BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF037A12

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57282.1|  POZ/BTB containing protein                             179   6e-49   Ipomoea nil [qian niu]
ref|XP_009789090.1|  PREDICTED: BTB/POZ domain-containing protein...    175   1e-47   Nicotiana sylvestris
gb|ACQ59090.1|  BTB/POZ protein                                         172   1e-46   Nicotiana benthamiana
gb|ADW41580.1|  BTB domain protein                                      167   2e-46   Nicotiana benthamiana
ref|XP_009625070.1|  PREDICTED: BTB/POZ domain-containing protein...    171   6e-46   Nicotiana tomentosiformis
ref|XP_004248069.1|  PREDICTED: BTB/POZ domain-containing protein...    168   4e-45   Solanum lycopersicum
ref|XP_009789089.1|  PREDICTED: BTB/POZ domain-containing protein...    168   5e-45   Nicotiana sylvestris
ref|XP_010326766.1|  PREDICTED: BTB/POZ domain-containing protein...    168   6e-45   
ref|XP_006339663.1|  PREDICTED: BTB/POZ domain-containing protein...    168   7e-45   Solanum tuberosum [potatoes]
ref|XP_009614365.1|  PREDICTED: BTB/POZ domain-containing protein...    167   9e-45   Nicotiana tomentosiformis
ref|XP_009772583.1|  PREDICTED: BTB/POZ domain-containing protein...    164   1e-43   Nicotiana sylvestris
ref|XP_009625060.1|  PREDICTED: BTB/POZ domain-containing protein...    164   2e-43   Nicotiana tomentosiformis
ref|XP_006358650.1|  PREDICTED: BTB/POZ domain-containing protein...    163   4e-43   Solanum tuberosum [potatoes]
ref|XP_010326992.1|  PREDICTED: BTB/POZ domain-containing protein...    162   1e-42   Solanum lycopersicum
ref|XP_010326760.1|  PREDICTED: BTB/POZ domain-containing protein...    161   1e-42   Solanum lycopersicum
ref|XP_009614366.1|  PREDICTED: BTB/POZ domain-containing protein...    159   8e-42   Nicotiana tomentosiformis
ref|XP_009377240.1|  PREDICTED: BTB/POZ domain-containing protein...    136   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_008348526.1|  PREDICTED: BTB/POZ domain-containing protein...    134   5e-33   
gb|KJB49507.1|  hypothetical protein B456_008G122900                    134   6e-33   Gossypium raimondii
ref|XP_011093267.1|  PREDICTED: BTB/POZ domain-containing protein...    134   7e-33   Sesamum indicum [beniseed]
gb|KHG04846.1|  BTB/POZ domain-containing POB1 -like protein            133   2e-32   Gossypium arboreum [tree cotton]
ref|XP_002279915.1|  PREDICTED: BTB/POZ domain-containing protein...    131   8e-32   Vitis vinifera
ref|XP_011093257.1|  PREDICTED: BTB/POZ domain-containing protein...    127   2e-30   
ref|XP_010661871.1|  PREDICTED: BTB/POZ domain-containing protein...    127   3e-30   Vitis vinifera
gb|KHG17323.1|  BTB/POZ domain-containing POB1 -like protein            126   3e-30   Gossypium arboreum [tree cotton]
emb|CBI34431.3|  unnamed protein product                                125   6e-30   Vitis vinifera
ref|XP_010658715.1|  PREDICTED: BTB/POZ domain-containing protein...    126   6e-30   Vitis vinifera
ref|XP_010251562.1|  PREDICTED: BTB/POZ domain-containing protein...    125   1e-29   Nelumbo nucifera [Indian lotus]
ref|XP_011093066.1|  PREDICTED: BTB/POZ domain-containing protein...    124   2e-29   Sesamum indicum [beniseed]
ref|XP_008357345.1|  PREDICTED: BTB/POZ domain-containing protein...    124   3e-29   
gb|KJB41445.1|  hypothetical protein B456_007G104800                    122   1e-28   Gossypium raimondii
ref|XP_010251563.1|  PREDICTED: BTB/POZ domain-containing protein...    121   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_007051648.1|  POZ/BTB containin G-protein 1 isoform 1            120   4e-28   
gb|EYU38918.1|  hypothetical protein MIMGU_mgv1a0037491mg               118   5e-28   Erythranthe guttata [common monkey flower]
gb|KDP28535.1|  hypothetical protein JCGZ_14306                         120   6e-28   Jatropha curcas
ref|XP_011468961.1|  PREDICTED: BTB/POZ domain-containing protein...    120   6e-28   Fragaria vesca subsp. vesca
gb|EYU32197.1|  hypothetical protein MIMGU_mgv1a003926mg                120   6e-28   Erythranthe guttata [common monkey flower]
emb|CDP08731.1|  unnamed protein product                                120   7e-28   Coffea canephora [robusta coffee]
ref|XP_011093065.1|  PREDICTED: BTB/POZ domain-containing protein...    117   7e-27   Sesamum indicum [beniseed]
ref|XP_007135185.1|  hypothetical protein PHAVU_010G108100g             117   1e-26   Phaseolus vulgaris [French bean]
gb|AGV54323.1|  BTB/POZ domain-containing protein POB1-like protein     116   1e-26   Phaseolus vulgaris [French bean]
ref|XP_007135186.1|  hypothetical protein PHAVU_010G108200g             116   2e-26   Phaseolus vulgaris [French bean]
ref|XP_007040412.1|  POZ/BTB containin G-protein 1 isoform 1            115   7e-26   Theobroma cacao [chocolate]
ref|XP_002511951.1|  atpob1, putative                                   114   1e-25   Ricinus communis
gb|KHN35353.1|  BTB/POZ domain-containing protein POB1                  113   2e-25   Glycine soja [wild soybean]
ref|XP_003521793.1|  PREDICTED: BTB/POZ domain-containing protein...    113   3e-25   Glycine max [soybeans]
gb|KDP25348.1|  hypothetical protein JCGZ_20504                         112   4e-25   Jatropha curcas
ref|XP_008233229.1|  PREDICTED: BTB/POZ domain-containing protein...    112   5e-25   Prunus mume [ume]
ref|XP_004510713.1|  PREDICTED: BTB/POZ domain-containing protein...    111   1e-24   Cicer arietinum [garbanzo]
emb|CAN63457.1|  hypothetical protein VITISV_008241                     111   1e-24   Vitis vinifera
ref|XP_007218966.1|  hypothetical protein PRUPE_ppa003673mg             111   2e-24   
ref|XP_003554745.1|  PREDICTED: BTB/POZ domain-containing protein...    110   2e-24   Glycine max [soybeans]
ref|XP_010053775.1|  PREDICTED: BTB/POZ domain-containing protein...    110   3e-24   Eucalyptus grandis [rose gum]
ref|XP_003528818.1|  PREDICTED: BTB/POZ domain-containing protein...    110   3e-24   Glycine max [soybeans]
gb|KDO86370.1|  hypothetical protein CISIN_1g008916mg                   107   3e-23   Citrus sinensis [apfelsine]
ref|XP_006444905.1|  hypothetical protein CICLE_v10019570mg             107   4e-23   Citrus clementina [clementine]
ref|XP_010261454.1|  PREDICTED: BTB/POZ domain-containing protein...    105   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002301391.1|  BTB/POZ domain-containing family protein           104   3e-22   
ref|NP_567115.1|  POZ/BTB containin G-protein 1                         103   7e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850733.1|  POZ/BTB containin G-protein 1                         103   8e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004133826.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Cucumis sativus [cucumbers]
gb|ADN34171.1|  ATPOB protein binding                                   103   1e-21   Cucumis melo subsp. melo
ref|XP_008437944.1|  PREDICTED: BTB/POZ domain-containing protein...    103   1e-21   Cucumis melo [Oriental melon]
gb|AFK39130.1|  unknown                                                 102   1e-21   Lotus japonicus
ref|XP_006293934.1|  hypothetical protein CARUB_v10022924mg             102   1e-21   Capsella rubella
ref|XP_003548592.1|  PREDICTED: BTB/POZ domain-containing protein...    102   1e-21   Glycine max [soybeans]
gb|KHN15978.1|  BTB/POZ domain-containing protein POB1                  102   1e-21   Glycine soja [wild soybean]
ref|XP_006444906.1|  hypothetical protein CICLE_v10019570mg             102   2e-21   
ref|XP_010544783.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_010506625.1|  PREDICTED: BTB/POZ domain-containing protein...    102   2e-21   Camelina sativa [gold-of-pleasure]
ref|NP_566069.1|  protein LIGHT-RESPONSE BTB 1                          102   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506624.1|  PREDICTED: BTB/POZ domain-containing protein...    102   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011037494.1|  PREDICTED: BTB/POZ domain-containing protein...    101   5e-21   Populus euphratica
ref|XP_002876624.1|  BTB/POZ domain-containing protein                  101   6e-21   
ref|XP_011023241.1|  PREDICTED: BTB/POZ domain-containing protein...    100   7e-21   Populus euphratica
ref|XP_010508047.1|  PREDICTED: BTB/POZ domain-containing protein...    100   1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010092900.1|  BTB/POZ domain-containing protein                99.8    2e-20   Morus notabilis
ref|XP_010261455.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_002509901.1|  atpob1, putative                                 99.8    3e-20   
ref|XP_002880228.1|  BTB/POZ domain-containing protein                99.0    3e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010518296.1|  PREDICTED: BTB/POZ domain-containing protein...  99.0    4e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010669540.1|  PREDICTED: BTB/POZ domain-containing protein...  98.6    4e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006402466.1|  hypothetical protein EUTSA_v10005840mg           98.2    7e-20   Eutrema salsugineum [saltwater cress]
gb|KJB52236.1|  hypothetical protein B456_008G251700                  96.7    2e-19   Gossypium raimondii
gb|EPS71516.1|  hypothetical protein M569_03239                       96.7    2e-19   Genlisea aurea
gb|KJB52233.1|  hypothetical protein B456_008G251700                  96.7    2e-19   Gossypium raimondii
ref|XP_009104325.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    2e-19   Brassica rapa
ref|XP_009626291.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    3e-19   Nicotiana tomentosiformis
ref|XP_006476450.1|  PREDICTED: BTB/POZ domain-containing protein...  96.3    3e-19   Citrus sinensis [apfelsine]
ref|XP_008458155.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    3e-19   Cucumis melo [Oriental melon]
gb|KFK35343.1|  hypothetical protein AALP_AA5G272300                  95.5    5e-19   Arabis alpina [alpine rockcress]
ref|XP_006439421.1|  hypothetical protein CICLE_v10019554mg           95.1    6e-19   Citrus clementina [clementine]
ref|XP_009789895.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    7e-19   Nicotiana sylvestris
ref|XP_004138466.1|  PREDICTED: BTB/POZ domain-containing protein...  95.1    7e-19   Cucumis sativus [cucumbers]
ref|XP_002320175.2|  BTB/POZ domain-containing family protein         95.1    7e-19   
gb|KJB52235.1|  hypothetical protein B456_008G251700                  95.1    7e-19   Gossypium raimondii
emb|CAB71090.1|  putative protein                                     95.1    7e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KDO76407.1|  hypothetical protein CISIN_1g007950mg                 95.1    8e-19   Citrus sinensis [apfelsine]
ref|XP_009789894.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    9e-19   Nicotiana sylvestris
emb|CDY52008.1|  BnaC06g42880D                                        94.4    1e-18   Brassica napus [oilseed rape]
ref|XP_008798670.1|  PREDICTED: BTB/POZ domain-containing protein...  93.2    3e-18   Phoenix dactylifera
emb|CDP12109.1|  unnamed protein product                              94.0    3e-18   Coffea canephora [robusta coffee]
ref|XP_009133768.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    4e-18   Brassica rapa
ref|XP_010914379.1|  PREDICTED: BTB/POZ domain-containing protein...  92.4    5e-18   Elaeis guineensis
ref|XP_009104326.1|  PREDICTED: BTB/POZ domain-containing protein...  92.0    8e-18   Brassica rapa
gb|AAM61110.1|  unknown                                               91.7    9e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009104323.1|  PREDICTED: BTB/POZ domain-containing protein...  91.7    1e-17   Brassica rapa
ref|XP_002303620.1|  hypothetical protein POPTR_0003s13510g           91.3    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006397812.1|  hypothetical protein EUTSA_v10001385mg           90.9    2e-17   
gb|KFK35342.1|  hypothetical protein AALP_AA5G272300                  90.9    2e-17   Arabis alpina [alpine rockcress]
gb|KDO76410.1|  hypothetical protein CISIN_1g007950mg                 90.9    2e-17   Citrus sinensis [apfelsine]
ref|XP_006397813.1|  hypothetical protein EUTSA_v10001385mg           90.9    2e-17   Eutrema salsugineum [saltwater cress]
ref|XP_008238990.1|  PREDICTED: BTB/POZ domain-containing protein...  90.9    2e-17   Prunus mume [ume]
ref|XP_002299499.2|  hypothetical protein POPTR_0001s10190g           90.9    2e-17   
ref|XP_007209857.1|  hypothetical protein PRUPE_ppa003692mg           90.5    2e-17   Prunus persica
gb|KDO76409.1|  hypothetical protein CISIN_1g007950mg                 90.5    2e-17   Citrus sinensis [apfelsine]
ref|XP_009772687.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    4e-17   Nicotiana sylvestris
ref|XP_009617879.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    6e-17   Nicotiana tomentosiformis
ref|XP_011022567.1|  PREDICTED: BTB/POZ domain-containing protein...  87.8    2e-16   Populus euphratica
ref|XP_007147261.1|  hypothetical protein PHAVU_006G109600g           87.8    2e-16   Phaseolus vulgaris [French bean]
emb|CDX83375.1|  BnaA03g21310D                                        87.8    2e-16   
ref|XP_004138465.1|  PREDICTED: BTB/POZ domain-containing protein...  85.9    1e-15   
ref|XP_003637208.1|  Kelch-like protein                               84.3    3e-15   
gb|KHG30067.1|  BTB/POZ domain-containing POB1 -like protein          84.3    3e-15   Gossypium arboreum [tree cotton]
ref|XP_006290834.1|  hypothetical protein CARUB_v10016944mg           84.3    4e-15   Capsella rubella
gb|KJB39679.1|  hypothetical protein B456_007G025100                  84.0    4e-15   Gossypium raimondii
ref|XP_003637209.1|  Kelch-like protein                               83.6    6e-15   
gb|KEH18742.1|  BTB/POZ domain protein POB1                           83.2    7e-15   Medicago truncatula
gb|EYU40044.1|  hypothetical protein MIMGU_mgv1a004127mg              82.4    1e-14   Erythranthe guttata [common monkey flower]
ref|XP_006402465.1|  hypothetical protein EUTSA_v10005840mg           81.6    3e-14   Eutrema salsugineum [saltwater cress]
emb|CDX95684.1|  BnaC03g25650D                                        81.3    3e-14   
ref|XP_009104327.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    6e-14   Brassica rapa
ref|XP_009142670.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  80.5    6e-14   Brassica rapa
ref|XP_010915728.1|  PREDICTED: BTB/POZ domain-containing protein...  80.5    7e-14   Elaeis guineensis
ref|XP_004494778.1|  PREDICTED: BTB/POZ domain-containing protein...  79.7    9e-14   Cicer arietinum [garbanzo]
emb|CDX80003.1|  BnaA05g01530D                                        79.3    1e-13   
gb|KJB22357.1|  hypothetical protein B456_004G043000                  79.3    1e-13   Gossypium raimondii
gb|KHG04418.1|  BTB/POZ domain-containing POB1 -like protein          79.3    1e-13   Gossypium arboreum [tree cotton]
emb|CDY42028.1|  BnaC04g01060D                                        78.6    2e-13   Brassica napus [oilseed rape]
ref|XP_008392473.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    5e-13   Malus domestica [apple tree]
ref|XP_010053177.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    7e-13   
ref|XP_008794992.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    7e-13   Phoenix dactylifera
ref|XP_004951269.1|  PREDICTED: BTB/POZ domain-containing protein...  75.9    2e-12   Setaria italica
ref|NP_001142262.1|  uncharacterized protein LOC100274431             75.5    2e-12   Zea mays [maize]
ref|XP_010469101.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_011026945.1|  PREDICTED: BTB/POZ domain-containing protein...  75.1    3e-12   Populus euphratica
gb|ABK24446.1|  unknown                                               74.7    5e-12   Picea sitchensis
ref|XP_010413379.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010512512.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    7e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004951268.1|  PREDICTED: BTB/POZ domain-containing protein...  73.9    8e-12   Setaria italica
ref|XP_002451902.1|  hypothetical protein SORBIDRAFT_04g009720        73.9    8e-12   Sorghum bicolor [broomcorn]
ref|XP_010469099.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_007040415.1|  POZ/BTB containin G-protein 1 isoform 4          73.2    1e-11   
ref|XP_010925790.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Elaeis guineensis
ref|XP_010676365.1|  PREDICTED: BTB/POZ domain-containing protein...  72.4    3e-11   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI40464.3|  unnamed protein product                              71.6    5e-11   Vitis vinifera
ref|XP_008794993.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    5e-11   
ref|XP_008793877.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    1e-10   Phoenix dactylifera
ref|XP_011463940.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    1e-10   Fragaria vesca subsp. vesca
ref|XP_009410863.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    2e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN27269.1|  BTB/POZ domain-containing protein POB1                68.6    4e-10   Glycine soja [wild soybean]
ref|NP_001146028.1|  hypothetical protein                             66.6    2e-09   Zea mays [maize]
gb|AFW65829.1|  hypothetical protein ZEAMMB73_711899                  66.6    2e-09   
ref|XP_004298859.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    8e-09   Fragaria vesca subsp. vesca
ref|XP_006842893.1|  hypothetical protein AMTR_s00075p00053230        59.3    3e-08   
ref|XP_006360698.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    3e-08   
ref|XP_006343902.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   Solanum tuberosum [potatoes]
ref|XP_011073542.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    1e-07   Sesamum indicum [beniseed]
ref|NP_001142889.1|  hypothetical protein                             57.4    1e-07   Zea mays [maize]
ref|XP_009419783.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006830392.1|  hypothetical protein AMTR_s00116p00144700        55.8    6e-07   
gb|ACG45607.1|  hypothetical protein                                  55.8    8e-07   Zea mays [maize]
ref|XP_009410864.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    8e-07   
ref|XP_010522933.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    9e-07   Tarenaya hassleriana [spider flower]
ref|XP_010522934.1|  PREDICTED: BTB/POZ domain-containing protein...  58.5    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_009380541.1|  PREDICTED: BTB/POZ domain-containing protein...  58.2    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380540.1|  PREDICTED: BTB/POZ domain-containing protein...  57.4    2e-06   
gb|EPS68073.1|  hypothetical protein M569_06692                       57.4    3e-06   Genlisea aurea
ref|XP_008677104.1|  PREDICTED: uncharacterized protein LOC100279...  57.0    3e-06   Zea mays [maize]
dbj|BAJ93322.1|  predicted protein                                    56.6    5e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT40121.1|  GAMYB-binding protein                                 56.2    7e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009419784.1|  PREDICTED: BTB/POZ domain-containing protein...  55.8    7e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010522935.1|  PREDICTED: BTB/POZ domain-containing protein...  55.5    1e-05   Tarenaya hassleriana [spider flower]
gb|AFW76704.1|  hypothetical protein ZEAMMB73_633282                  53.9    1e-05   
ref|XP_001771535.1|  predicted protein                                55.1    1e-05   
ref|XP_010098414.1|  hypothetical protein L484_000083                 52.0    1e-05   
dbj|BAJ95490.1|  predicted protein                                    54.7    2e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX71727.1|  BnaC08g31470D                                        53.9    3e-05   
gb|ACN26008.1|  unknown                                               53.9    3e-05   Zea mays [maize]
gb|AIB05667.1|  TRAF transcription factor                             53.9    4e-05   Zea mays [maize]
ref|XP_002961299.1|  ubiquitin-protein ligase, POB1                   53.9    4e-05   
ref|XP_006590500.1|  PREDICTED: BTB/POZ domain-containing protein...  53.5    4e-05   Glycine max [soybeans]
ref|XP_001760430.1|  predicted protein                                53.5    5e-05   
ref|XP_002983257.1|  ubiquitin-protein ligase, POB1                   53.1    6e-05   
ref|XP_007051650.1|  POZ/BTB containin G-protein 1 isoform 3          53.1    7e-05   
gb|KCW78131.1|  hypothetical protein EUGRSUZ_D02337                   52.8    8e-05   Eucalyptus grandis [rose gum]
ref|NP_001046484.1|  Os02g0260700                                     52.8    8e-05   
gb|EEC72875.1|  hypothetical protein OsI_06647                        52.8    9e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_007051653.1|  POZ/BTB containin G-protein 1 isoform 6          52.8    9e-05   
ref|XP_009116827.1|  PREDICTED: BTB/POZ domain-containing protein...  52.4    1e-04   Brassica rapa
ref|XP_003572201.1|  PREDICTED: BTB/POZ domain-containing protein...  52.0    2e-04   Brachypodium distachyon [annual false brome]
ref|NP_001148937.1|  GAMYB-binding protein                            52.0    2e-04   Zea mays [maize]
ref|XP_011093067.1|  PREDICTED: BTB/POZ domain-containing protein...  51.6    2e-04   Sesamum indicum [beniseed]
gb|EMT31791.1|  hypothetical protein F775_32011                       51.6    2e-04   
emb|CDY11366.1|  BnaA09g39320D                                        51.6    2e-04   Brassica napus [oilseed rape]
ref|NP_001057726.2|  Os06g0507400                                     51.2    3e-04   
ref|XP_004252576.1|  PREDICTED: BTB/POZ domain-containing protein...  51.2    3e-04   Solanum lycopersicum
ref|XP_006656117.1|  PREDICTED: BTB/POZ domain-containing protein...  50.4    5e-04   
ref|XP_010925791.1|  PREDICTED: BTB/POZ domain-containing protein...  50.1    7e-04   Elaeis guineensis



