  +A    +   E  DL           +TD EW  FY +SL
Sbjct  75   MVNNKHFV---ERKKVINNREA---ESLFHEEMDLDMRLVDHGVGDVTDCEWLYFYSISL  128

Query  478  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  648
             +SF AG   + + G++F  G  VWL+G H LQ Y CER K+A++HGI++LVCI T  GV
Sbjct  129  TQSFVAGHATNNILGRSFCSGGFVWLAGDHELQFYECERVKKARMHGIKSLVCIATPCGV  188

Query  649  VELGSLE  669
            +EL SL+
Sbjct  189  LELASLD  195



>ref|XP_008245384.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=476

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 106/187 (57%), Gaps = 22/187 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  + QQRLQFI++ + + W Y+IFWQ S D + ++ L+W  G F+  +         
Sbjct  15   QENSVSFQQRLQFIVQNRPEWWVYSIFWQASKDSNDQVALSWAGGHFESPRDLASKRSNK  74

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDL-----------ITDAEW--FYVMSL  477
            +V   H     ERKKVI+  +A    +   E  DL           +TD EW  FY +SL
Sbjct  75   MVNNKHFV---ERKKVINNREA---ESLFHEEMDLDMRLVDHGVGDVTDCEWLYFYSISL  128

Query  478  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  648
             +SF AG   + + G++F  G  VWL+G H LQ Y CER K+A++HGI++LVCI T  GV
Sbjct  129  TQSFVAGHATNNILGRSFCSGGFVWLAGDHELQFYECERVKKARMHGIKSLVCIATPCGV  188

Query  649  VELGSLE  669
            +EL SL+
Sbjct  189  LELASLD  195



>ref|XP_010058369.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=449

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 20/171 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQ +  IL+ + + W Y+IFW+ S DD GRLFL WG G F+GT        P      
Sbjct  23   TLQQLVHLILQARPEHWVYSIFWRPSRDDHGRLFLTWGHGHFRGTTRDPFPSKPTT----  78

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  531
                     +V+   Q   G      +G  I D EW+Y+ S+ARS+S+ DG+ G+AF  G
Sbjct  79   --------NRVLKEAQYPDGQFA---DGSDIGDPEWYYIFSVARSYSSEDGILGRAFRSG  127

Query  532  SLVWLSGAHRLQMYNCE---RAKEAQIHGIQTLVC--IPTGAGVVELGSLE  669
              +WLSG    ++  CE   R KEA++HGIQ++VC  IP G+GV+ELGS E
Sbjct  128  GHIWLSGDDHPELEMCESDDRVKEARMHGIQSIVCISIPNGSGVLELGSTE  178



>ref|XP_009776798.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=270

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 103/171 (60%), Gaps = 6/171 (4%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            +LQQRLQ +++   ++W Y IFWQ+   D    L L WG+G++ G +  +     +    
Sbjct  50   SLQQRLQTLIEGAREAWTYGIFWQSDVVDFASPLVLRWGNGYYIG-EEDKNKCKTMSFSP  108

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGDGVPGK  516
                +Q  RKKV   + +LI   Q S   D++    TD EWF+++S+++SF  G G+PG 
Sbjct  109  YFIAEQEHRKKVFREVNSLISGIQTSSENDVVDEEVTDTEWFFLISMSQSFVNGSGLPGL  168

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            A    S +W++ + RL   +CERA++AQ +G+QT+VCIP+  GVVELGS E
Sbjct  169  AMHSSSPIWVTESERLAASHCERARQAQGYGLQTMVCIPSTDGVVELGSTE  219



>ref|XP_007151965.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
 gb|ESW23959.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
Length=404

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 98/168 (58%), Gaps = 28/168 (17%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            + LQQRLQFIL+T+ + W YAIFWQ + + D RL L +GDGF+ G+K GR G      + 
Sbjct  19   NALQQRLQFILQTRPEWWVYAIFWQATKESDSRLTLEYGDGFYMGSK-GREG-----TEV  72

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  528
              S +Q                T+N      + D EWFY +S  RS++AGDGV G AF  
Sbjct  73   RMSEEQ----------------TRNH-----VNDIEWFYRVSQTRSYAAGDGVVGCAFGS  111

Query  529  GSLVWLSGAHRLQMYNC-ERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G  VWLSG +  ++  C ER  EA+ HGIQTLVC+    G++ELGS E
Sbjct  112  GVDVWLSGVNEFEVNECDERVGEARRHGIQTLVCVSVARGILELGSHE  159



>ref|XP_006838603.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
 gb|ERN01172.1| hypothetical protein AMTR_s00002p00225810 [Amborella trichopoda]
Length=655

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 103/176 (59%), Gaps = 16/176 (9%)
 Frame = +1

Query  160  PNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT--KAGRGGGVP  333
            P+  +LQ RLQ +++T  + W YAIFWQ S        LAW DG+++G   K  R    P
Sbjct  64   PSQDSLQHRLQSLIETAHEPWTYAIFWQPSLPSQA---LAWADGYYKGEPLKLARPPAPP  120

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLI----TDAEWFYVMSLARSFSAGD  501
                   S +Q  RK V+  + +LI  T ++ N + +    TD EWFY++S+ +SF+   
Sbjct  121  -------SAEQINRKLVLRQLHSLISQTSSATNDESVDEEVTDTEWFYLVSMMQSFAGPT  173