>dbj|BAO57282.1| POZ/BTB containing protein [Ipomoea nil]
Length=549

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD+ LDLFDPRTAVMDPDYSPT+    PDF FAFNDSNFSDRLLRIE+VADSSD  SDS
Sbjct  1    MKDRNLDLFDPRTAVMDPDYSPTTGR-QPDFAFAFNDSNFSDRLLRIEIVADSSDQLSDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            +  Q+LADW RHRK+R      ENALDI+   EEQI+ C+ ID +D D  NQ+E+VVAMI
Sbjct  60   EGCQSLADWARHRKRRKEDTKNENALDITICPEEQILTCHQIDPDDVDTENQEESVVAMI  119

Query  607  EEAQSGDEAANSEDSNWNIDS  669
            EE QSGDEA NSEDS+WN+DS
Sbjct  120  EEVQSGDEAPNSEDSDWNMDS  140



>ref|XP_009789090.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana sylvestris]
Length=552

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 113/143 (79%), Gaps = 3/143 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKDQ LDLFDPRTAVMDP++SPTS    PDF FAFNDSNFSDR+LRIE++ DS D   DS
Sbjct  1    MKDQNLDLFDPRTAVMDPEFSPTSTR-EPDFAFAFNDSNFSDRVLRIEIIGDSLDGDGDS  59

Query  427  das--QTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            D+    +LADW R+RK+R     KENALDI+   EEQI++CN ID+EDADN NQDE+VVA
Sbjct  60   DSHGCHSLADWARNRKRRREDFKKENALDITACPEEQIISCNQIDSEDADNENQDESVVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDS  669
            MIEE  SGDEAANS+DS WN DS
Sbjct  120  MIEEPNSGDEAANSDDSTWNCDS  142



>gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana]
Length=552

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 111/143 (78%), Gaps = 3/143 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssda--cs  420
            MKDQ LDLFDPRTAVMDP++SPT     PDF FAFNDSNFSDR+LRIE+V DS D    S
Sbjct  1    MKDQNLDLFDPRTAVMDPEFSPTRTR-EPDFAFAFNDSNFSDRVLRIEIVGDSLDGDGAS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            DS    +LADW R+RK+R     KENALDI+   EEQI++CN ID+EDADN NQDE+VVA
Sbjct  60   DSHGCHSLADWARNRKRRREDFKKENALDITACPEEQIISCNQIDSEDADNENQDESVVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDS  669
            MIEE  SGDEAANS+DS WN DS
Sbjct  120  MIEEPNSGDEAANSDDSTWNCDS  142



>gb|ADW41580.1| BTB domain protein [Nicotiana benthamiana]
Length=306

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 108/140 (77%), Gaps = 3/140 (2%)
 Frame = +1

Query  256  QILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssda--csdsd  429
            Q LDLFDPRTAVMDP++SPT     PDF FAFNDSNFSDR+LRIE+V DS D    SDS 
Sbjct  6    QNLDLFDPRTAVMDPEFSPTRTR-EPDFAFAFNDSNFSDRVLRIEIVGDSLDGDGASDSH  64

Query  430  asQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIE  609
               +LADW R+RK+R     KENALDI+   EEQI++CN ID+EDADN NQDE+VVAMIE
Sbjct  65   GCHSLADWARNRKRRREDFKKENALDITACPEEQIISCNQIDSEDADNENQDESVVAMIE  124

Query  610  EAQSGDEAANSEDSNWNIDS  669
            E  SGDEAANS+DS WN DS
Sbjct  125  EPNSGDEAANSDDSTWNCDS  144



>ref|XP_009625070.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=552

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 111/143 (78%), Gaps = 3/143 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssda--cs  420
            MKDQ LDLFDPRTAV+DP++SPT     PDF FAFNDSNFSDR+LRIE+V DS D    S
Sbjct  1    MKDQNLDLFDPRTAVIDPEFSPTRTR-EPDFAFAFNDSNFSDRVLRIEIVGDSLDGDGTS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            DS    +LADW R+RK+R     KENALDI+   EEQI++CN ID+EDADN NQDE+VVA
Sbjct  60   DSHGCHSLADWARNRKRRREDFKKENALDITACPEEQIISCNQIDSEDADNENQDESVVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDS  669
            MIEE  SGDEAANS+DS WN DS
Sbjct  120  MIEEPNSGDEAANSDDSTWNCDS  142



>ref|XP_004248069.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Solanum lycopersicum]
Length=551

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa-dssdacsd  423
            MKDQ LDLFDPRTAVMDP+YSPT     PDF FAF+D NFSDR+LRIE++    +   S 
Sbjct  1    MKDQNLDLFDPRTAVMDPEYSPTHTG-EPDFAFAFDDVNFSDRILRIEILGDSIAGGSSS  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAM  603
                 +LADW R+RK+R     KENALDI+   E+QI+ CN ID+EDADN NQDEAVVAM
Sbjct  60   DGGCSSLADWARNRKRRREDFRKENALDITACPEDQIICCNQIDSEDADNENQDEAVVAM  119

Query  604  IEEAQSGDEAANSEDSNWNIDS  669
            IEE  SGDEAANS+DS WN DS
Sbjct  120  IEETNSGDEAANSDDSTWNCDS  141



>ref|XP_009789089.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana sylvestris]
Length=559

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 113/150 (75%), Gaps = 10/150 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKDQ LDLFDPRTAVMDP++SPTS    PDF FAFNDSNFSDR+LRIE++ DS D   DS
Sbjct  1    MKDQNLDLFDPRTAVMDPEFSPTSTR-EPDFAFAFNDSNFSDRVLRIEIIGDSLDGDGDS  59

Query  427  da--sQTLADWTRHRKQRGGGDFKEN-------ALDISTYQEEQIVNCNPIDTEDADNGN  579
            D+    +LADW R+RK+R     KEN       ALDI+   EEQI++CN ID+EDADN N
Sbjct  60   DSHGCHSLADWARNRKRRREDFKKENDMCHSFAALDITACPEEQIISCNQIDSEDADNEN  119

Query  580  QDEAVVAMIEEAQSGDEAANSEDSNWNIDS  669
            QDE+VVAMIEE  SGDEAANS+DS WN DS
Sbjct  120  QDESVVAMIEEPNSGDEAANSDDSTWNCDS  149



>ref|XP_010326766.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Solanum lycopersicum]
Length=552

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 3/143 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadss--dacs  420
            MKDQ LDLFDPRTAVMDP+YSP+S    PDFGFAFND NFSDRLL+IE++ADS    + S
Sbjct  1    MKDQNLDLFDPRTAVMDPEYSPSSTR-DPDFGFAFNDVNFSDRLLQIEIMADSFDPQSDS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            DS  SQ+LADW R+RK+R     KE ALDI+   EEQ+++CN IDTED +N NQDE+VVA
Sbjct  60   DSFHSQSLADWARNRKRRREDIRKEMALDITACPEEQVISCNQIDTEDVENENQDESVVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDS  669
            MIEE  SGDEA N++DS+WN DS
Sbjct  120  MIEEPHSGDEATNADDSSWNFDS  142



>ref|XP_006339663.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=552

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 3/143 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadss--dacs  420
            MKDQ LDLFDPRTAVMDP+YSP+S    PDFGFAFND NFSDRLL+IE++ADS    + S
Sbjct  1    MKDQNLDLFDPRTAVMDPEYSPSSTR-DPDFGFAFNDVNFSDRLLQIEIMADSFDPQSDS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            DS  SQ+LADW R+RK+R     KE ALDI+   EEQ+++CN IDTED +N NQDE+VVA
Sbjct  60   DSFHSQSLADWARNRKRRREDIRKEMALDITACPEEQVISCNQIDTEDVENENQDESVVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDS  669
            MIEE  SGDEA N++DS+WN DS
Sbjct  120  MIEEPHSGDEATNADDSSWNFDS  142



>ref|XP_009614365.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=548

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKDQ LDLFDPRTA+MDP YSP  A   PDFGFAFNDSNFSDRLLRIE++AD  D     
Sbjct  1    MKDQNLDLFDPRTAIMDPGYSPNRAR-DPDFGFAFNDSNFSDRLLRIEIMADPLDPEGFH  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
               Q+LADW R+RK+R     K+ ALDI+   EEQI++CN I TEDA+N NQDE+VVAMI
Sbjct  60   C--QSLADWARNRKRRRDDINKDMALDITACPEEQIISCNQIYTEDAENENQDESVVAMI  117

Query  607  EEAQSGDEAANSEDSNWNIDS  669
            EE  SGDEAAN++DS+WN DS
Sbjct  118  EEPHSGDEAANTDDSSWNFDS  138



>ref|XP_009772583.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
sylvestris]
Length=545

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 106/141 (75%), Gaps = 6/141 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKDQ LDLFDPR AVMDP+ SP+ A   PDFGFAFNDSNFSDRLLRIE++AD        
Sbjct  1    MKDQNLDLFDPRMAVMDPESSPSRAR-DPDFGFAFNDSNFSDRLLRIEIMADPEGFHC--  57

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
               Q+LADW R+RK+R     K+  LDI+   EEQI++CN IDTEDA+N NQDE+VVAMI
Sbjct  58   ---QSLADWARNRKRRRDDINKDMTLDITACPEEQIISCNQIDTEDAENENQDESVVAMI  114

Query  607  EEAQSGDEAANSEDSNWNIDS  669
            EE  SGDEAAN++D +WN DS
Sbjct  115  EEPHSGDEAANTDDCSWNFDS  135



>ref|XP_009625060.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=559

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 111/150 (74%), Gaps = 10/150 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssda--cs  420
            MKDQ LDLFDPRTAV+DP++SPT     PDF FAFNDSNFSDR+LRIE+V DS D    S
Sbjct  1    MKDQNLDLFDPRTAVIDPEFSPTRTR-EPDFAFAFNDSNFSDRVLRIEIVGDSLDGDGTS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKEN-------ALDISTYQEEQIVNCNPIDTEDADNGN  579
            DS    +LADW R+RK+R     KEN       ALDI+   EEQI++CN ID+EDADN N
Sbjct  60   DSHGCHSLADWARNRKRRREDFKKENDMCHSFAALDITACPEEQIISCNQIDSEDADNEN  119

Query  580  QDEAVVAMIEEAQSGDEAANSEDSNWNIDS  669
            QDE+VVAMIEE  SGDEAANS+DS WN DS
Sbjct  120  QDESVVAMIEEPNSGDEAANSDDSTWNCDS  149



>ref|XP_006358650.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=551

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa-dssdacsd  423
            MK Q LDLFDPRTAVMDP+YSPT     PDF FAF+D NFSDR+LRIE++    +   + 
Sbjct  1    MKYQNLDLFDPRTAVMDPEYSPTHTG-EPDFAFAFDDVNFSDRILRIEILGDSIAGGSNS  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAM  603
            S    +LADW R+RK+R     KENALDI+   E+Q++ CN ID+EDADN NQDEAVVAM
Sbjct  60   SGGCSSLADWARNRKRRREDFRKENALDITACPEDQVICCNQIDSEDADNENQDEAVVAM  119

Query  604  IEEAQSGDEAANSEDSNWNIDS  669
            IEE  SGDE ANS+DS WN DS
Sbjct  120  IEEPNSGDEGANSDDSTWNCDS  141



>ref|XP_010326992.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Solanum lycopersicum]
Length=558

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 105/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa-dssdacsd  423
            MKDQ LDLFDPRTAVMDP+YSPT     PDF FAF+D NFSDR+LRIE++    +   S 
Sbjct  1    MKDQNLDLFDPRTAVMDPEYSPTHTG-EPDFAFAFDDVNFSDRILRIEILGDSIAGGSSS  59

Query  424  sdasQTLADWTRHRKQRGGGDFKEN-------ALDISTYQEEQIVNCNPIDTEDADNGNQ  582
                 +LADW R+RK+R     KEN       ALDI+   E+QI+ CN ID+EDADN NQ
Sbjct  60   DGGCSSLADWARNRKRRREDFRKENDMYHSFAALDITACPEDQIICCNQIDSEDADNENQ  119

Query  583  DEAVVAMIEEAQSGDEAANSEDSNWNIDS  669
            DEAVVAMIEE  SGDEAANS+DS WN DS
Sbjct  120  DEAVVAMIEETNSGDEAANSDDSTWNCDS  148



>ref|XP_010326760.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Solanum lycopersicum]
Length=557

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 113/148 (76%), Gaps = 8/148 (5%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadss--dacs  420
            MKDQ LDLFDPRTAVMDP+YSP+S    PDFGFAFND NFSDRLL+IE++ADS    + S
Sbjct  1    MKDQNLDLFDPRTAVMDPEYSPSSTR-DPDFGFAFNDVNFSDRLLQIEIMADSFDPQSDS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            DS  SQ+LADW R+RK+R     KE ALDI+   EEQ+++CN IDTED +N NQDE+VVA
Sbjct  60   DSFHSQSLADWARNRKRRREDIRKEMALDITACPEEQVISCNQIDTEDVENENQDESVVA  119

Query  601  MIEEAQS-----GDEAANSEDSNWNIDS  669
            MIEE  S     GDEA N++DS+WN DS
Sbjct  120  MIEEPHSVFCSAGDEATNADDSSWNFDS  147



>ref|XP_009614366.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=539

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 104/141 (74%), Gaps = 12/141 (9%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKDQ LDLFDPRTA+MDP YSP  A   PDFGFAFNDSNFSDRLLRIE++AD  D     
Sbjct  1    MKDQNLDLFDPRTAIMDPGYSPNRAR-DPDFGFAFNDSNFSDRLLRIEIMADPLDPEGFH  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
               Q+LADW R+RK+          LDI+   EEQI++CN I TEDA+N NQDE+VVAMI
Sbjct  60   C--QSLADWARNRKR---------PLDITACPEEQIISCNQIYTEDAENENQDESVVAMI  108

Query  607  EEAQSGDEAANSEDSNWNIDS  669
            EE  SGDEAAN++DS+WN DS
Sbjct  109  EEPHSGDEAANTDDSSWNFDS  129



>ref|XP_009377240.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Pyrus 
x bretschneideri]
Length=556

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 102/147 (69%), Gaps = 5/147 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHP----DFGFAFNDSNFSDRLLRIEVVadssda  414
            MK+   DLFDPRT +M+PD+S    P       DFGFAFNDSNFSDRLLRIE++ D+ ++
Sbjct  1    MKELNTDLFDPRTTLMEPDFSRAVTPSADADGDDFGFAFNDSNFSDRLLRIEIMGDTPES  60

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              DS+A  ++ADW RHRK+R     KEN LD++   EEQI+N N  D +D +   NQDE 
Sbjct  61   RPDSEACTSIADWARHRKRRREDIKKENILDLAECPEEQILNDNQPDMDDCEGCENQDEE  120

Query  592  VVAMIEEAQSGDEAANSEDSNWNIDSS  672
             VAM+EE+ SGDEAANS DS+W +D S
Sbjct  121  AVAMVEESPSGDEAANSNDSDWGMDCS  147



>ref|XP_008348526.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=556

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 5/147 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHP----DFGFAFNDSNFSDRLLRIEVVadssda  414
            MK+   DLFDPRT +M+PD+S    P       DFGFAFNDSNFSDRLLR+E++ D+ ++
Sbjct  1    MKELNTDLFDPRTTLMEPDFSRXVTPSADADGDDFGFAFNDSNFSDRLLRMEIMGDTPES  60

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              DS+A  ++ADW RHRK+R     KEN LD++   EEQI+N N  D +D +   NQDE 
Sbjct  61   RPDSEACTSIADWARHRKRRREDIKKENILDLAECPEEQILNDNQPDMDDCEGCENQDEE  120

Query  592  VVAMIEEAQSGDEAANSEDSNWNIDSS  672
             VAM+EE+ SGDEAANS DS+W +D S
Sbjct  121  AVAMVEESPSGDEAANSNDSDWGMDCS  147



>gb|KJB49507.1| hypothetical protein B456_008G122900 [Gossypium raimondii]
Length=552

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 97/144 (67%), Gaps = 3/144 (2%)
 Frame = +1

Query  247  MKDQI-LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            MKDQ+  DLFDPR   MD DYS  SA    DFGFAFNDSNFSDRLLRIE++   SD   D
Sbjct  1    MKDQLNSDLFDPRNE-MDSDYSRGSAGSGGDFGFAFNDSNFSDRLLRIEIMGGPSDCLPD  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVA  600
             +   ++ADW RHRK+R     KEN LD+S   EEQ++N    D +DA    NQDE  VA
Sbjct  60   GEGCTSIADWARHRKRRREDMKKENVLDLSLCPEEQVLNDGQPDMDDAAGCENQDEEAVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDSS  672
            M+EE QSGDE ANS +S+WN+D S
Sbjct  120  MVEETQSGDEEANSNESSWNMDCS  143



>ref|XP_011093267.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Sesamum indicum]
 ref|XP_011093272.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Sesamum indicum]
Length=555

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 104/146 (71%), Gaps = 4/146 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPT-SAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+D  LDLFDPRTAV+D D S + +    PDFGFAFNDSNFSDR+LRIE+VAD  +A  +
Sbjct  1    MRDWGLDLFDPRTAVLDSDSSSSPTGGGDPDFGFAFNDSNFSDRVLRIEIVADPPEAPPE  60

Query  424  sdasQTLADWTRHRKQRGGGDF--KENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAV  594
            S+  +TLADW   + +R  GD   KENALDI+   EEQI++C   D ED A + N DE  
Sbjct  61   SEGCRTLADWAARKSKRRRGDVVKKENALDINNCPEEQILDCQQPDVEDGAGDENHDEED  120

Query  595  VAMIEEAQSGDEAANSEDSNWNIDSS  672
            + MIE++ SGDEAANS+DSNW+ D S
Sbjct  121  IPMIEDSPSGDEAANSDDSNWSEDGS  146



>gb|KHG04846.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=552

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 96/144 (67%), Gaps = 3/144 (2%)
 Frame = +1

Query  247  MKDQI-LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            MKDQ+  DLFDPR   MD DYS  SA    DFGFAFNDSNFSDRLLRIE++   SD   D
Sbjct  1    MKDQLNSDLFDPRNE-MDSDYSRGSAGSGGDFGFAFNDSNFSDRLLRIEIMGGPSDCLPD  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVA  600
             +   ++ADW RHRK+R     KEN LD+S   EEQ+ N    D +DA    NQDE  VA
Sbjct  60   GEGCTSIADWARHRKRRREDMKKENVLDLSLCPEEQVFNDGQPDMDDAAGCENQDEEAVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDSS  672
            M+EE QSGDE ANS +S+WN+D S
Sbjct  120  MVEETQSGDEDANSNESSWNMDCS  143



>ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Vitis vinifera]
Length=553

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAP--PHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            M+D   DLFDPRTA MD D SP S P     DFGFAFNDSNFSDR+LRIE++A S D+ S
Sbjct  1    MRDSNTDLFDPRTA-MDSDSSPGSTPTVSSCDFGFAFNDSNFSDRVLRIEIMAGSQDSRS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVV  597
            + +   ++ADW RHRK+R     KEN  DI    EEQI+NCN  D +D     N+DE  V
Sbjct  60   EGEGCTSIADWARHRKRRREDIKKENGADIVACPEEQILNCNQPDVDDVVACENEDEEAV  119

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AMIEE+ SGDEA    +S WN+D S
Sbjct  120  AMIEESASGDEAEVGNNSAWNMDCS  144



>ref|XP_011093257.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093262.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
 ref|XP_011093265.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
Length=562

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 104/153 (68%), Gaps = 11/153 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPT-SAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+D  LDLFDPRTAV+D D S + +    PDFGFAFNDSNFSDR+LRIE+VAD  +A  +
Sbjct  1    MRDWGLDLFDPRTAVLDSDSSSSPTGGGDPDFGFAFNDSNFSDRVLRIEIVADPPEAPPE  60

Query  424  sdasQTLADWTRHRKQRGGGDF--KEN-------ALDISTYQEEQIVNCNPIDTED-ADN  573
            S+  +TLADW   + +R  GD   KEN       ALDI+   EEQI++C   D ED A +
Sbjct  61   SEGCRTLADWAARKSKRRRGDVVKKENDMYHSFAALDINNCPEEQILDCQQPDVEDGAGD  120

Query  574  GNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
             N DE  + MIE++ SGDEAANS+DSNW+ D S
Sbjct  121  ENHDEEDIPMIEDSPSGDEAANSDDSNWSEDGS  153



>ref|XP_010661871.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Vitis vinifera]
Length=551

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 96/145 (66%), Gaps = 6/145 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAP--PHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            M+D   DLFDPRTA MD D SP S P     DFGFAFNDSNFSDR+LRIE++A S D+ S
Sbjct  1    MRDSNTDLFDPRTA-MDSDSSPGSTPTVSSCDFGFAFNDSNFSDRVLRIEIMAGSQDSRS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVV  597
            + +   ++ADW RHRK+R     KEN  DI    EEQI+NCN  D +D     N+DE  V
Sbjct  60   EGEGCTSIADWARHRKRRREDIKKEN--DIVACPEEQILNCNQPDVDDVVACENEDEEAV  117

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AMIEE+ SGDEA    +S WN+D S
Sbjct  118  AMIEESASGDEAEVGNNSAWNMDCS  142



>gb|KHG17323.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=552

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 95/144 (66%), Gaps = 3/144 (2%)
 Frame = +1

Query  247  MKDQI-LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+DQ+  DLFDPRT  M PD+S  ++    DFGFAFNDSNFSDRLLRIE++        D
Sbjct  1    MRDQLNSDLFDPRTE-MVPDFSRGASSSDGDFGFAFNDSNFSDRLLRIEIMGGPPQCRPD  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVA  600
             +   ++ADW RHRK+R     KE  LD+S   EEQI+N N  D +D     NQDE  VA
Sbjct  60   GEGCTSIADWARHRKRRREDIKKETVLDLSLCPEEQILNDNQPDMDDGVGCENQDEEPVA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDSS  672
            M+EE QSGDE ANS +S+W++D S
Sbjct  120  MVEETQSGDEDANSNESSWSMDCS  143



>emb|CBI34431.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 100/156 (64%), Gaps = 17/156 (11%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAP----PHPDFGFAFNDSNFSDRLLRIEVVadssda  414
            MKD  +DLFDPRT +MD D SP+          DF FAFNDSNFSDRLLRIE++AD  ++
Sbjct  48   MKDSNVDLFDPRT-IMDSDLSPSGVAGGSVSDSDFAFAFNDSNFSDRLLRIEIIADLPES  106

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEA  591
              D +   ++ADW R+RK+R     KENA+D+  + EEQI+NCN  DTED     NQDE 
Sbjct  107  KGDGEGCNSIADWARNRKRRREEIKKENAVDV--HHEEQILNCNMPDTEDGVAYENQDEE  164

Query  592  VVAMIEE---------AQSGDEAANSEDSNWNIDSS  672
             VAMIEE         +Q GDEA +S DS+W +D S
Sbjct  165  AVAMIEESPPGVGMNLSQHGDEAGHSSDSSWGMDCS  200



>ref|XP_010658715.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis 
vinifera]
Length=562

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 100/156 (64%), Gaps = 17/156 (11%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHP----DFGFAFNDSNFSDRLLRIEVVadssda  414
            MKD  +DLFDPRT +MD D SP+          DF FAFNDSNFSDRLLRIE++AD  ++
Sbjct  1    MKDSNVDLFDPRT-IMDSDLSPSGVAGGSVSDSDFAFAFNDSNFSDRLLRIEIIADLPES  59

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEA  591
              D +   ++ADW R+RK+R     KENA+D+  + EEQI+NCN  DTED     NQDE 
Sbjct  60   KGDGEGCNSIADWARNRKRRREEIKKENAVDV--HHEEQILNCNMPDTEDGVAYENQDEE  117

Query  592  VVAMIEE---------AQSGDEAANSEDSNWNIDSS  672
             VAMIEE         +Q GDEA +S DS+W +D S
Sbjct  118  AVAMIEESPPGVGMNLSQHGDEAGHSSDSSWGMDCS  153



>ref|XP_010251562.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Nelumbo nucifera]
Length=553

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 98/145 (68%), Gaps = 4/145 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTS--APPHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MK+  +DLFDPRT +MD D+S +        DF FAFNDSNFSDRLLRIE++A   +  S
Sbjct  1    MKESNVDLFDPRT-IMDSDFSSSGNGVSSDGDFAFAFNDSNFSDRLLRIEIMAGLPENKS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVV  597
            D +   ++ADW R+RK+R     KE A D +  +EEQI+NC   DTED     NQDE  V
Sbjct  60   DGEGCNSIADWARNRKRRREDIKKEAATDFTLCREEQILNCGQPDTEDGVAYENQDEEPV  119

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AMIEE+ SGDEAA+S +S+W++D S
Sbjct  120  AMIEESPSGDEAAHSNESSWSMDCS  144



>ref|XP_011093066.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Sesamum indicum]
Length=557

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 5/146 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH-PDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+   LDLFDPR+ V+   Y+ + A    PDFGFAFNDSNFSDR+LRIE+VAD  +A  +
Sbjct  1    MRGSGLDLFDPRSTVIASAYTSSRAGSRDPDFGFAFNDSNFSDRVLRIEIVADPMEARPE  60

Query  424  sdasQTLADWT--RHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD-NGNQDEAV  594
            S ASQTLADW   + +++RG    KENALDI+ + EEQI++C P D E+ D + N DE  
Sbjct  61   SKASQTLADWAARKSKRRRGNVAKKENALDINNFPEEQILDCQP-DAEEGDGDENHDEEE  119

Query  595  VAMIEEAQSGDEAANSEDSNWNIDSS  672
            +   E++ SGDEAA S+DSNW+ D S
Sbjct  120  IPTTEDSPSGDEAALSDDSNWSGDGS  145



>ref|XP_008357345.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=556

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 5/147 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHP----DFGFAFNDSNFSDRLLRIEVVadssda  414
            MK+   DLFDPRT +M+PD+S    P       DF FAFNDSNFSDR LRIE++ D+ ++
Sbjct  1    MKELNTDLFDPRTTLMEPDFSRAVTPLADADGDDFAFAFNDSNFSDRQLRIEIMGDTPES  60

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              DS+A  ++ADW  HRK+R     KEN LD++   EEQI+N N  D +  +   NQDE 
Sbjct  61   RPDSEACTSIADWALHRKRRREDIKKENILDLAECPEEQILNDNQPDMDXCEGCENQDEE  120

Query  592  VVAMIEEAQSGDEAANSEDSNWNIDSS  672
             VAM+EE+ SGDEAANS DS+W +D S
Sbjct  121  PVAMVEESPSGDEAANSNDSDWGMDCS  147



>gb|KJB41445.1| hypothetical protein B456_007G104800 [Gossypium raimondii]
Length=552

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 96/148 (65%), Gaps = 11/148 (7%)
 Frame = +1

Query  247  MKDQI-LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+DQ+  DLFDPRT  M PD+S  ++    DFGFAFNDSNFSDRLLRIE++        D
Sbjct  1    MRDQLNSDLFDPRTE-MVPDFSRGASSSDGDFGFAFNDSNFSDRLLRIEIMGGPPQCRPD  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTE-DADNG----NQDE  588
             +   ++ADW RHRK+R     KE  LD+S   EEQ++N    D + D D G    NQDE
Sbjct  60   GEGCTSIADWARHRKRRREDIKKETVLDLSLCPEEQMLN----DIQPDMDGGGGFENQDE  115