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             +P  +F  G+ VWL+G  RL    CERA++A   G+Q+LVCIPT +GVVELGS E
Sbjct  174  ALPSHSFFSGAPVWLAGGGRLATCPCERARQAVAFGLQSLVCIPTSSGVVELGSTE  229



>gb|KCW72573.1| hypothetical protein EUGRSUZ_E01042 [Eucalyptus grandis]
Length=436

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 103/171 (60%), Gaps = 20/171 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQ +  IL+T+T+ W Y IFW+ S D  G L L W DG FQGT        P    + 
Sbjct  23   TLQQLVHLILQTRTEEWIYFIFWRPSRDKHGCLVLTWADGHFQGTTRD-----PFT--SK  75

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  531
            H+T     K+V+   Q L     +S +   I D EW+Y+ S+ARS+S+  G+ GKAF  G
Sbjct  76   HTT-----KRVLEETQCLNDKFAHSSD---IGDPEWYYIFSVARSYSSEHGLLGKAFRSG  127

Query  532  SLVWLSGA--HRLQMYNC-ERAKEAQIHGIQTLVC--IPTGAGVVELGSLE  669
              VWL+G   H L+MY C ER KEA+++GI+++ C  IP G+GV+ELGS E
Sbjct  128  GHVWLNGEDRHELEMYECDERVKEARMYGIKSIACISIPNGSGVLELGSSE  178



>ref|XP_009396848.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=712

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 101/169 (60%), Gaps = 6/169 (4%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDD-GRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            L +RLQ +++   DSW Y I WQ+S D D G   L W DG ++G +  +    P     +
Sbjct  77   LHERLQALIEGVRDSWTYVILWQSSVDTDTGESLLVWADGCYKGCEEDKRKQQPAAASAA  136

Query  352  HSTQQSERKKVISGIQALI-----GSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGK  516
             + +Q  RK+V+  + +LI      S+ N    D +TD+EWF+++S+ +SF  G G+PG+
Sbjct  137  SAAEQVRRKRVLRELNSLIDGDERSSSANEAAEDEVTDSEWFFLVSMTQSFVNGSGLPGQ  196

Query  517  AFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            A   G   WL+GA RL +  C+RA++A + GIQT+V +P   GV+ELGS
Sbjct  197  ALFSGDPSWLAGADRLAVAPCDRARQATVFGIQTMVYVPVSPGVLELGS  245



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 107/174 (61%), Gaps = 11/174 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            N  TLQQRL  +++   +SW YAIFWQ+S  D  G   L WGDG+++G +  +G      
Sbjct  68   NQETLQQRLLALIEGARESWTYAIFWQSSVVDYGGPSVLGWGDGYYKGEE-NKGKR----  122

Query  340  VQTSHS-TQQSERKKVISGIQALIGSTQNSENGDL---ITDAEWFYVMSLARSFSAGDGV  507
             QT+ S  +Q  RKKV+  + +LI     + +  +   +TD EWF+++S+ +SF  G G+
Sbjct  123  -QTASSPAEQDHRKKVLRELNSLISGPPTAVDDAVDEDVTDTEWFFLISMTQSFVNGSGL  181

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            PG+A    S VW++G  RL   +C+RA++A   G+QTLVC+P   GVVELGS E
Sbjct  182  PGQALYSSSPVWVTGTDRLAASHCDRARQAHGFGLQTLVCVPCSNGVVELGSTE  235



>ref|XP_009391048.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=551

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N  TLQQRL  +++   ++W YAIFWQ+S    G   L+WGDG+++  +  +    P  V
Sbjct  46   NPETLQQRLNALIEGGPENWTYAIFWQSS-PAGGAAALSWGDGYYRSCEEDKRK--PAGV  102

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSENGDL-ITDAEWFYVMSLARSFSAGDGVPGKA  519
              S + +Q  RK+V+  + ALI      +  D  ++D EWF+++S+ ++F+ G G+PG+ 
Sbjct  103  GASSTAEQEHRKRVLRELNALISGAGGEDAADEEVSDTEWFFLVSMTQTFAPGAGLPGQV  162

Query  520  FSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
               G  VW++G  RL    CERA++A   G++T+ C+P G+GVVELGS
Sbjct  163  LLSGETVWVAGEDRLAAAPCERAQQAWAFGLRTMACVPMGSGVVELGS  210



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 107/177 (60%), Gaps = 10/177 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDG-----RLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  62   NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGESTVILGWGDGYYRGEEDKEK--  119

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                  +S+  +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  120  KKKQSSSSNPAEQEHRKRVIRELNSLIAGGAGVSDEANDEEVTDTEWFFLVSMTQSFVNG  179

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG+  L    CERA++ +++G+QT+VCI    GVVELGS E
Sbjct  180  VGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSE  236



>gb|KFK45000.1| hypothetical protein AALP_AA1G331100 [Arabis alpina]
Length=610

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 105/174 (60%), Gaps = 7/174 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQG--TKAGRGGGVPV  336
            +  TLQQRLQ +++   + W YAIFWQ S D  G   L W DG+++G   K+ R    P 
Sbjct  54   SQETLQQRLQALIEGTHEGWTYAIFWQPSYDYSGASVLGWADGYYKGEEDKSNRRSSSPP  113

Query  337  VVQTSHSTQQSERKKVISGIQALI-GSTQNSENG--DLITDAEWFYVMSLARSFSAGDGV  507
               T     Q+ RKKV+  + +LI GS   +++   + +TD EWF+++S+ +SF  G G+
Sbjct  114  AFTTP--VDQAYRKKVLRELNSLISGSLAPADDAVEEEVTDTEWFFLVSMTQSFGPGFGL  171