Query  589  AVVAMIEEAQSGDEAANSEDSNWNIDSS  672
              VAM+EE QSGDE ANS +S+W++D S
Sbjct  116  EPVAMVEEIQSGDEDANSNESSWSMDCS  143



>ref|XP_010251563.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Nelumbo nucifera]
Length=551

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 99/145 (68%), Gaps = 6/145 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTS--APPHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MK+  +DLFDPRT +MD D+S +        DF FAFNDSNFSDRLLRIE++A   +  S
Sbjct  1    MKESNVDLFDPRT-IMDSDFSSSGNGVSSDGDFAFAFNDSNFSDRLLRIEIMAGLPENKS  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVV  597
            D +   ++ADW R+RK+R   D K+ A D +  +EEQI+NC   DTED     NQDE  V
Sbjct  60   DGEGCNSIADWARNRKRR-REDIKKEA-DFTLCREEQILNCGQPDTEDGVAYENQDEEPV  117

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AMIEE+ SGDEAA+S +S+W++D S
Sbjct  118  AMIEESPSGDEAAHSNESSWSMDCS  142



>ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
 gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
Length=552

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 91/137 (66%), Gaps = 2/137 (1%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPRT  MD D++  ++    DFGFAFNDSNFSDRLLRIE++    +   D +   ++
Sbjct  8    DLFDPRTE-MDSDFARGASGSDGDFGFAFNDSNFSDRLLRIEIMGGPPECHPDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEAQS  621
            ADW RHRK+R     KEN LD+S   +EQI+N N  D +D     N DE  VAM+EE QS
Sbjct  67   ADWARHRKRRREDIKKENVLDLSLCPDEQILNGNQPDMDDGVGCENLDEDAVAMVEETQS  126

Query  622  GDEAANSEDSNWNIDSS  672
            GDE ANS +S+W++D S
Sbjct  127  GDEDANSNESSWSMDFS  143



>gb|EYU38918.1| hypothetical protein MIMGU_mgv1a0037491mg, partial [Erythranthe 
guttata]
Length=290

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 97/152 (64%), Gaps = 10/152 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPD-YSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+   LDLFDP TAVMD D  S       PDFGFAFNDSNFSDRLLRIE+VAD S++  D
Sbjct  1    MRGSGLDLFDPTTAVMDSDDNSSPGGSRDPDFGFAFNDSNFSDRLLRIEIVADPSESQPD  60

Query  424  sdasQTLADWTRHRKQRGGGDF--KEN-------ALDISTYQEEQIVNCNPIDTEDADNG  576
            SDA QTLA W   + +R   D   KEN       ALDI+   EEQI++C     +   + 
Sbjct  61   SDACQTLAGWAARKTKRRRADIAKKENDMYHSFAALDINNCPEEQILDCESDADDGLGDA  120

Query  577  NQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
            + DE  + MIE++ SGDEAANS+DSNW+ D S
Sbjct  121  DHDEEEIPMIEDSPSGDEAANSDDSNWSGDGS  152



>gb|KDP28535.1| hypothetical protein JCGZ_14306 [Jatropha curcas]
Length=551

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            M+    DLFD  T  M+  YS  S P   DFGFAFNDSNFSDRLLRIE++ DS +  S +
Sbjct  1    MRGYNTDLFDSATE-MESVYSRQSCPSDGDFGFAFNDSNFSDRLLRIEIMDDSPEDRSGA  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAM  603
            +   ++ADW RHRK+R     KENA+++S   EEQI++CN  D +D     NQDE   AM
Sbjct  60   EGCTSIADWARHRKRRREDIKKENAVEVSVGAEEQILSCNQHDMDDCVGCENQDEEADAM  119

Query  604  IEEAQSGDEAANSEDSNWNIDSS  672
            IEE  SGDE A+  DS W++D S
Sbjct  120  IEEPPSGDEGADGNDSTWSMDCS  142



>ref|XP_011468961.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 99/143 (69%), Gaps = 8/143 (6%)
 Frame = +1

Query  265  DLFDPRTA-VMDPDYSPTSAPPHP----DFGFAFNDSNFSDRLLRIEVVadssdacsdsd  429
            DLFDPRTA VM+P+++  +    P    DF FAFNDSNFSDRLLRIE++ DS ++  DS+
Sbjct  8    DLFDPRTATVMEPEFAAVARTVTPSTDADFAFAFNDSNFSDRLLRIEIMGDSPESRPDSE  67

Query  430  asQTLADWTRHRKQRGGGDFKE--NALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAM  603
            A  ++ADW RHRK+R   DFK+    +++S   EEQI+N N  D +D    NQDE  VAM
Sbjct  68   ACTSIADWARHRKRRRE-DFKKEIGVVELSDCPEEQILNDNQPDMDDEPCENQDEDAVAM  126

Query  604  IEEAQSGDEAANSEDSNWNIDSS  672
            +EE+ SGDE ANS DS+W +D S
Sbjct  127  VEESPSGDEGANSIDSDWGMDCS  149



>gb|EYU32197.1| hypothetical protein MIMGU_mgv1a003926mg [Erythranthe guttata]
Length=555

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 6/147 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDY--SPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            M+D  LDLFDPRTAVMD D   SPT     PDFGFAFNDSNFSDR+LRIE+VAD  DA  
Sbjct  1    MRDFGLDLFDPRTAVMDSDSNSSPTGGR-DPDFGFAFNDSNFSDRVLRIEIVADPPDAPL  59

Query  421  dsdasQTLADWTRHRKQRGGGDF--KENALDISTYQEEQIVNC-NPIDTEDADNGNQDEA  591
            +++  +TLADW   R +R  GD   K+NALDI++   EQ++ C  P   E   + N DE 
Sbjct  60   ETEGFRTLADWAVRRSKRRRGDAVKKKNALDITSSSREQVLCCQQPAVEEGIGDENYDEE  119

Query  592  VVAMIEEAQSGDEAANSEDSNWNIDSS  672
                +E++ SGDEA NS+DSNW+ D S
Sbjct  120  ESLKMEDSPSGDEAENSDDSNWSEDDS  146



>emb|CDP08731.1| unnamed protein product [Coffea canephora]
Length=554

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH-PDFGFAFNDSNFSDRLLRIEVVa-dssdacs  420
            M+D  LDLFDPRTAVMD      ++    PDFGFAFNDSNFSDR+LRIEV+A DS D+ S
Sbjct  1    MRDANLDLFDPRTAVMDSSVYSPTSSSLDPDFGFAFNDSNFSDRILRIEVLADDSPDSFS  60

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVV  597
             + A Q+LADW R+RK+      ++NALDI+   EEQ++NC+  D +D   G NQDE   
Sbjct  61   AAAACQSLADWARYRKRPREDIKRQNALDITVCPEEQVLNCDQPDADDVIRGENQDEEEF  120

Query  598  AMIEEAQSGDEAAN  639
            AMIEE+ SGDEAAN
Sbjct  121  AMIEESPSGDEAAN  134



>ref|XP_011093065.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Sesamum indicum]
Length=564

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 102/153 (67%), Gaps = 12/153 (8%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH-PDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+   LDLFDPR+ V+   Y+ + A    PDFGFAFNDSNFSDR+LRIE+VAD  +A  +
Sbjct  1    MRGSGLDLFDPRSTVIASAYTSSRAGSRDPDFGFAFNDSNFSDRVLRIEIVADPMEARPE  60

Query  424  sdasQTLADWT--RHRKQRGGGDFKEN-------ALDISTYQEEQIVNCNPIDTEDAD-N  573
            S ASQTLADW   + +++RG    KEN       ALDI+ + EEQI++C P D E+ D +
Sbjct  61   SKASQTLADWAARKSKRRRGNVAKKENDMCHSFAALDINNFPEEQILDCQP-DAEEGDGD  119

Query  574  GNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
             N DE  +   E++ SGDEAA S+DSNW+ D S
Sbjct  120  ENHDEEEIPTTEDSPSGDEAALSDDSNWSGDGS  152



>ref|XP_007135185.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris]
 gb|ESW07179.1| hypothetical protein PHAVU_010G108100g [Phaseolus vulgaris]
Length=551

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 3/142 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP  A M+ ++S   +    DF FAFNDSNFSDR+LRIE++ D  DA  D+
Sbjct  1    MKDSNSDLFDPVVA-MESEWSRGGSTSDADFAFAFNDSNFSDRVLRIEIMPDPVDARPDT  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            D   T+ADW RHRK+R     K+N +DI++  +EQI+N N  D ++ +  NQDE  VAM+
Sbjct  60   DGCTTIADWARHRKRRREDVKKDNGVDIASVPDEQILNGNQPDLDECE--NQDEDAVAMV  117

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EE  SGDEA NS DS+W++D S
Sbjct  118  EEPNSGDEATNSIDSDWSMDCS  139



>gb|AGV54323.1| BTB/POZ domain-containing protein POB1-like protein [Phaseolus 
vulgaris]
Length=550

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 3/142 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP  A M+ ++S   +    DF FAFNDSNFSDR+LRIE++ D  DA  D+
Sbjct  1    MKDSNSDLFDPVVA-MESEWSRGGSTSDADFAFAFNDSNFSDRVLRIEIMPDPVDARPDT  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            D   T+ADW RHRK+R     K+N +DI++  +EQI+N N  D ++ +  NQDE  VAM+
Sbjct  60   DGCTTIADWARHRKRRREDVKKDNGVDIASVPDEQILNGNQPDLDECE--NQDEDAVAMV  117

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EE  SGDEA NS DS+W++D S
Sbjct  118  EEPNSGDEATNSIDSDWSMDCS  139



>ref|XP_007135186.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris]
 gb|ESW07180.1| hypothetical protein PHAVU_010G108200g [Phaseolus vulgaris]
Length=550

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 3/142 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD I DLFDP  A M+ D+S   +    DF FAFNDSNFSDR+LRIE++AD +DA  DS
Sbjct  1    MKDSISDLFDPVVA-MESDWSHAGSTSDADFAFAFNDSNFSDRVLRIEIMADPADAGPDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            D   T+ADW RHRK+R     K+   D +   +EQ++N N  D ++ +  NQDE  VAM+
Sbjct  60   DGCATIADWARHRKRRREDIRKDTGTDPAAMPDEQVLNGNQPDVDERE--NQDEEAVAMV  117

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EE  SGDEA NS DS+W++D +
Sbjct  118  EEPHSGDEATNSHDSDWSMDRT  139



>ref|XP_007040412.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
 gb|EOY24913.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao]
Length=564

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 94/151 (62%), Gaps = 15/151 (10%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPH----PDFGFAFNDSNFSDRLLRIEVVadssdacsdsd  429
            +DLFDPRT +MD D+SP  A        DFGFAFNDSNFSDR+LRIE++ D  +  +D D
Sbjct  6    VDLFDPRT-IMDSDFSPGEASGSGSGDSDFGFAFNDSNFSDRVLRIEIMPDLRETKADGD  64

Query  430  asQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMI  606
               ++ADW R+RK+R     KEN  D+   +EEQ +NCN  DTED     NQDE  VAMI
Sbjct  65   GCSSIADWARNRKRRREDIKKENGADVVGQREEQTLNCNMPDTEDGVTYENQDEEAVAMI  124

Query  607  EEA---------QSGDEAANSEDSNWNIDSS  672
            E +         Q G++A  S DS+WN+D S
Sbjct  125  EGSPTDVGLNSNQIGNDATPSNDSSWNMDCS  155



>ref|XP_002511951.1| atpob1, putative [Ricinus communis]
 gb|EEF50620.1| atpob1, putative [Ricinus communis]
Length=549

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 91/137 (66%), Gaps = 4/137 (3%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPRT  M+  YS  ++    DFGFAFNDSNFSDRLLRIE++ +S D   D +   ++
Sbjct  7    DLFDPRTE-MESVYSRGASSSDGDFGFAFNDSNFSDRLLRIEIMDESPDNRCDGEGCNSI  65

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEAQS  621
            ADW RHRK+R     K+NA+++S   EEQI+N  P D ED     NQDE  VAMIEE  S
Sbjct  66   ADWARHRKRRREDIKKDNAVEVSAGAEEQILN-QP-DMEDCVGCENQDEDAVAMIEEPPS  123

Query  622  GDEAANSEDSNWNIDSS  672
            GDEA +  +S W++D S
Sbjct  124  GDEAVDGNESTWSMDCS  140



>gb|KHN35353.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 93/145 (64%), Gaps = 3/145 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPD--FGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   DLFDP T +       + +    D  FGFAFNDSNFSDR+LRIE++ D  +A  
Sbjct  1    MKDFNSDLFDPGTVMDSSSSDYSRSASSSDADFGFAFNDSNFSDRILRIEIMGDPVEARP  60

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVV  597
            DS+   T+ADW RHRK+R     K+N +D++   +EQI+N N  D +D     NQDE  V
Sbjct  61   DSEGCTTIADWARHRKRRREDIKKDNVVDLTLLPDEQILNGNQPDMDDFVPTENQDEDAV  120

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AM+EE  SGDEAANS DSNWN+D S
Sbjct  121  AMVEEPPSGDEAANSNDSNWNMDCS  145



>ref|XP_003521793.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=553

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 94/145 (65%), Gaps = 3/145 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPD--FGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   DLFDP T +       + +    D  FGFAFNDSNFSDR+LRIE++ D  +A  
Sbjct  1    MKDFNSDLFDPGTVMDSSSSDYSRSASSSDADFGFAFNDSNFSDRILRIEIMGDPVEARP  60

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVV  597
            DSD   T+ADW RHRK+R     K+N +D++   +EQI+N N  D +D   + NQDE  V
Sbjct  61   DSDGCTTIADWARHRKRRREDIKKDNVVDLTLLPDEQILNGNQPDMDDFVPSENQDEDAV  120

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AM+EE  SGDEAANS DSNWN+D S
Sbjct  121  AMVEEPPSGDEAANSNDSNWNMDCS  145



>gb|KDP25348.1| hypothetical protein JCGZ_20504 [Jatropha curcas]
Length=563

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 94/149 (63%), Gaps = 14/149 (9%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTS---APPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdas  435
            DLFDPRT +MD DYSP     +   PDF FAFNDSNFSDR+LRIE++ D  +  SD D  
Sbjct  7    DLFDPRT-IMDSDYSPGGLDGSGSDPDFAFAFNDSNFSDRVLRIEIIPDLPETKSDGDPC  65

Query  436  QTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEE  612
             ++ADW R+RK+R     KE+A ++    EEQI+N N  DTED     NQDE  +AM+EE
Sbjct  66   TSIADWARNRKRRREDIKKESAAEVIGQSEEQIINVNMPDTEDVVVYENQDEEPMAMVEE  125

Query  613  A---------QSGDEAANSEDSNWNIDSS  672
                      Q GD+A+ S DS+WN+D S
Sbjct  126  PPTDADLNLNQLGDDASTSNDSSWNMDCS  154



>ref|XP_008233229.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Prunus mume]
Length=557

 Score =   112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 102/147 (69%), Gaps = 5/147 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYS----PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssda  414
            MK+   DLFDPR+ +MDPD+S    P++     DF FAFNDSNFSDRLLRIE++ D+ ++
Sbjct  2    MKELNTDLFDPRSTLMDPDFSRDATPSADADADDFAFAFNDSNFSDRLLRIEIMGDTPES  61

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              DS+A  ++ADW RHRK+R     KEN  D++   EEQI+N N  D +D +   NQDE 
Sbjct  62   RPDSEACTSIADWARHRKRRREDIKKENIPDLAECPEEQILNDNQPDMDDCEGCENQDEE  121

Query  592  VVAMIEEAQSGDEAANSEDSNWNIDSS  672
             VAM+EE+ SGDEAANS DS+W +D S
Sbjct  122  AVAMVEESPSGDEAANSNDSDWGMDCS  148



>ref|XP_004510713.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cicer 
arietinum]
Length=551

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 97/144 (67%), Gaps = 6/144 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP T VM+ +++   +    DFGFAFNDSNFSDR+LRIE++AD+ D   DS
Sbjct  1    MKDLNSDLFDPVT-VMESEWAHGGSKSDADFGFAFNDSNFSDRVLRIEIMADTVDPQPDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADN-GNQDEAVVAM  603
            +   T+ADW RHRK+R     KEN +D+    +EQI+N N  D +D     NQDE VVAM
Sbjct  60   ETCTTIADWARHRKRRREDIKKENVVDLP---DEQILNGNQPDMDDCVAPENQDEEVVAM  116

Query  604  IEEAQSGDEAANS-EDSNWNIDSS  672
            +EE+ SGDEA NS +DSN  +D S
Sbjct  117  VEESPSGDEAVNSNDDSNLGMDYS  140



>emb|CAN63457.1| hypothetical protein VITISV_008241 [Vitis vinifera]
Length=526

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DF FAFNDSNFSDRLLRIE++AD  ++  D +   ++ADW R+RK+R     KENA+D+ 
Sbjct  9    DFAFAFNDSNFSDRLLRIEIIADLPESKGDGEGCNSIADWARNRKRRREEIKKENAVDV-  67

Query  514  TYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
             + EEQI+NCN  DTED     NQDE  VAMIEE+  GDEA +S DS+W +D S
Sbjct  68   -HHEEQILNCNMPDTEDGVAYENQDEEAVAMIEESPPGDEAGHSSDSSWGMDCS  120



>ref|XP_007218966.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica]
 gb|EMJ20165.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica]
Length=557

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 5/147 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYS----PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssda  414
            MK+   DLFDPR+ +MDPD+S    P++     DF FAFNDSNFSDRLLRIE++ D+ ++
Sbjct  2    MKELNTDLFDPRSTLMDPDFSRDATPSADADADDFAFAFNDSNFSDRLLRIEIMGDTPES  61

Query  415  csdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              DS+A  ++ADW RHRK+R     KEN  D S   EEQI+N N  D +D +   NQDE 
Sbjct  62   RPDSEACTSIADWARHRKRRREDIKKENIPDPSECPEEQILNDNQPDMDDCEGCENQDEE  121

Query  592  VVAMIEEAQSGDEAANSEDSNWNIDSS  672
             VAM+EE+ SGDEAANS DS+W +D S
Sbjct  122  AVAMVEESPSGDEAANSNDSDWGMDCS  148



>ref|XP_003554745.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
 gb|KHN43127.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 93/145 (64%), Gaps = 3/145 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPD--FGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   DLFDP   +       + +    D  FGFAFNDSNFSDR+LRIE++ D  +A  
Sbjct  1    MKDFNSDLFDPGMVMDSSSSDYSRSASSSDADFGFAFNDSNFSDRILRIEIMGDPVEARP  60

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVV  597
            DS+   T+ADW RHRK+R     K+N +D++   +EQI+N N  D +D   + NQDE  V
Sbjct  61   DSEGCTTIADWARHRKRRREDIKKDNVVDLTLLPDEQILNENQPDMDDFVPSENQDEDAV  120

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AM+EE  SGDEAANS DSNWN+D S
Sbjct  121  AMVEEPPSGDEAANSNDSNWNMDCS  145



>ref|XP_010053775.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Eucalyptus 
grandis]
 gb|KCW78130.1| hypothetical protein EUGRSUZ_D02337 [Eucalyptus grandis]
Length=547

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs--  420
            M++   DLFDPR+  M+P +S +S     +FGFAFNDSNFSDR+LRIEVV   S+  S  
Sbjct  1    MREMGSDLFDPRSE-MEPQFSQSS---DGNFGFAFNDSNFSDRVLRIEVVGGPSECRSDG  56

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVA  600
            +     ++ADW R RK+R     KE ALDI+   EEQI+N  P D +D D     +  VA
Sbjct  57   EGGCCTSIADWARLRKRRREDGRKETALDITGCPEEQILN-EP-DMDDCDGPENQDDTVA  114

Query  601  MIEEAQSGDEAANSEDSNWNIDSS  672
            M+EE+ SGDEAA+S DS W++DSS
Sbjct  115  MVEESPSGDEAASSNDSGWSMDSS  138



>ref|XP_003528818.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=550

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 94/142 (66%), Gaps = 3/142 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP  A M+ ++S        DF FAFNDSNFSDR+LRIE++ D  DA  DS
Sbjct  1    MKDSNSDLFDPVMA-MESEWSRGGTTSDADFAFAFNDSNFSDRVLRIEIMHDPVDARPDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            DA  T+ADW RHRK+R     K+N  D+++  +EQ++N +  + ++ +  NQDE   AM+
Sbjct  60   DACATIADWARHRKRRREDIKKDNGADLASVPDEQVLNGHQSEADECE--NQDEEADAMV  117

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EE  SGDEA NS DS+W++D S
Sbjct  118  EEPHSGDEATNSNDSDWSMDCS  139



>gb|KDO86370.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=517

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            M+D   DLFDPRT  MD D S +++    DFGFAFNDSNFSDRLLRIE++ D  ++ SD 
Sbjct  1    MRDVNTDLFDPRTE-MDSDISRSASSSDGDFGFAFNDSNFSDRLLRIEIMGDPPESRSDG  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            +   ++ADW R RK+R     K+N LD+S   EEQI+N  P   +     NQDE V AMI
Sbjct  60   EGCTSIADWARDRKRRREDIKKDNGLDLSACPEEQILN-QPDMDDCVGCENQDEEVEAMI  118

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            E + SGDEAAN  +S+W++D S
Sbjct  119  EGSPSGDEAANGNESSWSMDCS  140



>ref|XP_006444905.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 ref|XP_006491218.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus 
sinensis]
 gb|ESR58145.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 gb|KDO86369.1| hypothetical protein CISIN_1g008916mg [Citrus sinensis]
Length=549

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            M+D   DLFDPRT  MD D S +++    DFGFAFNDSNFSDRLLRIE++ D  ++ SD 
Sbjct  1    MRDVNTDLFDPRTE-MDSDISRSASSSDGDFGFAFNDSNFSDRLLRIEIMGDPPESRSDG  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            +   ++ADW R RK+R     K+N LD+S   EEQI+N  P   +     NQDE V AMI
Sbjct  60   EGCTSIADWARDRKRRREDIKKDNGLDLSACPEEQILN-QPDMDDCVGCENQDEEVEAMI  118

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            E + SGDEAAN  +S+W++D S
Sbjct  119  EGSPSGDEAANGNESSWSMDCS  140



>ref|XP_010261454.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Nelumbo nucifera]
Length=539

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 1/114 (1%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DF FAFNDSNFSDR+LRIEV+A  S+  SD D   ++ADW R+RK+R     KENA D++
Sbjct  17   DFAFAFNDSNFSDRVLRIEVMAGLSENKSDGDGCNSIADWARNRKRRREDIKKENAADVT  76

Query  514  TYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
               EEQI+NC   D+ED     NQDE  VAMIEE+ SGDEAA   +S+W++D  
Sbjct  77   WCCEEQILNCGQPDSEDGVAYENQDEEPVAMIEESPSGDEAAQGNESSWSMDCC  130



>ref|XP_002301391.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE80664.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=556

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 90/142 (63%), Gaps = 8/142 (6%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPRT  MD D++  S+    DFGFAFNDSNFSDRLLRIE++  S++  +D +   ++
Sbjct  8    DLFDPRTE-MDSDFTRGSSASDGDFGFAFNDSNFSDRLLRIEIMGGSAENRADGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKE-----NALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMI  606
             DW RHRK+R   D K+      A D+S   EEQI+     D +D     NQDE   AM+
Sbjct  67   IDWARHRKRR-REDIKKDINNVRAGDLSVGAEEQILGSIQPDMDDCVGCDNQDEEAEAMV  125

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            E + SGDEAA+  +S+W++D S
Sbjct  126  EGSPSGDEAADGTESSWSMDCS  147



>ref|NP_567115.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
 gb|AAG44951.1|AF292397_1 POZ/BTB containing-protein AtPOB1 [Arabidopsis thaliana]
 gb|ABO38760.1| At3g61600 [Arabidopsis thaliana]
 gb|AEE80230.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
Length=561

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 85/141 (60%), Gaps = 6/141 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MDPD++   +    DFGFAFNDSNFSDRLLRIE++   SD+ S+ +   ++
Sbjct  9    DLFDPKTQ-MDPDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSEVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNGNQ--DEAVVAMIE  609
            ADW RHRK+R     KE+ +   DI    EEQI+     D +    G    DE   AM+E
Sbjct  68   ADWARHRKRRREDIKKESGVTISDIVACPEEQILTDEQPDMDGCPGGENPDDEGGEAMVE  127

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGDE   S + NW +D S
Sbjct  128  EALSGDEEETSSEPNWGMDCS  148



>ref|NP_850733.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
 sp|Q9FPW6.2|POB1_ARATH RecName: Full=BTB/POZ domain-containing protein POB1; AltName: 
Full=POZ/BTB CONTAINING-PROTEIN 1; Short=AtPOB1 [Arabidopsis 
thaliana]
 gb|AEE80229.1| POZ/BTB containin G-protein 1 [Arabidopsis thaliana]
Length=561

 Score =   103 bits (257),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 85/141 (60%), Gaps = 6/141 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MDPD++   +    DFGFAFNDSNFSDRLLRIE++   SD+ S+ +   ++
Sbjct  9    DLFDPKTQ-MDPDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSEVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNGNQ--DEAVVAMIE  609
            ADW RHRK+R     KE+ +   DI    EEQI+     D +    G    DE   AM+E
Sbjct  68   ADWARHRKRRREDIKKESGVTISDIVACPEEQILTDEQPDMDGCPGGENPDDEGGEAMVE  127

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGDE   S + NW +D S
Sbjct  128  EALSGDEEETSSEPNWGMDCS  148



>ref|XP_004133826.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Cucumis 
sativus]
 ref|XP_004155851.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Cucumis 
sativus]
 gb|KGN56452.1| hypothetical protein Csa_3G119820 [Cucumis sativus]
Length=553

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH--PDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   D+FDP TA MD DYS  S       DFGFAFNDSNFSDRLLRIE++ +  ++  
Sbjct  1    MKDLNSDIFDP-TAGMDSDYSRASCASSSDADFGFAFNDSNFSDRLLRIEIMGEPPESRP  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVV  597
            DS    ++ DW R +++R     K+N +D++   EEQ++N +  D +DA    N D+   
Sbjct  60   DSVGCTSILDWARRKRRREDCK-KDNVVDLNGCPEEQVLNGSQPDMDDAIPCDNLDDEPA  118

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
             MIEE  SGDEAAN ++S+W +D S
Sbjct  119  QMIEELHSGDEAANGDESSWGMDCS  143



>gb|ADN34171.1| ATPOB protein binding [Cucumis melo subsp. melo]
Length=552

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH--PDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   D+FDP TA MD DYS  S       DFGFAFNDSNFSDRLLRIE++ +  ++  
Sbjct  1    MKDLNSDIFDP-TAGMDSDYSRASCASSSDADFGFAFNDSNFSDRLLRIEIMGEPPESRP  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVV  597
            DS    ++ DW R +++R     K+N +D++   EEQ++N +  D +DA    N D+   
Sbjct  60   DSVGCTSILDWARRKRRREDCK-KDNVVDLNGCPEEQVLNGSQPDMDDAIPCDNLDDEPA  118

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
             MIEE  SGDEAAN ++S+W +D S
Sbjct  119  QMIEELHSGDEAANGDESSWGMDCS  143



>ref|XP_008437944.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
melo]
Length=553

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 5/145 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH--PDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   D+FDP TA MD DYS  S       DFGFAFNDSNFSDRLLRIE++ +  ++  
Sbjct  1    MKDLNSDIFDP-TAGMDSDYSRASCASSSDADFGFAFNDSNFSDRLLRIEIMGEPPESRP  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVV  597
            DS    ++ DW R +++R     K+N +D++   EEQ++N +  D +DA    N D+   
Sbjct  60   DSVGCTSILDWARRKRRREDCK-KDNVVDLNGCPEEQVLNGSQPDMDDAIPCDNLDDEPA  118

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
             MIEE  SGDEAAN ++S+W +D S
Sbjct  119  QMIEELHSGDEAANGDESSWGMDCS  143



>gb|AFK39130.1| unknown [Lotus japonicus]
Length=556

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 96/149 (64%), Gaps = 8/149 (5%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYS---PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdac  417
            MKD   DLF+P T VMD DYS    +S+    DFGFAFNDSNFSDR+LRIE++ DS +  
Sbjct  1    MKDFNSDLFEPGT-VMDSDYSRGGASSSSSDADFGFAFNDSNFSDRILRIEIMDDSVETR  59

Query  418  sdsdasQTLADWTRHRKQRGGGDFKE-NALDISTYQEEQIVNCNPIDTED-ADNGNQDEA  591
            SDSD   T+ADW R RK+R     KE N +D++   +EQI+N N    +D     NQDE 
Sbjct  60   SDSDGCTTIADWARQRKRRREDIKKENNVVDLTLLPDEQILNENQTGIDDFVPCENQDEE  119

Query  592  VVAMIEEAQSGDE--AANSEDSNWNIDSS  672
             VAM+EE  SGDE   ANS DSN N+D S
Sbjct  120  AVAMVEEPPSGDETAVANSNDSNLNMDCS  148



>ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
 gb|EOA26832.1| hypothetical protein CARUB_v10022924mg [Capsella rubella]
Length=560

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 7/141 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD  +S   + P  DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  8    DLFDPKTE-MDSTFSRHGSSPEGDFGFAFNDSNFSDRLLRIEILGGPSDSRSDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIV-NCNPIDTEDADNG-NQDEAVVAMIE  609
            ADW RHRK+R   + K+N +   DI    EEQI+ + N  D +D   G N D+   AM+E
Sbjct  67   ADWARHRKRRREDNKKDNGVAISDIVACAEEQILTDNNQPDMDDCPGGDNLDDEGEAMVE  126

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGD+  +SE  NW IDSS
Sbjct  127  EALSGDDDVSSE-PNWGIDSS  146



>ref|XP_003548592.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=553

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 92/137 (67%), Gaps = 4/137 (3%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPH-PDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            DLFDP  A M+ ++S         DF FAFNDSNFSDR+LRIE++ D  DA  DSDA  T
Sbjct  9    DLFDPVMA-MESEWSRGGGGTSDADFAFAFNDSNFSDRVLRIEIMNDPVDARPDSDACAT  67

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS  621
            +ADW RHRK+R     K+N +D+++  +EQ++N +  + ++ +  NQDE   AM+EE  S
Sbjct  68   IADWARHRKRRREDIKKDNGVDLASVPDEQVLNGHQSEVDECE--NQDEEPDAMVEEPHS  125

Query  622  GDEAANSEDSNWNIDSS  672
            GDEA NS DS+W++D S
Sbjct  126  GDEATNSNDSDWSMDCS  142



>gb|KHN15978.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=553

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 92/137 (67%), Gaps = 4/137 (3%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPH-PDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            DLFDP  A M+ ++S         DF FAFNDSNFSDR+LRIE++ D  DA  DSDA  T
Sbjct  9    DLFDPVMA-MESEWSRGGGGTSDADFAFAFNDSNFSDRVLRIEIMNDPVDARPDSDACAT  67

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS  621
            +ADW RHRK+R     K+N +D+++  +EQ++N +  + ++ +  NQDE   AM+EE  S
Sbjct  68   IADWARHRKRRREDIKKDNGVDLASVPDEQVLNGHQSEVDECE--NQDEEPDAMVEEPHS  125

Query  622  GDEAANSEDSNWNIDSS  672
            GDEA NS DS+W++D S
Sbjct  126  GDEATNSNDSDWSMDCS  142



>ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
 gb|ESR58146.1| hypothetical protein CICLE_v10019570mg [Citrus clementina]
Length=550

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 94/143 (66%), Gaps = 3/143 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            M+D   DLFDPRT  MD D S +++    DFGFAFNDSNFSDRLLRIE++ D  ++ SD 
Sbjct  1    MRDVNTDLFDPRTE-MDSDISRSASSSDGDFGFAFNDSNFSDRLLRIEIMGDPPESRSDG  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI  606
            +   ++ADW R RK+R     K+N LD+S   EEQI+N  P   +     NQDE V AMI
Sbjct  60   EGCTSIADWARDRKRRREDIKKDNGLDLSACPEEQILN-QPDMDDCVGCENQDEEVEAMI  118

Query  607  EEAQSG-DEAANSEDSNWNIDSS  672
            E + SG DEAAN  +S+W++D S
Sbjct  119  EGSPSGSDEAANGNESSWSMDCS  141



>ref|XP_010544783.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Tarenaya hassleriana]
Length=558

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D+S   A    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  8    DLFDPKTE-MDSDFSRHGAASDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL--DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ADW RHRK+R     KE+ +  DI    EEQI+    +D +    G N DE   AM+EE 
Sbjct  67   ADWARHRKRRRADIKKESGVISDIVACPEEQILTDTQLDMDGGPGGENLDEEDEAMVEET  126

Query  616  QSGDEAANSEDSNWNIDSS  672
             SGDE   SE +NW +D S
Sbjct  127  LSGDEDTASE-TNWGMDCS  144



>ref|XP_010506625.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X2 [Camelina sativa]
Length=559