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             GKAFS  + VW +G  +L    CERAK+  + G++T+ C+PT  GVVELGS E
Sbjct  172  AGKAFSSANPVWCTGFDQLSGSGCERAKQGGVFGMKTIACVPTVNGVVELGSTE  225



>ref|XP_010058361.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=476

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 102/171 (60%), Gaps = 20/171 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQ +  IL+T+T+ W Y IFW+ S D  G L L W DG FQGT             + 
Sbjct  52   TLQQLVHLILQTRTEEWIYFIFWRPSRDKHGCLVLTWADGHFQGTTRD-------PFTSK  104

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  531
            H+T     K+V+   Q L     +S +   I D EW+Y+ S+ARS+S+  G+ GKAF  G
Sbjct  105  HTT-----KRVLEETQCLNDKFAHSSD---IGDPEWYYIFSVARSYSSEHGLLGKAFRSG  156

Query  532  SLVWLSGA--HRLQMYNC-ERAKEAQIHGIQTLVC--IPTGAGVVELGSLE  669
              VWL+G   H L+MY C ER KEA+++GI+++ C  IP G+GV+ELGS E
Sbjct  157  GHVWLNGEDRHELEMYECDERVKEARMYGIKSIACISIPNGSGVLELGSSE  207



>ref|XP_009413229.1| PREDICTED: transcription factor MYC2-like [Musa acuminata subsp. 
malaccensis]
Length=707

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 108/174 (62%), Gaps = 7/174 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDD-DGRLFLAWGDGFFQGTKAGRGGGVPVV  339
            +  TLQQRLQ +++   +SW Y IFWQ+S D   G  +L WGDG+++G +  +    P  
Sbjct  68   SQETLQQRLQTLIEGARESWTYGIFWQSSVDAATGASYLGWGDGYYKGREEDKRKQRPTA  127

Query  340  VQTSHSTQQSERKKVISGIQALI---GSTQNSEN-GDLITDAEWFYVMSLARSFSAGDGV  507
              +    +Q  RK+V+  + +LI   GS+   E   D +TD EWF+++S+ +SF  G G+
Sbjct  128  AASPE--EQEYRKRVLRELHSLISCGGSSGMDEAVEDEVTDTEWFFLVSMTQSFVNGVGL  185

Query  508  PGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+A   G+  W++G  RL    C+RA +AQ+ GIQT+VC+P G+GV+ELGS +
Sbjct  186  AGQALYAGAPSWVAGDSRLAAAPCQRAHQAQLLGIQTMVCVPVGSGVLELGSTD  239



>ref|XP_004140617.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
 gb|KGN46541.1| hypothetical protein Csa_6G107910 [Cucumis sativus]
Length=431

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 91/163 (56%), Gaps = 32/163 (20%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            L  RL+F+L +Q   W+YAIFWQT+ DD+G + L+W DG FQ                  
Sbjct  17   LHHRLRFLLHSQPLPWSYAIFWQTTTDDNGSVSLSWRDGHFQ-----------------F  59

Query  355  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  534
             +Q      ++                D  TD +WFY+MSL  SF A D +PGK+F+  S
Sbjct  60   PSQHPLSPPLLP---------------DDPTDLDWFYMMSLTSSFPAADALPGKSFTSSS  104

Query  535  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +VWL+G+  L +++C R KEA+ HGIQT +C+PT  GV+EL S
Sbjct  105  VVWLTGSEELHLHDCHRVKEAKSHGIQTFLCVPTSYGVLELAS  147



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 107/178 (60%), Gaps = 11/178 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-----GRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  63   NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGENTVILGWGDGYYRGEEDKEK--  120

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS----TQNSENGDLITDAEWFYVMSLARSFSA  495
                  +S+  +Q  RK+VI  + +LI        +  N + +TD EWF+++S+ +SF  
Sbjct  121  KKKQSSSSNPAEQEHRKRVIRELNSLIAGGGAGVSDEANDEEVTDTEWFFLVSMTQSFVN  180

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G G+PG++F    ++WLSG+  L    CERA++ +++G+QT+VCI    GVVELGS E
Sbjct  181  GVGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSE  238



>ref|XP_010058362.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=476

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 102/171 (60%), Gaps = 20/171 (12%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQ +  IL+T+T+ W Y IFW+ S D  G L L W DG FQGT             + 
Sbjct  52   TLQQLVHLILQTRTEEWIYFIFWRPSRDKHGCLVLTWADGHFQGTTRD-------PFTSK  104

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMG  531
            H+T     K+V+   Q L     +S +   I D EW+Y+ S+ARS+S+  G+ GKAF  G
Sbjct  105  HTT-----KRVLEETQCLNDKFAHSSD---IGDPEWYYIFSVARSYSSEHGLLGKAFRSG  156

Query  532  SLVWLSGA--HRLQMYNC-ERAKEAQIHGIQTLVC--IPTGAGVVELGSLE  669
              VWL+G   H L+MY C ER KEA+++GI+++ C  IP G+GV+ELGS E
Sbjct  157  GHVWLNGEDRHELEMYECDERVKEARMYGIKSIACISIPNGSGVLELGSSE  207