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 89/139 (64%), Gaps = 6/139 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD  SD +   ++
Sbjct  9    DLFDPKTE-MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDCRSDVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIV-NCNPIDTEDADNG--NQDEAVVAMIEEA  615
            ADW RHRK+R   + K+N  DI    EEQI+ + N  D +D   G  N D+   AM+EEA
Sbjct  68   ADWARHRKRRREDNKKDNG-DIVACAEEQILTDNNQPDMDDCPGGGDNLDDEGEAMVEEA  126

Query  616  QSGDEAANSEDSNWNIDSS  672
             SGDE A+SE  NW ID S
Sbjct  127  LSGDEDASSE-PNWGIDCS  144



>ref|NP_566069.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana]
 sp|O82343.2|Y2626_ARATH RecName: Full=BTB/POZ domain-containing protein At2g46260 [Arabidopsis 
thaliana]
 gb|AAK76685.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85129.1| unknown protein [Arabidopsis thaliana]
 gb|AAC62880.2| expressed protein [Arabidopsis thaliana]
 gb|AEC10666.1| protein LIGHT-RESPONSE BTB 1 [Arabidopsis thaliana]
Length=561

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 93/141 (66%), Gaps = 7/141 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD++   ++
Sbjct  8    DLFDPKTE-MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDSRSDAEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIV-NCNPIDTEDADNG-NQDEAVVAMIE  609
            ADW RHRK+R   + K+N +   DI    EEQI+ + N  D +DA  G N D+   AM+E
Sbjct  67   ADWARHRKRRREDNKKDNGVAISDIVACAEEQILTDNNQPDMDDAPGGDNLDDEGEAMVE  126

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGD+ A+SE  NW ID S
Sbjct  127  EALSGDDDASSE-PNWGIDCS  146



>ref|XP_010506624.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X1 [Camelina sativa]
Length=563

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 89/142 (63%), Gaps = 8/142 (6%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD  SD +   ++
Sbjct  9    DLFDPKTE-MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDCRSDVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVN-CNPIDTEDADNG--NQDEAVVAMI  606
            ADW RHRK+R   + K+N +   DI    EEQI+   N  D +D   G  N D+   AM+
Sbjct  68   ADWARHRKRRREDNKKDNGVAVSDIVACAEEQILTDNNQPDMDDCPGGGDNLDDEGEAMV  127

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EEA SGDE A+SE  NW ID S
Sbjct  128  EEALSGDEDASSE-PNWGIDCS  148



>ref|XP_011037494.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=553

 Score =   101 bits (251),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 5/145 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            M+    DLFDPRT  MD D +   +    DFGFAFNDSNFSDRLLRIE++  S++  +D 
Sbjct  2    MRGSNTDLFDPRTE-MDSDSTRGGSASDGDFGFAFNDSNFSDRLLRIEIMGGSAENRADG  60

Query  427  dasQTLADWTRHRKQRGGGDFKE--NALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVV  597
            +   ++ DW RHRK+R   D K+  N  D+S   EEQI+  N  D +D   G NQDE   
Sbjct  61   EGCTSIIDWARHRKRR-REDIKKDNNNGDLSVGAEEQILGINQPDMDDCVVGENQDEEGE  119

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AM+E + S DEA +  +S+W++D S
Sbjct  120  AMVEVSPSDDEAGDGNESSWSMDCS  144



>ref|XP_002876624.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52883.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 84/142 (59%), Gaps = 7/142 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MDPD++   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  9    DLFDPKTQ-MDPDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENA----LDISTYQEEQIVNCNPIDTEDADNGNQ--DEAVVAMI  606
            ADW RHRK+R     KE+      DI    EEQI+     D +    G    DE   AM+
Sbjct  68   ADWARHRKRRREDIKKESGGVTISDIVACPEEQILTDEQPDMDGCPGGENLDDEGGEAMV  127

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EEA SGDE   S + NW +D S
Sbjct  128  EEALSGDEEETSSEPNWGMDCS  149



>ref|XP_011023241.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=553

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 86/139 (62%), Gaps = 5/139 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPRT  MD D++   +    DFGFAFNDSNFSDRLLRIE++  S++   D +   ++
Sbjct  8    DLFDPRTE-MDYDFTRGRSASDGDFGFAFNDSNFSDRLLRIEIMGGSAENRVDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKE--NALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
             DW RHRK+R   D K+  N  D+S   EEQI      D  D     NQDE   AM+E +
Sbjct  67   IDWARHRKRR-REDIKKDINNGDLSVGAEEQIFGSIQPDMYDCVGCDNQDEEAEAMVERS  125

Query  616  QSGDEAANSEDSNWNIDSS  672
             SGDE+A+  +S+W++D S
Sbjct  126  PSGDESADGTESSWSMDCS  144



>ref|XP_010508047.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Camelina 
sativa]
Length=563

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 90/142 (63%), Gaps = 8/142 (6%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  9    DLFDPKTE-MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDSRSDVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVN-CNPIDTEDADNG--NQDEAVVAMI  606
            ADW RHRK+R   + K+N +   DI    EEQI+   N  D +D   G  N D+   AM+
Sbjct  68   ADWARHRKRRREDNKKDNGVAVSDIVACAEEQILTDNNQPDMDDCPGGGDNLDDEGEAMV  127

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EEA SGD+ A+SE  NW ID S
Sbjct  128  EEALSGDDDASSE-PNWGIDCS  148



>ref|XP_010092900.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB52718.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=552

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDF-GFAFNDSNFSDRLLRIEVVadssdacsd  423
            M+D   DLFD RT VMDPD+S +++       GFAFNDSNFSDR LRIE++ D+SDA  D
Sbjct  1    MRDLNSDLFDLRT-VMDPDFSRSASSSSDADFGFAFNDSNFSDRQLRIEIMGDASDARPD  59

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVA  600
            SD   T+ADW RHRK+R     KEN +D++   EEQI++CN  D +D +   NQ+E V A
Sbjct  60   SDTCATIADWARHRKRRREDFKKENVVDLTGCPEEQILSCNQPDMDDLEGCENQEEEVEA  119

Query  601  MIEEAQSGDEAANSEDSNWNIDSS  672
            M+EE+ SGDEAANS +S+W++D S
Sbjct  120  MVEESPSGDEAANSNESDWSMDCS  143



>ref|XP_010261455.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Nelumbo nucifera]
Length=537

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 3/114 (3%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DF FAFNDSNFSDR+LRIEV+A  S+  SD D   ++ADW R+RK+R     KEN  D++
Sbjct  17   DFAFAFNDSNFSDRVLRIEVMAGLSENKSDGDGCNSIADWARNRKRRREDIKKEN--DVT  74

Query  514  TYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
               EEQI+NC   D+ED     NQDE  VAMIEE+ SGDEAA   +S+W++D  
Sbjct  75   WCCEEQILNCGQPDSEDGVAYENQDEEPVAMIEESPSGDEAAQGNESSWSMDCC  128



>ref|XP_002509901.1| atpob1, putative [Ricinus communis]
 gb|EEF51288.1| atpob1, putative [Ricinus communis]
Length=734

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 97/154 (63%), Gaps = 13/154 (8%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPH---PDFGFAFNDSNFSDRLLRIEVVadssdac  417
            M+   +DLFDP+T +MD DYS  +A P    PDF FAFNDSNFSDR+L+IE++ D  +  
Sbjct  1    MRLPSVDLFDPQT-IMDSDYSSGTADPSASDPDFAFAFNDSNFSDRVLKIEIIPDLPENK  59

Query  418  sdsdasQTLADWTRHRKQRGGGDFKEN-ALDISTYQEEQIVNCNPIDTEDA-DNGNQDEA  591
            SD D   ++ADW R+RK+R     KE+ A ++    EEQI++CN  DT+DA    NQDE 
Sbjct  60   SDGDPCTSIADWARNRKRRREDIKKESAAAEVIGQSEEQIISCNMPDTDDAVVYENQDEE  119

Query  592  VVAMIEEAQSGDEAA-------NSEDSNWNIDSS  672
             +AMIEE  + ++         N  +S+WN+D S
Sbjct  120  PMAMIEEPPTDNQNQLDDDIPNNINESSWNMDCS  153



>ref|XP_002880228.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56487.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 91/141 (65%), Gaps = 7/141 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  8    DLFDPKTD-MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDSRSDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIV-NCNPIDTEDADNG-NQDEAVVAMIE  609
            ADW RHRK+R   + ++N +   DI    EEQI+ + N  D +D   G N D+   AM+E
Sbjct  67   ADWARHRKRRREDNKRDNGVAISDIVACAEEQILTDNNQPDMDDGPGGDNLDDEGEAMVE  126

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGD+ A+SE  NW ID S
Sbjct  127  EALSGDDDASSE-PNWGIDCS  146



>ref|XP_010518296.1| PREDICTED: BTB/POZ domain-containing protein At2g46260 [Camelina 
sativa]
Length=562

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 7/141 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP++  MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD  SD+D   ++
Sbjct  9    DLFDPKSE-MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDCRSDADGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIV-NCNPIDTEDADNG-NQDEAVVAMIE  609
            ADW RHRK+R   + K+N +   DI    EEQI+ + N  D +D   G N D+   AM+E
Sbjct  68   ADWARHRKRRREDNKKDNGVAVSDIVACAEEQILTDNNQPDMDDCPGGDNLDDEGEAMVE  127

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGD+ A+SE  NW ID S
Sbjct  128  EALSGDDDASSE-PNWGIDCS  147



>ref|XP_010669540.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Beta 
vulgaris subsp. vulgaris]
Length=556

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 95/152 (63%), Gaps = 15/152 (10%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MK+   DLFDPRT VMD +Y    +P   +FGFAFNDSNFSDR+LRIE++A  SD+ SD 
Sbjct  1    MKNMNRDLFDPRT-VMDSEYD--RSPKEGNFGFAFNDSNFSDRVLRIEIMAGPSDSKSDV  57

Query  427  dasQTLADWTRHRKQRGGGDFKE----------NALDISTYQEEQIVNCNPIDTEDADNG  576
            D   +L DW R+RK+R   D K+          N  +++   EEQ++N +  D   A   
Sbjct  58   DGCCSLLDWARNRKRRRE-DLKKDAQIENEDDNNGAEVAVCPEEQVLNQSDGDDVLACE-  115

Query  577  NQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
            N DE  VAMIEE+ SGDE  NS DS+W+++ S
Sbjct  116  NDDEEAVAMIEESPSGDEGDNSNDSSWSMECS  147



>ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
 gb|ESQ43919.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
Length=613

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D++   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  61   DLFDPKTQ-MDSDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDGEGCTSI  119

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEE  612
            ADW RHRK+R   + K+  +   DI    EEQI+     D E    G N D+   AM+EE
Sbjct  120  ADWARHRKRRREDNNKKEFVTVSDIVACAEEQILTDEQPDMEGCPGGDNLDDEGEAMVEE  179

Query  613  AQSGDEAANSEDSNWNIDSS  672
            A SGDE   + + NW +D S
Sbjct  180  ALSGDEEDTTSEPNWGMDCS  199



>gb|KJB52236.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=514

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 90/150 (60%), Gaps = 17/150 (11%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSP----TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLF+P++ VMD D+SP     SA   PDFGFAF+DSNFSDR LRIE++ D  +  SD   
Sbjct  7    DLFNPQS-VMDSDFSPGGASASASVDPDFGFAFDDSNFSDRTLRIEIMPDLPETKSDGGG  65

Query  433  sQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCN-PIDTEDADNGNQDEAVVAMIE  609
              ++ADW R+RK+R     KEN  D     EEQI+NCN P   +     NQDE  +AM+E
Sbjct  66   CCSIADWARNRKRRREDFKKEN--DFIGQSEEQILNCNLPYTVDGVTYENQDEEAMAMVE  123

Query  610  EA---------QSGDEAANSEDSNWNIDSS  672
            E+         Q G+++  + DS+ N+D S
Sbjct  124  ESPSDIGLNSNQIGNDSIYNNDSSKNMDCS  153



>gb|EPS71516.1| hypothetical protein M569_03239, partial [Genlisea aurea]
Length=559

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 87/144 (60%), Gaps = 11/144 (8%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYS--PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdas  435
            LDLFDPRT+ MD D +  PT+AP  PDF FAFND NFSDR+LRIE++   SD        
Sbjct  4    LDLFDPRTSSMDSDSTSSPTAAPV-PDFAFAFNDVNFSDRILRIEIL---SDPMDAPSLQ  59

Query  436  QTLADWTRHRKQRGGGDF---KENALDISTYQEEQIVNCNPIDTEDA--DNGNQDEAVVA  600
            +TLA W   + +R   D    +E ALDI+   EEQ   C P D  D   D  N +E  + 
Sbjct  60   ETLAHWATRKSKRQRRDTVREREKALDINVGPEEQTSECQPSDVGDGLDDEENFEEERIP  119

Query  601  MIEEAQSGDEAANSEDSNWNIDSS  672
            MIE++QSGDE ANS DS+W  D S
Sbjct  120  MIEDSQSGDEDANSNDSDWLEDGS  143



>gb|KJB52233.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
 gb|KJB52234.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=562

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 90/150 (60%), Gaps = 17/150 (11%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSP----TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLF+P++ VMD D+SP     SA   PDFGFAF+DSNFSDR LRIE++ D  +  SD   
Sbjct  7    DLFNPQS-VMDSDFSPGGASASASVDPDFGFAFDDSNFSDRTLRIEIMPDLPETKSDGGG  65

Query  433  sQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCN-PIDTEDADNGNQDEAVVAMIE  609
              ++ADW R+RK+R     KEN  D     EEQI+NCN P   +     NQDE  +AM+E
Sbjct  66   CCSIADWARNRKRRREDFKKEN--DFIGQSEEQILNCNLPYTVDGVTYENQDEEAMAMVE  123

Query  610  EA---------QSGDEAANSEDSNWNIDSS  672
            E+         Q G+++  + DS+ N+D S
Sbjct  124  ESPSDIGLNSNQIGNDSIYNNDSSKNMDCS  153



>ref|XP_009104325.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Brassica rapa]
Length=561

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 85/139 (61%), Gaps = 4/139 (3%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D+S   +    DFGFAFNDSNFSDRLLRIE++ + SD+ SD +   ++
Sbjct  8    DLFDPKTQ-MDSDFSRHGSSSEGDFGFAFNDSNFSDRLLRIEIMGNPSDSRSDVEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL--DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ADW RHRK+R     KE+    DI    EEQI+     D +    G N D+   AMIEE+
Sbjct  67   ADWARHRKRRREDIKKESVTISDIVACPEEQILTDEQPDMDGCPGGDNLDDEGEAMIEES  126

Query  616  QSGDEAANSEDSNWNIDSS  672
             SGDE   + + +W +D S
Sbjct  127  LSGDEEDTTSEPSWGMDCS  145



>ref|XP_009626291.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
tomentosiformis]
Length=561

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 96/154 (62%), Gaps = 14/154 (9%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            MK+   D+FDP+T +MD D+SP   +    DFGFAFNDSNFSDR+L +E+V DS D+ SD
Sbjct  1    MKNLNNDIFDPQTIIMDSDFSPGYGSGTESDFGFAFNDSNFSDRILIVEIVLDSRDSKSD  60

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVA  600
             +   ++ DW R RK+R     KEN  D+ T  EE+++NCN +DT D     NQDE  VA
Sbjct  61   GEDCSSIVDWARKRKRRREEIRKEN--DVFTQSEEEVLNCNMLDTVDGLSYENQDEEAVA  118

Query  601  MIEEAQSG----------DEAANSEDSNWNIDSS  672
            M+EE+ SG           EA  S DS+ N+DSS
Sbjct  119  MVEESPSGTEMTTDHPGDGEAPKSSDSSTNMDSS  152



>ref|XP_006476450.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Citrus 
sinensis]
Length=555

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 94/147 (64%), Gaps = 15/147 (10%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            +DLFDP++  MD D+S  S  P  DFGFAFNDSNFSDR+LRIE++ D  D+ SD DA  +
Sbjct  5    VDLFDPQSN-MDSDFS--SGLPDSDFGFAFNDSNFSDRVLRIEIMPDLPDSKSDGDACSS  61

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA-  615
            +ADW R+RK+R   + K++ +D+   Q EQI+ CN  DTED     NQD+   AM+EE+ 
Sbjct  62   IADWARNRKRR-REEIKKDTVDVLV-QREQILQCNMPDTEDGVAYENQDDEPDAMVEESP  119

Query  616  --------QSGDEAANSEDSNWNIDSS  672
                    Q G+EA  S D  W++D S
Sbjct  120  ADVGLNLNQCGEEATGSIDPAWSMDLS  146



>ref|XP_008458155.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
melo]
Length=550

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDY--SPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   DLFDPR A +D DY  S +++    DFGFAF+DSNFSDRLLRIE+V  S +   
Sbjct  1    MKDPNTDLFDPR-ATIDSDYVLSASTSSRDSDFGFAFDDSNFSDRLLRIEIVGGSDETEP  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVV  597
            +     ++ DW R ++++      ENALDIS   ++Q++ C+  D  D  +  N DE  V
Sbjct  60   EFGGCSSVLDWARRKRRKEEKK-TENALDISKCPQQQVLTCDQPDMVDVLSFENPDEEPV  118

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AMIEE+ SGDE AN+ D   N+DSS
Sbjct  119  AMIEESLSGDEGANTND--LNLDSS  141



>gb|KFK35343.1| hypothetical protein AALP_AA5G272300 [Arabis alpina]
Length=560

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 84/141 (60%), Gaps = 10/141 (7%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVadss---dacsdsda  432
            DLFDP+T  MD D+S   S+P   DFGFAFNDSNFSDRLLRIE++               
Sbjct  11   DLFDPKTQ-MDSDFSRHGSSPDAGDFGFAFNDSNFSDRLLRIEIMGGGLNSDSRSDVEGC  69

Query  433  sQTLADWTRHRKQRGGGDFKENALDI-STYQEEQIVNCNPIDTEDADNGNQDEAVVAMIE  609
              ++ADW RHRK+R   DFK+++ DI +  +EEQI+     +  D D    DE   AM+E
Sbjct  70   CTSIADWARHRKRR-REDFKKDSNDIVACPEEEQILT---DEQPDMDGCPVDEGGEAMVE  125

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGDE   + + NW +D S
Sbjct  126  EALSGDEDDTTSEPNWGMDCS  146



>ref|XP_006439421.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|ESR52661.1| hypothetical protein CICLE_v10019554mg [Citrus clementina]
 gb|KDO76408.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=555

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 94/147 (64%), Gaps = 15/147 (10%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            +DLFDP++  MD D+S  S  P  DFGFAFNDSNFSDR+LRIE++ D  D+ SD DA  +
Sbjct  5    VDLFDPQSN-MDSDFS--SGLPDSDFGFAFNDSNFSDRVLRIEIMPDLPDSKSDGDACSS  61

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA-  615
            +ADW R+RK+R   + K++ +D+   Q EQI+ CN  DTED     NQD+   AM+EE+ 
Sbjct  62   IADWARNRKRR-REEIKKDTVDVLV-QREQILQCNMPDTEDGVAYENQDDEPEAMVEESP  119

Query  616  --------QSGDEAANSEDSNWNIDSS  672
                    Q G+EA  + D  W++D S
Sbjct  120  ADVGLNLKQCGEEATGNIDPAWSMDLS  146



>ref|XP_009789895.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Nicotiana sylvestris]
Length=563

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 95/154 (62%), Gaps = 12/154 (8%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            MK+   D+FDP T +MD D+S    +    DFGFAFNDSNFSDR+L +E+V DS D+ SD
Sbjct  1    MKNLNNDIFDPLTIIMDSDFSSGYGSGTESDFGFAFNDSNFSDRILIVEIVPDSPDSKSD  60

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVA  600
             +   ++ DW R RK+R     KEN  D+ T +EE+++NCN +DTED     NQDE  VA
Sbjct  61   GEGCSSIVDWARKRKRRREEIKKENDADVLTQREEEMLNCNMLDTEDGLAYENQDEEAVA  120

Query  601  MIEEAQSG----------DEAANSEDSNWNIDSS  672
            M+EE  SG           EA  S DS+ N+DSS
Sbjct  121  MVEEYPSGLEMITDHPGDGEAPKSTDSSTNMDSS  154



>ref|XP_004138466.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
2 [Cucumis sativus]
 ref|XP_004159779.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cucumis 
sativus]
 gb|KGN45706.1| hypothetical protein Csa_6G007400 [Cucumis sativus]
Length=550

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDY--SPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   DLFDPR A +D DY  S +++    DFGFAF+DSNFSDRLLRIE+V  S +   
Sbjct  1    MKDPNTDLFDPR-ATIDSDYLLSASTSSRDSDFGFAFDDSNFSDRLLRIEIVGGSDETDP  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVV  597
            +     ++ DW R ++++      ENALD+S   ++Q++ C+  D  D  +  N DE  V
Sbjct  60   EFGGCSSVLDWARRKRRKEEKK-TENALDLSKCPQQQVLTCDQPDMVDVLSFENPDEGPV  118

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AMIEE+ SGDE AN+ D   N+DSS
Sbjct  119  AMIEESLSGDEGANTND--LNLDSS  141



>ref|XP_002320175.2| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE98490.2| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=548

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (63%), Gaps = 6/137 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPRT  M+ D +   +    DFGFAFNDSNFSDRLLRIE++  S+++ +D +   ++
Sbjct  8    DLFDPRTE-MESDSTRGGSASDGDFGFAFNDSNFSDRLLRIEIMGGSAESRADGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEAQS  621
             DW RHRK+R     K+N    +   EEQI+  N  D +D   G NQDE   AM+E + S
Sbjct  67   IDWARHRKRRREDIKKDN----NNGAEEQILGSNQPDMDDCVVGDNQDEEGEAMVEVSPS  122

Query  622  GDEAANSEDSNWNIDSS  672
             DEA +  +S+W++D S
Sbjct  123  DDEAGDGNESSWSMDCS  139



>gb|KJB52235.1| hypothetical protein B456_008G251700 [Gossypium raimondii]
Length=574

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 91/160 (57%), Gaps = 25/160 (16%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSP----TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLF+P++ VMD D+SP     SA   PDFGFAF+DSNFSDR LRIE++ D  +  SD   
Sbjct  7    DLFNPQS-VMDSDFSPGGASASASVDPDFGFAFDDSNFSDRTLRIEIMPDLPETKSDGGG  65

Query  433  sQTLADWTRHRKQRGGGDFKENAL----------DISTYQEEQIVNCN-PIDTEDADNGN  579
              ++ADW R+RK+R     KEN L          D     EEQI+NCN P   +     N
Sbjct  66   CCSIADWARNRKRRREDFKKENGLFCFVSKIKIIDFIGQSEEQILNCNLPYTVDGVTYEN  125

Query  580  QDEAVVAMIEEA---------QSGDEAANSEDSNWNIDSS  672
            QDE  +AM+EE+         Q G+++  + DS+ N+D S
Sbjct  126  QDEEAMAMVEESPSDIGLNSNQIGNDSIYNNDSSKNMDCS  165



>emb|CAB71090.1| putative protein [Arabidopsis thaliana]
Length=545

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQ  471
            MDPD++   +    DFGFAFNDSNFSDRLLRIE++   SD+ S+ +   ++ADW RHRK+
Sbjct  1    MDPDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSEVEGCTSIADWARHRKR  60

Query  472  RGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNGNQ--DEAVVAMIEEAQSGDEAA  636
            R     KE+ +   DI    EEQI+     D +    G    DE   AM+EEA SGDE  
Sbjct  61   RREDIKKESGVTISDIVACPEEQILTDEQPDMDGCPGGENPDDEGGEAMVEEALSGDEEE  120

Query  637  NSEDSNWNIDSS  672
             S + NW +D S
Sbjct  121  TSSEPNWGMDCS  132



>gb|KDO76407.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=583

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 94/147 (64%), Gaps = 15/147 (10%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            +DLFDP++  MD D+S  S  P  DFGFAFNDSNFSDR+LRIE++ D  D+ SD DA  +
Sbjct  5    VDLFDPQSN-MDSDFS--SGLPDSDFGFAFNDSNFSDRVLRIEIMPDLPDSKSDGDACSS  61

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA-  615
            +ADW R+RK+R   + K++ +D+   Q EQI+ CN  DTED     NQD+   AM+EE+ 
Sbjct  62   IADWARNRKRR-REEIKKDTVDVLV-QREQILQCNMPDTEDGVAYENQDDEPEAMVEESP  119

Query  616  --------QSGDEAANSEDSNWNIDSS  672
                    Q G+EA  + D  W++D S
Sbjct  120  ADVGLNLKQCGEEATGNIDPAWSMDLS  146



>ref|XP_009789894.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Nicotiana sylvestris]
Length=576

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 95/154 (62%), Gaps = 12/154 (8%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            MK+   D+FDP T +MD D+S    +    DFGFAFNDSNFSDR+L +E+V DS D+ SD
Sbjct  1    MKNLNNDIFDPLTIIMDSDFSSGYGSGTESDFGFAFNDSNFSDRILIVEIVPDSPDSKSD  60

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVA  600
             +   ++ DW R RK+R     KEN  D+ T +EE+++NCN +DTED     NQDE  VA
Sbjct  61   GEGCSSIVDWARKRKRRREEIKKENDADVLTQREEEMLNCNMLDTEDGLAYENQDEEAVA  120

Query  601  MIEEAQSG----------DEAANSEDSNWNIDSS  672
            M+EE  SG           EA  S DS+ N+DSS
Sbjct  121  MVEEYPSGLEMITDHPGDGEAPKSTDSSTNMDSS  154



>emb|CDY52008.1| BnaC06g42880D [Brassica napus]
Length=562

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D+S   +    DFGFAFNDSNFSDRLLRIE++ + SD+ SD +   ++
Sbjct  8    DLFDPKTQ-MDSDFSRHGSSSEGDFGFAFNDSNFSDRLLRIEIMGNPSDSRSDVEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL--DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ADW RHRK+R     KE+    DI    EEQI+     D +    G N D+   AMIEEA
Sbjct  67   ADWARHRKRRREDIKKESVTISDIVACPEEQILTDEQPDMDGCPGGDNLDDEGEAMIEEA  126

Query  616  QSG-DEAANSEDSNWNIDSS  672
             SG DE   S + +W +D S
Sbjct  127  LSGSDEEDTSSEPSWGMDCS  146



>ref|XP_008798670.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Phoenix 
dactylifera]
Length=537

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 80/128 (63%), Gaps = 6/128 (5%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQ  471
            MDPD+S  S     +F FAFN SNFSDR+LRIE++   ++  +D +    ++DW RHRK+
Sbjct  1    MDPDFSHASG--EQNFEFAFNSSNFSDRILRIEILEGPAECRTDWEGGVGVSDWDRHRKR  58

Query  472  RGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEAQSGDEAANSED  648
            R     K+ A++ S +  E   NCN  DTED     N DE VVAM+EE  SGDE +   D
Sbjct  59   RREEIKKDKAVESSMHSLE---NCNQPDTEDDVTYENHDEEVVAMLEEFPSGDEPSQCSD  115

Query  649  SNWNIDSS  672
            S+W++D+S
Sbjct  116  SSWSMDAS  123



>emb|CDP12109.1| unnamed protein product [Coffea canephora]
Length=832

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 72/162 (44%), Positives = 96/162 (59%), Gaps = 22/162 (14%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHP-----------DFGFAFNDSNFSDRLLRIEV  393
            MK   +DLFDPR+  MD D+SP      P           DF FAFNDSNFSDR+LR+E+
Sbjct  1    MKGLNVDLFDPRST-MDADFSPGGGAERPIEPRHGSGSDSDFAFAFNDSNFSDRVLRVEI  59

Query  394  VadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-D  570
            + D  D+ SD D   T+ADW R+RK+R     KENA +I   +EEQ+++CN  DT+D   
Sbjct  60   LPDLPDSKSDPDGCTTIADWARNRKRRREEIRKENAAEI-MQREEQVLSCNMPDTDDILA  118

Query  571  NGNQDEAVVAMIEEA--------QSGDEAANSEDSNWNIDSS  672
              NQDE  +AM+EE+        Q GD +  + DS+ N+D S
Sbjct  119  YENQDEEAIAMVEESTGIGMSSIQLGDGSTENNDSSTNMDCS  160



>ref|XP_009133768.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like [Brassica 
rapa]
Length=550

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 81/140 (58%), Gaps = 9/140 (6%)
 Frame = +1

Query  265  DLFDPRTAV-MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs--dsdas  435
            DLFDP+T+  MD   SP  + P  DFGFAFNDSNFSDRLLRIE++   S           
Sbjct  5    DLFDPKTSTDMDSILSPRDSSPGADFGFAFNDSNFSDRLLRIEILGGPSSGSRPDGDGCC  64

Query  436  QTLADWTRHRKQRGGGDFKENALDISTYQEEQIV-NCNPIDTEDADNGNQDEAVVAMIEE  612
             ++ADW RHRK+    D K N  DI    EEQI+ + N  D +D   G  DE   AM+EE
Sbjct  65   TSIADWARHRKRT--RDDKNNK-DIVACPEEQIITDNNRPDMDDCPGG--DEEGEAMVEE  119

Query  613  AQSGDEAANSEDSNWNIDSS  672
            A SGD+   S + NW +D S
Sbjct  120  ALSGDDDDESSEPNWGMDHS  139



>ref|XP_010914379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Elaeis guineensis]
Length=537

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (61%), Gaps = 6/128 (5%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQ  471
            MDPD+S  S     +F FAFN SNFSDR+LRIE++A   +  SD D    ++DW RHRK+
Sbjct  1    MDPDFSHASG--EQNFEFAFNSSNFSDRILRIEILAGPPECRSDGDGGGGVSDWDRHRKR  58

Query  472  RGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEAQSGDEAANSED  648
            R     K+  ++ + Y  E   NCN  DTED     N DE  VAM+EE  SGDE +   D
Sbjct  59   RREEIKKDKVVESAMYSLE---NCNQPDTEDDVTYENHDEEAVAMLEEFPSGDEPSQFSD  115

Query  649  SNWNIDSS  672
            S+W++D+S
Sbjct  116  SSWSMDAS  123



>ref|XP_009104326.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Brassica rapa]
Length=559

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D+S   +    DFGFAFNDSNFSDRLLRIE++ + SD+ SD +   ++
Sbjct  8    DLFDPKTQ-MDSDFSRHGSSSEGDFGFAFNDSNFSDRLLRIEIMGNPSDSRSDVEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL--DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ADW RHRK+R     KE+    DI    EEQI+     D +    G N D+   AMIEE+
Sbjct  67   ADWARHRKRRREDIKKESVTISDIVACPEEQILTDEQPDMDGCPGGDNLDDEGEAMIEES  126

Query  616  QSG-DEAANSEDSNWNIDSS  672
             SG DE   + + +W +D S
Sbjct  127  LSGSDEEDTTSEPSWGMDCS  146



>gb|AAM61110.1| unknown [Arabidopsis thaliana]
Length=546

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 84/132 (64%), Gaps = 6/132 (5%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQ  471
            MD ++S   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD++   ++ADW RHRK+
Sbjct  1    MDSNFSRHGSSSEGDFGFAFNDSNFSDRLLRIEILGGPSDSRSDAEGCTSIADWARHRKR  60

Query  472  RGGGDFKENAL---DISTYQEEQIVN-CNPIDTEDADNG-NQDEAVVAMIEEAQSGDEAA  636
            R   + K+N +   DI    EEQI+   N  D +DA  G N D+   AM+EEA  GD+ A
Sbjct  61   RREDNKKDNGVAISDIVACAEEQILTDNNQPDMDDAPGGDNLDDEGEAMVEEALXGDDDA  120

Query  637  NSEDSNWNIDSS  672
            +SE  NW ID S
Sbjct  121  SSE-PNWGIDCS  131



>ref|XP_009104323.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Brassica rapa]
 emb|CDY53909.1| BnaA07g38170D [Brassica napus]
Length=562

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D+S   +    DFGFAFNDSNFSDRLLRIE++ + SD+ SD +   ++
Sbjct  8    DLFDPKTQ-MDSDFSRHGSSSEGDFGFAFNDSNFSDRLLRIEIMGNPSDSRSDVEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL--DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ADW RHRK+R     KE+    DI    EEQI+     D +    G N D+   AMIEE+
Sbjct  67   ADWARHRKRRREDIKKESVTISDIVACPEEQILTDEQPDMDGCPGGDNLDDEGEAMIEES  126

Query  616  QSG-DEAANSEDSNWNIDSS  672
             SG DE   + + +W +D S
Sbjct  127  LSGSDEEDTTSEPSWGMDCS  146



>ref|XP_002303620.1| hypothetical protein POPTR_0003s13510g [Populus trichocarpa]
 gb|EEE78599.1| hypothetical protein POPTR_0003s13510g [Populus trichocarpa]
Length=561