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 107/178 (60%), Gaps = 11/178 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD-----GRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  + W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  64   NEDTLQQRLQTLIESAGERWTYAIFWQISHDFDSPAGENTVILGWGDGYYRGEEDKEK--  121

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS----TQNSENGDLITDAEWFYVMSLARSFSA  495
                  +S+  +Q  RK+VI  + +LI        +  N + +TD EWF+++S+ +SF  
Sbjct  122  KKKQSSSSNPAEQEHRKRVIRELNSLIAGGGAGVSDEANDEEVTDTEWFFLVSMTQSFVN  181

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G G+PG++F    ++WLSG+  L    CERA++ +++G+QT+VCI    GVVELGS E
Sbjct  182  GVGLPGESFLNSRVIWLSGSGALTGSGCERARQGEVYGLQTIVCIAAENGVVELGSSE  239



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score =   134 bits (337),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 106/183 (58%), Gaps = 17/183 (9%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  + W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  46   NEDTLQQRLQALIESAGEKWTYAIFWQISHDFESPAGDNAVVLGWGDGYYKGEEDKEKK-  104

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGST---------QNSENGDLITDAEWFYVMSLA  480
                   S+  +Q  RK+VI  + +LI             +  N + +TD EWF+++S+ 
Sbjct  105  --KKSSNSNPAEQEHRKRVIRELNSLISGGGGGGGGVGVSDESNDEEVTDTEWFFLVSMT  162

Query  481  RSFSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELG  660
            +SF+ G G+PG++F    ++WLSG+  L    CERA + QI+G+QT+VCI    GVVELG
Sbjct  163  QSFANGVGLPGESFLNSRVIWLSGSGALTGSGCERANQGQIYGLQTMVCIAAENGVVELG  222

Query  661  SLE  669
            S E
Sbjct  223  SSE  225



>ref|XP_010058368.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
 gb|KCW72578.1| hypothetical protein EUGRSUZ_E01047 [Eucalyptus grandis]
Length=447

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 98/170 (58%), Gaps = 20/170 (12%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            LQQ +  IL+ + + W Y+IFWQ S DD GRL L WG G F+GT        P       
Sbjct  24   LQQLVHLILQARPEDWVYSIFWQPSRDDHGRLVLTWGYGHFRGTTREPFASKPTT-----  78

Query  355  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  534
                    +V+   Q   G   +S +   I+D EW+Y+ S+ RS+S+ DG+ G+AF  G 
Sbjct  79   -------NRVLEEAQCPDGQFAHSSD---ISDPEWYYIFSVMRSYSSEDGILGRAFRSGG  128

Query  535  LVWLSGA--HRLQMYNC-ERAKEAQIHGIQTLVCIPT--GAGVVELGSLE  669
             +WLSG   H L+M  C ER KEA++HGIQ++VCI    G+GV+ELGS E
Sbjct  129  HIWLSGENHHELEMCECDERVKEARMHGIQSIVCISIADGSGVLELGSSE  178



>ref|XP_008342536.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=517

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 106/189 (56%), Gaps = 18/189 (10%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSN-DDDGRLFLAWGDGFFQGTK----AGRG  321
            Q   ST QQRLQFI++ + + W Y+IFWQ S      ++ L+W  G F  T     + R 
Sbjct  15   QETSSTFQQRLQFIVQNRPEWWVYSIFWQASKVSISDQVSLSWAGGHFWNTHDHLASKRS  74

Query  322  GGVPVVVQTSHSTQQSERKKVIS-GIQALIGSTQNSENGDLI-----TDAEWFY--VMSL  477
             GV    Q        ER KVI+  ++AL+       +  L+     TD+EWFY   +SL
Sbjct  75   SGVINSYQPKFGFSNGERSKVINQEVEALLHDDMVDLDMRLVDHEDATDSEWFYFYTVSL  134

Query  478  ARSFSAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  642
             +SFSAG G     + G+AF  G  VWL+G H  Q Y CER KEA++HGIQTLVCI T  
Sbjct  135  TQSFSAGQGNNSKNIVGRAFGSGGFVWLAGDHDFQFYECERVKEARMHGIQTLVCIATPC  194

Query  643  GVVELGSLE  669
            GV+EL SL+
Sbjct  195  GVLELASLD  203



>ref|XP_010538501.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=646

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 105/177 (59%), Gaps = 10/177 (6%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND---DDGRLFLAWGDGFFQGTKAGRGGGVP  333
            N  TLQQRLQ +++   + W YAIFWQ S D    DG   L WGDG+++G +    G   
Sbjct  67   NEDTLQQRLQSLIEGAREPWTYAIFWQLSYDFPGGDGTALLGWGDGYYKGEE--DKGKSR  124

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQ-----NSENGDLITDAEWFYVMSLARSFSAG  498
                ++ + +Q  RK+VI  + ALI   +     +    + +TD E F+++S+ +SF  G
Sbjct  125  KKCSSASAAEQEHRKRVIRELNALISGGEAVGAADDAGDEEVTDTEGFFLVSMTQSFLNG  184

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG+A      +WL+G+  L    CERA++ QI+G+QTLVCIP+  GVVELGS E
Sbjct  185  TGLPGQASLNSRTIWLAGSGVLAGSGCERARQGQIYGLQTLVCIPSENGVVELGSTE  241



>ref|XP_008238755.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=483

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 107/184 (58%), Gaps = 15/184 (8%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  T QQRLQFI + + + W Y+IFWQ S D + ++ L+W  G F+   +        
Sbjct  15   QENLGTFQQRLQFIFQNRPEWWVYSIFWQPSKDSNDQVSLSWAAGDFR-VNSDLASKRNN  73

Query  337  VVQTSHSTQQSERKKV--ISGIQALIGSTQNS------ENGDLITDAEWFYV--MSLARS  486
             V  +H  +    KKV  I   +AL+            ++GD +T +EWFY   +SL +S
Sbjct  74   KVTNNHQPKFGFNKKVTSIEAEEALLDEDMVDLEMRLVDHGD-VTGSEWFYFYSVSLTQS  132

Query  487  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  657
            F+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  133  FAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPYGVLEL  192

Query  658  GSLE  669
             SL+
Sbjct  193  ASLD  196



>ref|XP_008238754.1| PREDICTED: transcription factor MYC4-like isoform X1 [Prunus 
mume]
Length=484

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 107/184 (58%), Gaps = 15/184 (8%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  T QQRLQFI + + + W Y+IFWQ S D + ++ L+W  G F+   +        
Sbjct  15   QENLGTFQQRLQFIFQNRPEWWVYSIFWQPSKDSNDQVSLSWAAGDFR-VNSDLASKRNN  73

Query  337  VVQTSHSTQQSERKKV--ISGIQALIGSTQNS------ENGDLITDAEWFYV--MSLARS  486
             V  +H  +    KKV  I   +AL+            ++GD +T +EWFY   +SL +S
Sbjct  74   KVTNNHQPKFGFNKKVTSIEAEEALLDEDMVDLEMRLVDHGD-VTGSEWFYFYSVSLTQS  132

Query  487  FSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVEL  657
            F+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV+EL
Sbjct  133  FAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPYGVLEL  192

Query  658  GSLE  669
             SL+
Sbjct  193  ASLD  196



>ref|XP_010494857.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 107/177 (60%), Gaps = 13/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  55   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  109

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                   +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  110  KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDEANDEEVTDTEWFFLVSMTQSFPNG  169

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG+  L    CERA + QI+G++T+VCI    GVVELGS E
Sbjct  170  VGLPGESFLNSRVIWLSGSGALTGSGCERAGQGQIYGLKTMVCIAAQNGVVELGSSE  226



>ref|XP_010940945.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=448

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 98/165 (59%), Gaps = 18/165 (11%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
             LQ RLQ++L  +++ WAYAIFW+ + D      L++G+G F+G +            T 
Sbjct  37   NLQHRLQYLLHARSEWWAYAIFWRAAPDHH---LLSFGEGHFRGVR-----------DTG  82

Query  352  HSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGD-GVPGKAFSM  528
                         GI AL+       +GD   +AEWFYV+SL+RSF AGD  VP +A+  
Sbjct  83   PRGSCGGGGGGGGGIHALLSDDAGPTDGD---EAEWFYVVSLSRSFVAGDPAVPARAYGS  139

Query  529  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             + VWL+GAH LQ   C+RA+EAQ+HGI+TLVC+P   GV+ELGS
Sbjct  140  LAPVWLTGAHALQSCGCDRAREAQLHGIETLVCVPLPGGVLELGS  184



>ref|XP_010935028.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=641

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 106/172 (62%), Gaps = 7/172 (4%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRL-FLAWGDGFFQGTKAGRGGGVPVV  339
            +H +LQ RLQ +++   DSW YAIFWQ+S D       L WGDG+++G +  +       
Sbjct  38   SHESLQHRLQTLIEGARDSWTYAIFWQSSADAASGAALLGWGDGYYKGFQEDKR----TR  93

Query  340  VQTSHSTQQSERKKVISGIQALIGSTQNSENG--DLITDAEWFYVMSLARSFSAGDGVPG  513
               +  ++Q  RK+V+  +  LI S    ++   + +TD EWF+++S+ +SF AG G+PG
Sbjct  94   RAAASGSEQEHRKRVLRELNCLISSGAAPDDAVEEEVTDMEWFFLVSMTQSFIAGVGLPG  153

Query  514  KAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            +A   G+ VW++G  R+    C+RA++A   G+QT+ CIP G+GV+ELGS E
Sbjct  154  QALLSGAPVWIAGGDRMAAAQCDRARQAHAFGLQTMACIPVGSGVLELGSTE  205



>ref|XP_010910582.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=441

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 103/173 (60%), Gaps = 29/173 (17%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-----LFLAWGDGFFQGTKAGRGGGVPV  336
            TLQ RLQ +L ++ + WAYAI W+ S+ +DG      L L+W  G F+G +         
Sbjct  33   TLQLRLQCLLHSRLEWWAYAILWRPSSAEDGAAAGCPLVLSWEAGHFRGAR---------  83

Query  337  VVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDG--VP  510
                      ++  + ++G  A++GS   + +G  +TD EWFYV+SL RSF+AGD   +P
Sbjct  84   ---------DADPPRKVAG-DAVVGS---AADGCGVTDVEWFYVLSLPRSFTAGDAATLP  130

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             + F   S VWL+G   L    CERA+EAQ+HG++TLVC+P G GV+E+GS E
Sbjct  131  ARVFRSLSPVWLAGGDALHACRCERAREAQLHGVETLVCVPAGGGVLEMGSAE  183



>ref|XP_009408104.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=613

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 101/167 (60%), Gaps = 6/167 (4%)
 Frame = +1

Query  172  TLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTS  351
            TLQQRL  +++   + W YAIFWQ+S    G   L WGDG+++G +  +    P+    S
Sbjct  78   TLQQRLHSLIEGAREKWTYAIFWQSS-PPSGAAVLTWGDGYYRGCEEDKRK--PLRSGAS  134

Query  352  HSTQQSERKKVISGIQALI---GSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAF  522
             + +Q  RK V+  + ALI       +    + +TD EWF+++S+ ++F+ G G PG+AF
Sbjct  135  SAAEQEHRKHVLRELNALIYGGCGGGDDAADEEVTDTEWFFLVSMTQTFAPGAGHPGQAF  194

Query  523  SMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
              GS  W++GA R+    CER ++AQ  G++T+ C+P  +GVVELGS
Sbjct  195  LSGSPAWIAGADRMAAAPCERVRQAQAFGLRTMACVPLESGVVELGS  241



>ref|XP_009393178.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=454

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 97/171 (57%), Gaps = 30/171 (18%)
 Frame = +1

Query  157  QPNHST-LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVP  333
            QP  +T LQ+RLQ +L+ + + WAYAIFW+ S D      L++GDG F+G +        
Sbjct  53   QPAPATELQRRLQCLLQARPEWWAYAIFWRASPD---HRVLSFGDGHFRGARC-------  102

Query  334  VVVQTSHSTQQSERKKVISGIQALIGSTQNSENG-DLITDAEWFYVMSLARSFSAGDGVP  510
                    T +  R           G     E G D + DAEWFY+MSL+RSF  G  +P
Sbjct  103  -------PTDRRPR-----------GCYAADEAGADAVDDAEWFYIMSLSRSFVGGGAIP  144

Query  511  GKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
             + +    L+WL+GAH LQ   C+R++EAQ+HGIQTL C+P   GV+ELGS
Sbjct  145  ARVYGSLELLWLTGAHALQACGCDRSREAQLHGIQTLACVPVPGGVLELGS  195



>ref|XP_009796881.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=424

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 97/167 (58%), Gaps = 28/167 (17%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQT  348
            +TLQ+ LQ+I+ ++ + W YAIFWQ S D +GRL  +WGDG F+GTK             
Sbjct  8    NTLQKHLQYIIHSRQEWWVYAIFWQASKDANGRLIFSWGDGHFRGTK-------------  54

Query  349  SHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSM  528
                       + +     I +  N+     ++D E FY++S+ + F A + +  +A++ 
Sbjct  55   ----------NLANSATVRIPNVDNN-----VSDTELFYMVSVPKYFVADNELIVRAYNP  99

Query  529  GSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             S +WL+    LQ+YN +RAKEA +HGI+TLVCIPT  GVVELGS E
Sbjct  100  TSYIWLNNYDELQLYNYDRAKEAHLHGIRTLVCIPTPNGVVELGSSE  146



>ref|XP_004166899.1| PREDICTED: transcription factor ATR2-like [Cucumis sativus]
Length=431

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 91/163 (56%), Gaps = 32/163 (20%)
 Frame = +1

Query  175  LQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVVQTSH  354
            L  RL+F+L +Q   W+YAIFWQT+ DD+G + L+W DG FQ                  
Sbjct  17   LHHRLRFLLHSQPLPWSYAIFWQTTTDDNGSVSLSWRDGHFQ-----------------F  59

Query  355  STQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAGDGVPGKAFSMGS  534
             +Q      ++                D  TD +WFY+MSL  SF A D +PGK+F+  S
Sbjct  60   PSQHPLSPPLLP---------------DDPTDLDWFYMMSLTSSFLAADALPGKSFTSSS  104

Query  535  LVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            +VWL+G+  L +++C R KEA+ HGIQT +C+PT  GV+EL S
Sbjct  105  VVWLTGSEELHLHDCHRVKEAKSHGIQTFLCVPTSYGVLELAS  147



>ref|XP_010941241.1| PREDICTED: transcription factor MYC2-like [Elaeis guineensis]
Length=665

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 105/181 (58%), Gaps = 23/181 (13%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGT-------KAGRG  321
            +   LQ RLQ +++   ++W YAIFWQ+S D      L WGDG+++G        +A  G
Sbjct  60   SQENLQHRLQTLIEGARENWTYAIFWQSSGD----AVLGWGDGYYKGCEEDKRKRRASGG  115

Query  322  GGVPVVVQTSHSTQQSERKKVISGIQALI-----GSTQNSENGDLITDAEWFYVMSLARS  486
              VP       + +Q  RK+V+  + +LI     G+  +    D +TD EWF+++S+ +S
Sbjct  116  SAVP-------AAEQEHRKRVLRELNSLISGGAGGAVPDDMVEDEVTDTEWFFLVSMTQS  168

Query  487  FSAGDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSL  666
            F AG G+PG+A   G+  W++G  R+    CERA+ A + G+QT+ C+P  +GVVELGS 
Sbjct  169  FVAGAGLPGQALLSGAPTWVAGGERMVNSPCERARHAHVFGLQTMACVPVVSGVVELGST  228

Query  667  E  669
            +
Sbjct  229  D  229



>ref|XP_009360190.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=468

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 106/182 (58%), Gaps = 22/182 (12%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLF-LAWGDGFFQGT------KAG  315
            Q N  TLQ RLQFI++ + + W Y+IFWQ S+ D   L  L+W  G F+ T      ++ 
Sbjct  15   QENSLTLQ-RLQFIIQNRPEQWVYSIFWQASSKDSNDLVSLSWAGGHFRSTGDLASKQSY  73

Query  316  RGGGVPVVVQTSHSTQQSERKKVISG-IQALIGSTQNSENGDLITDAEWFY--VMSLARS  486
                V  VV         +RK  IS  ++AL     + + GD +TDAEWFY    SL +S
Sbjct  74   NKANVFDVV---------DRKNGISREVEALFYEDMDLDGGD-VTDAEWFYFYTASLTQS  123

Query  487  FSAGDG-VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            F+AG G + G+ F  G  VWL+G H LQ Y CER KEA++HGI TLVCI T  GV+EL S
Sbjct  124  FTAGHGNILGRTFCSGDFVWLAGDHELQFYECERVKEARMHGIHTLVCIATSCGVLELAS  183

Query  664  LE  669
            L+
Sbjct  184  LD  185



>ref|XP_007210206.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
 gb|EMJ11405.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
Length=459

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 107/187 (57%), Gaps = 21/187 (11%)
 Frame = +1

Query  157  QPNHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPV  336
            Q N  T QQRLQFI + + + W Y IFWQ+S D + ++ L+W  G F+   +        
Sbjct  15   QENLGTFQQRLQFIFQNRPEWWLYWIFWQSSKDSNDQVSLSWAAGDFR-VNSDLASKRNN  73

Query  337  VVQTSHSTQQSERKKVIS--GIQALIGSTQNSENGDL---------ITDAEWFYV--MSL  477
             V  +H  +    KKV S    +AL     + +  DL         +T++EWFY   +SL
Sbjct  74   KVSNNHQPKFGFNKKVTSREAEEALF----DEDMADLEMRLVDHEDVTESEWFYFYSVSL  129

Query  478  ARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGV  648
             +SF+AG   + + G+AF  G  VWL+GAH LQ Y CER KEA++HGIQTLVCI T  GV
Sbjct  130  TQSFAAGHATNNILGRAFCSGGFVWLAGAHELQFYECERVKEARMHGIQTLVCIATPCGV  189

Query  649  VELGSLE  669
            +EL SL+
Sbjct  190  LELASLD  196



>gb|KFK28472.1| hypothetical protein AALP_AA7G000700 [Arabis alpina]
Length=543

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 109/178 (61%), Gaps = 16/178 (9%)
 Frame = +1

Query  166  HSTLQQRLQFILKTQTDSWAYAIFWQTSNDDD--------GRLFLAWGDGFFQGTKAGRG  321
            H+ LQQ+LQ +++    +W YA+FW +S++D+            L WGDG+++G +  + 
Sbjct  50   HNNLQQKLQALIEGANQNWTYAVFWLSSHEDNNNNNNNNNASAMLCWGDGYYKGGEEYKS  109

Query  322  GGVPVVVQTSHSTQQSERKKVISGIQALIGS--TQNSENGDLITDAEWFYVMSLARSFSA  495
                   + S+  +Q  RK+VI  + +L+ S    +S+  + +TD EWF+++S+ +SF  
Sbjct  110  R------KKSNPLEQEHRKRVIRELNSLLSSGFVVSSDEDEEVTDTEWFFLVSMTQSFIN  163

Query  496  GDGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
            G G+P +AFS  + +WLSG++ L    C RA + Q++G++T+VC+P   GVVELGS E
Sbjct  164  GSGLPSQAFSNSNTIWLSGSNALASSCCVRACQGQVYGLETMVCVPVMNGVVELGSWE  221



>gb|KDP22548.1| hypothetical protein JCGZ_26379 [Jatropha curcas]
Length=469

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 101/175 (58%), Gaps = 15/175 (9%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKA--------GRGG  324
            S L  RLQFIL+++ + W YA+FWQ + D  G L L+W DG F G K          + G
Sbjct  22   SPLHHRLQFILQSRPECWLYAVFWQATKDATGSLVLSWADGSFHGAKEFAAKASNHNKFG  81

Query  325  GVPVVVQTSHSTQQSERKKVISGIQALIGSTQNSENGDLITDAEWFYVMSLARSFSAG-D  501
              P   +T+      E   + S    + G      + D+I D EWFY +S+ RS++   D
Sbjct  82   FNPEKRKTTMINSNKEFPTLFSDEMDMDGLA----DVDVI-DYEWFYTVSVTRSYAVDRD  136

Query  502  GVPGKAFSMGSLVWLSGAHRLQMYN-CERAKEAQIHGIQTLVCIPTGAGVVELGS  663
            G+  +AF  G+ +WL+G + LQ+Y+ C+R KEA++HGIQTLVCI T  GVVE GS
Sbjct  137  GILSRAFGSGNFIWLTGDNELQLYDYCDRVKEARMHGIQTLVCISTCNGVVEFGS  191



>ref|XP_008238769.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=485

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 111/190 (58%), Gaps = 31/190 (16%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N +  QQRLQF+++++ + W Y+IFW+ S D +G++ L+WG G FQ  +        +  
Sbjct  17   NPAIFQQRLQFLVQSRPECWVYSIFWRASKDSNGQVALSWGAGDFQIDRD-------LTS  69

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSE----------------NGDLITDAEWFYV--  468
            +T++    + + K+  G+   + S +  E                +GD +T +EWFY   
Sbjct  70   KTTNKVTNNYQPKI--GLTKKVTSREAEEALFHEDMVDLEMRLVDHGD-VTGSEWFYFYS  126

Query  469  MSLARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTG  639
            +SL +SF+AG   + + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T 
Sbjct  127  VSLTQSFAAGHATNNILGRAFCSGGFVWLAGVHELQFYECERVKEARMHGIQTLVCIATS  186

Query  640  AGVVELGSLE  669
             GV+EL S++
Sbjct  187  CGVLELASVD  196



>ref|XP_010441550.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 107/177 (60%), Gaps = 13/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  56   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  110

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                   +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  111  KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFPNG  170

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG+  L    C+RA + QI+G++T+VCI    GVVELGS E
Sbjct  171  VGLPGESFLNSRVIWLSGSGALTGSGCKRAGQGQIYGLKTMVCIAAQNGVVELGSSE  227



>ref|XP_010481417.1| PREDICTED: transcription factor MYC3 [Camelina sativa]
Length=610

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 107/177 (60%), Gaps = 13/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSND-----DDGRLFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D      D  + L WGDG+++G +      
Sbjct  56   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGDNTVILGWGDGYYKGEED-----  110

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                   +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  111  KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFPNG  170

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG+  L    C+RA + QI+G++T+VCI    GVVELGS E
Sbjct  171  VGLPGESFLNSRVIWLSGSGALTGSGCKRAGQGQIYGLKTMVCIAAQNGVVELGSSE  227



>ref|XP_008350027.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=517

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 105/185 (57%), Gaps = 19/185 (10%)
 Frame = +1

Query  169  STLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTK----AGRGGGVPV  336
            +T QQRLQFI++   + W Y+IFW+ S D   ++ L+W  G FQ T       R      
Sbjct  21   TTFQQRLQFIVQNVPEWWVYSIFWRASKDSSDQVSLSWAGGHFQNTHDHLAXKRSNQXTS  80

Query  337  VVQTSHSTQQSERKKVISG-IQALIGS------TQNSENGDLITDAE--WFYVMSLARSF  489
              Q        E KKVI+  ++AL+         +  ++GD +TD+E  +FY +SL +SF
Sbjct  81   SYQPKFGFNNVEGKKVINREVEALLHDDVMDLDMRLVDHGD-VTDSELFYFYTVSLTQSF  139

Query  490  SAGDG-----VPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVE  654
            SA  G     + G+AF  G  VWL+G H  Q Y CER KEA++HGIQTLVCI T  GVVE
Sbjct  140  SASHGNNSNNIFGRAFGSGGFVWLAGDHEFQFYECERVKEARMHGIQTLVCIATPCGVVE  199

Query  655  LGSLE  669
            L SL+
Sbjct  200  LASLD  204



>ref|XP_007210117.1| hypothetical protein PRUPE_ppa022165mg [Prunus persica]
 gb|EMJ11316.1| hypothetical protein PRUPE_ppa022165mg [Prunus persica]
Length=442

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 109/189 (58%), Gaps = 29/189 (15%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGRLFLAWGDGFFQGTKAGRGGGVPVVV  342
            N +  QQRLQF+++ + + W Y+IFW+ S D +G++ L+WG G FQ  +        +  
Sbjct  17   NPAIFQQRLQFLVQNRPECWVYSIFWRASKDSNGQVALSWGAGDFQIDR-------DLAT  69

Query  343  QTSHSTQQSERKKVISGIQALIGSTQNSE---NGDLI------------TDAEWFYV--M  471
            +T++    + + K   G+   + S +  E   N D++            T +EWFY   +
Sbjct  70   KTTNKVTNNYQPKF--GLTKKMTSREAEEALFNEDMVDLEMRLVDHGDVTGSEWFYFYSV  127

Query  472  SLARSFSAG---DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGA  642
            SL +SF+AG   + + G+AF  G  VWL+G H LQ Y CER KEA++HGIQTLVCI T  
Sbjct  128  SLTQSFAAGHATNNILGRAFCSGGFVWLAGVHELQFYECERVKEARMHGIQTLVCIATSC  187

Query  643  GVVELGSLE  669
            GV+EL S++
Sbjct  188  GVLELASVD  196



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 106/177 (60%), Gaps = 13/177 (7%)
 Frame = +1

Query  163  NHSTLQQRLQFILKTQTDSWAYAIFWQTSNDDDGR-----LFLAWGDGFFQGTKAGRGGG  327
            N  TLQQRLQ ++++  ++W YAIFWQ S+D D       + L WGDG+++G +      
Sbjct  50   NEDTLQQRLQALIESAGENWTYAIFWQISHDFDSSTGENTVILGWGDGYYKGEED-----  104

Query  328  VPVVVQTSHSTQQSERKKVISGIQALIGS---TQNSENGDLITDAEWFYVMSLARSFSAG  498
                   +++ +Q  RK+VI  + +LI       +  N + +TD EWF+++S+ +SF  G
Sbjct  105  KEKKKNNTNTAEQEHRKRVIRELNSLISGGIGVSDESNDEEVTDTEWFFLVSMTQSFVNG  164

Query  499  DGVPGKAFSMGSLVWLSGAHRLQMYNCERAKEAQIHGIQTLVCIPTGAGVVELGSLE  669
             G+PG++F    ++WLSG   L    CERA + QI+G++T+VCI    GVVELGS E
Sbjct  165  VGLPGESFLNSRVIWLSGPGALTGSGCERAGQGQIYGLKTMVCIAAQNGVVELGSSE  221



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780