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 86/147 (59%), Gaps = 12/147 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLF PR   MD D+SP       DFGFAFNDSNFSDR+L+IE+VAD  DA S  D   ++
Sbjct  7    DLFGPRIG-MDSDFSPVEYRSDYDFGFAFNDSNFSDRVLKIEIVADLPDAKSVGDGCSSI  65

Query  445  ADWTRHRKQRGGGDFKENALD-ISTYQEEQIVNCNPIDTE-DADNGNQDEAVVAMIEEA-  615
             +W R+RK+R     K+ A++ +   ++EQ++N N  DTE +    NQD   V M E + 
Sbjct  66   TEWARNRKRRREDIMKDKAVEVVGQNKDEQVLNFNIPDTENNVAYENQDVEAVVMTEGSP  125

Query  616  --------QSGDEAANSEDSNWNIDSS  672
                    Q GD A  S DS+W++D S
Sbjct  126  TDAQLDFNQRGDAAGPSSDSSWSMDCS  152



>ref|XP_006397812.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
 gb|ESQ39265.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
Length=530

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S  S+    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  8    DLFDPKTE-MDSNFSRHSSSSEGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIV-NCNPIDTEDADNG-NQDEAVVAMIEEAQ  618
            ADW RHRK+R   + K+N  DI    EEQI+ + N  D +D   G N D+   AM+EE  
Sbjct  67   ADWARHRKRRREDNKKDNC-DIVGCAEEQIITDNNQPDMDDCPGGDNLDDEREAMVEEPL  125

Query  619  SGDEAANSEDSNWNIDSS  672
            SG++ A+SE  NW +D S
Sbjct  126  SGEDDASSE-PNWGMDHS  142



>gb|KFK35342.1| hypothetical protein AALP_AA5G272300 [Arabis alpina]
Length=564

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 84/145 (58%), Gaps = 14/145 (10%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVadss---dacsdsda  432
            DLFDP+T  MD D+S   S+P   DFGFAFNDSNFSDRLLRIE++               
Sbjct  11   DLFDPKTQ-MDSDFSRHGSSPDAGDFGFAFNDSNFSDRLLRIEIMGGGLNSDSRSDVEGC  69

Query  433  sQTLADWTRHRKQRGGGDFKENA-LDIS----TYQEEQIVNCNPIDTEDADNGNQDEAVV  597
              ++ADW RHRK+R   DFK+++ + IS      +EEQI+     +  D D    DE   
Sbjct  70   CTSIADWARHRKRR-REDFKKDSNVSISDIVACPEEEQILT---DEQPDMDGCPVDEGGE  125

Query  598  AMIEEAQSGDEAANSEDSNWNIDSS  672
            AM+EEA SGDE   + + NW +D S
Sbjct  126  AMVEEALSGDEDDTTSEPNWGMDCS  150



>gb|KDO76410.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=554

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 93/146 (64%), Gaps = 14/146 (10%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            +DLFDP++  MD D+S  S  P  DFGFAFNDSNFSDR+LRIE++ D  D+ SD DA  +
Sbjct  5    VDLFDPQSN-MDSDFS--SGLPDSDFGFAFNDSNFSDRVLRIEIMPDLPDSKSDGDACSS  61

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA-  615
            +ADW R+RK+R   + K++ +D+   Q EQI+ CN  DTED     NQD+   AM+EE+ 
Sbjct  62   IADWARNRKRR-REEIKKDTVDVLV-QREQILQCNMPDTEDGVAYENQDDEPEAMVEESP  119

Query  616  -------QSGDEAANSEDSNWNIDSS  672
                   +  +EA  + D  W++D S
Sbjct  120  ADVGLNLKQCEEATGNIDPAWSMDLS  145



>ref|XP_006397813.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
 gb|ESQ39266.1| hypothetical protein EUTSA_v10001385mg [Eutrema salsugineum]
Length=554

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/138 (49%), Positives = 89/138 (64%), Gaps = 5/138 (4%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD ++S  S+    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  8    DLFDPKTE-MDSNFSRHSSSSEGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDGEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVN-CNPIDTEDADNG-NQDEAVVAMIEEAQ  618
            ADW RHRK+R   + K+N  DI    EEQI+   N  D +D   G N D+   AM+EE  
Sbjct  67   ADWARHRKRRREDNKKDNC-DIVGCAEEQIITDNNQPDMDDCPGGDNLDDEREAMVEEPL  125

Query  619  SGDEAANSEDSNWNIDSS  672
            SG++ A+SE  NW +D S
Sbjct  126  SGEDDASSE-PNWGMDHS  142



>ref|XP_008238990.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Prunus 
mume]
Length=555

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 89/148 (60%), Gaps = 13/148 (9%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPT------SAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            +DL   RT + D D SP+      S P   DF FAFND NFSDR+LRIE+V DS +A  D
Sbjct  6    VDLLRRRT-ITDSDQSPSGLGESGSDPEAQDFTFAFNDINFSDRILRIEIVPDSPEAKPD  64

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDT-EDADNGNQDEAVVA  600
                 T +DW R++K+R     +++A DI  + EEQ++NCN  DT +D    NQDE   A
Sbjct  65   GVGCSTASDWERNKKRRRADIKRDSAEDILAHSEEQVLNCNIPDTVDDVAFENQDEEAAA  124

Query  601  MIEEAQSG----DEAANSEDSNWNIDSS  672
            M  E+ SG    DEA +S DS+W++D S
Sbjct  125  M-NESPSGVGRVDEAVHSNDSSWSMDCS  151



>ref|XP_002299499.2| hypothetical protein POPTR_0001s10190g [Populus trichocarpa]
 gb|EEE84304.2| hypothetical protein POPTR_0001s10190g [Populus trichocarpa]
Length=561

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 83/147 (56%), Gaps = 12/147 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPR+  MD   SP  +    DF FAFNDSNFSDR+L+IE+VA   D  S  D    +
Sbjct  7    DLFDPRSD-MDSYVSPVESRLDYDFSFAFNDSNFSDRVLKIEIVAGLPDVKSAGDGCSGI  65

Query  445  ADWTRHRKQRGGGDFKENALDISTYQE-EQIVNCNPIDTED-ADNGNQDEAVVAMIEEA-  615
             +W R+RK+R     K+ A++I    E EQ + CN  DTED     NQD   VAM+E + 
Sbjct  66   TEWARNRKRRREDVKKDKAVEIVGQSEDEQALTCNIPDTEDTVAYENQDVEAVAMVEGSP  125

Query  616  --------QSGDEAANSEDSNWNIDSS  672
                    Q GD A  S DS+W++D S
Sbjct  126  TDAQLDFHQRGDAAGPSSDSSWSMDCS  152



>ref|XP_007209857.1| hypothetical protein PRUPE_ppa003692mg [Prunus persica]
 gb|EMJ11056.1| hypothetical protein PRUPE_ppa003692mg [Prunus persica]
Length=555

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 89/148 (60%), Gaps = 13/148 (9%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPT------SAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            +DL   RT + D D SP+      S P   DF FAFND NFSDR+LRIE+V DS +A  D
Sbjct  6    VDLLRRRT-ITDSDQSPSGLGESGSDPEAQDFTFAFNDINFSDRILRIEIVPDSPEAKPD  64

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDT-EDADNGNQDEAVVA  600
                 T +DW R++K+R     +++A DI  + EEQ++NCN  DT +D    NQDE   A
Sbjct  65   GVGCSTASDWERNKKRRRADIKRDSAEDILAHSEEQVLNCNIPDTVDDVAFENQDEEAAA  124

Query  601  MIEEAQSG----DEAANSEDSNWNIDSS  672
            M  E+ SG    DEA +S DS+W++D S
Sbjct  125  M-NESPSGVGRVDEAVHSNDSSWSMDCS  151



>gb|KDO76409.1| hypothetical protein CISIN_1g007950mg [Citrus sinensis]
Length=582

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 93/146 (64%), Gaps = 14/146 (10%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            +DLFDP++  MD D+S  S  P  DFGFAFNDSNFSDR+LRIE++ D  D+ SD DA  +
Sbjct  5    VDLFDPQSN-MDSDFS--SGLPDSDFGFAFNDSNFSDRVLRIEIMPDLPDSKSDGDACSS  61

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA-  615
            +ADW R+RK+R   + K++ +D+   Q EQI+ CN  DTED     NQD+   AM+EE+ 
Sbjct  62   IADWARNRKRR-REEIKKDTVDVLV-QREQILQCNMPDTEDGVAYENQDDEPEAMVEESP  119

Query  616  -------QSGDEAANSEDSNWNIDSS  672
                   +  +EA  + D  W++D S
Sbjct  120  ADVGLNLKQCEEATGNIDPAWSMDLS  145



>ref|XP_009772687.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
sylvestris]
Length=550

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 84/142 (59%), Gaps = 16/142 (11%)
 Frame = +1

Query  292  MDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVads-sdacsdsdasQTLADWTRHR  465
            MD D+SP   +    DF FAFNDSNFSDR+LRIE+V D           +  + DW R+R
Sbjct  1    MDSDFSPGCGSGIQSDFAFAFNDSNFSDRILRIEIVPDLPDCKTGCEGCTGGIDDWARNR  60

Query  466  KQRGGGDFKENALDISTYQEEQIVNCNPIDTED--ADNGNQDEAVVAMIEEAQSG-----  624
            K+R     KEN  D+   +EEQ+VNCN ++ ED  AD+  QDE  V M+EE+ SG     
Sbjct  61   KRRREDIKKENDADVVMQREEQVVNCNVLEMEDGLADD-EQDEEAVGMLEESPSGIEMTT  119

Query  625  -----DEAANS-EDSNWNIDSS  672
                 DEA+ S +DS+ N+DSS
Sbjct  120  NPPGDDEASKSDDDSSTNMDSS  141



>ref|XP_009617879.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Nicotiana 
tomentosiformis]
Length=550

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 84/142 (59%), Gaps = 16/142 (11%)
 Frame = +1

Query  292  MDPDYSP-TSAPPHPDFGFAFNDSNFSDRLLRIEVVads-sdacsdsdasQTLADWTRHR  465
            MD D+SP   +    DF FAFNDSNFSDR+LRIE+V D           S  + DW R+R
Sbjct  1    MDSDFSPGCESGIQSDFAFAFNDSNFSDRILRIEIVPDLPDCKTGCEGCSGGIDDWARNR  60

Query  466  KQRGGGDFKENALDISTYQEEQIVNCNPIDTED--ADNGNQDEAVVAMIEEAQSG-----  624
            K+R     KEN  D+   +EEQ+VNCN ++ ED  AD+  QDE  V M+EE+ SG     
Sbjct  61   KRRREEIKKENDADVVMQREEQVVNCNLLEMEDGLADD-EQDEEAVGMLEESPSGIEMTT  119

Query  625  -----DEAANS-EDSNWNIDSS  672
                 DEA+ S +DS+ N+DSS
Sbjct  120  NPPGDDEASKSDDDSSTNMDSS  141



>ref|XP_011022567.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Populus 
euphratica]
Length=561

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 83/146 (57%), Gaps = 12/146 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLF PR   MD D SP       DFGFAFNDSNFSDR+L+IE+VAD  D  S  D   ++
Sbjct  7    DLFGPRIG-MDSDLSPVEYRSDYDFGFAFNDSNFSDRVLKIEIVADFPDEKSVGDGCSSI  65

Query  445  ADWTRHRKQRGGGDFKENALD-ISTYQEEQIVNCNPIDTE-DADNGNQDEAVVAMIEEA-  615
             +W R+RK+R     K+ A++ +   ++EQ++N N  DTE +    NQD   V M E + 
Sbjct  66   TEWARNRKRRREDIMKDKAVEVVGQNKDEQVLNFNIPDTENNVAYENQDVEAVVMTEGSP  125

Query  616  --------QSGDEAANSEDSNWNIDS  669
                    Q GD A  S DS+W++D 
Sbjct  126  TDAQLDFNQRGDAAGPSSDSSWSMDC  151



>ref|XP_007147261.1| hypothetical protein PHAVU_006G109600g [Phaseolus vulgaris]
 gb|ESW19255.1| hypothetical protein PHAVU_006G109600g [Phaseolus vulgaris]
Length=553

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 88/146 (60%), Gaps = 5/146 (3%)
 Frame = +1

Query  247  MKDQILDLFDPRTAV---MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdac  417
            M+D  LDLFDP   +      DYS +++    DFGFAFNDSNFSDR+LRIE++ D  +A 
Sbjct  1    MRDFSLDLFDPGMTMESSSSSDYSRSASSSDSDFGFAFNDSNFSDRILRIEIMIDVVEAP  60

Query  418  sdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAV  594
             + +    + DW RH K+R     K+N +D+S   +EQI+N N  D +D+    N DE  
Sbjct  61   PNFEGCNAILDWARHHKRRREDVKKDNVVDLSL-PDEQILNENQPDMDDSTPPENLDEEA  119

Query  595  VAMIEEAQSGDEAANSEDSNWNIDSS  672
            + M EE  SGDE  N  DS+WN+D S
Sbjct  120  IPMGEEFPSGDEPTNMNDSDWNMDCS  145



>emb|CDX83375.1| BnaA03g21310D [Brassica napus]
Length=553

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 82/143 (57%), Gaps = 12/143 (8%)
 Frame = +1

Query  265  DLFDPRTAV-MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd--sdas  435
            DLFDP+T+  MD   SP  + P  DFGFAFNDSNFSDRLLRIE++   S           
Sbjct  5    DLFDPKTSTDMDSILSPRDSSPGADFGFAFNDSNFSDRLLRIEILGGPSSGSRSDGDGCC  64

Query  436  QTLADWTRHRKQRGGGDFKENALDISTYQEEQIVN-CNPIDTEDADNGNQDEAVVAMIEE  612
             ++ADW RHRK+    D K N  DI    EEQI+   N  D +D   G++D    AM+EE
Sbjct  65   TSIADWARHRKRT--RDDKNNK-DIVACPEEQIITDNNRPDMDDCPGGDEDGE--AMVEE  119

Query  613  AQSGDEAAN---SEDSNWNIDSS  672
            A SGD+  +   S + NW +D S
Sbjct  120  ALSGDDDDDDDASSEPNWGMDHS  142



>ref|XP_004138465.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
1 [Cucumis sativus]
Length=552

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 90/148 (61%), Gaps = 11/148 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDY--SPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            MKD   DLFDPR A +D DY  S +++    DFGFAF+DSNFSDRLLRIE+V  S +   
Sbjct  1    MKDPNTDLFDPR-ATIDSDYLLSASTSSRDSDFGFAFDDSNFSDRLLRIEIVGGSDETDP  59

Query  421  dsdasQTLADWTRHRKQRGGGDFKENALDISTYQ---EEQIVNCNPIDTEDADNG-NQDE  588
            +     ++ DW R ++++      EN  + STY    ++Q++ C+  D  D  +  N DE
Sbjct  60   EFGGCSSVLDWARRKRRKEEKK-TENG-EFSTYLKCPQQQVLTCDQPDMVDVLSFENPDE  117

Query  589  AVVAMIEEAQSGDEAANSEDSNWNIDSS  672
              VAMIEE+ SGDE AN+ D   N+DSS
Sbjct  118  GPVAMIEESLSGDEGANTND--LNLDSS  143



>ref|XP_003637208.1| Kelch-like protein [Medicago truncatula]
 gb|KEH18740.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=551

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 93/144 (65%), Gaps = 6/144 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP T VM+ +++   +    DFGFAFNDSNFSDR+LRIE++AD  D   DS
Sbjct  1    MKDLNSDLFDPVT-VMESEWAHGGSSSDADFGFAFNDSNFSDRVLRIEIMADPVDPQPDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAM  603
            +   ++ADW RHRK+R     KEN  D+    +EQI+N N  D +D   + NQ+E VVAM
Sbjct  60   ENCTSIADWARHRKRRREDIKKENVGDLP---DEQILNGNQPDMDDCVASENQEEEVVAM  116

Query  604  IEEAQSGDEAANSEDS-NWNIDSS  672
            +EE+ SGDEA N  D  N  +D S
Sbjct  117  VEESPSGDEAVNDNDEPNLGMDYS  140



>gb|KHG30067.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=562

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 88/148 (59%), Gaps = 18/148 (12%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSA----PPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLFD  T +M  D+SP  A       PDFGFAFNDSNFSDR+LRIE++ DS +  SD D 
Sbjct  8    DLFDLST-IMVSDFSPGGAFGSDTTEPDFGFAFNDSNFSDRVLRIEIIPDSPETKSDGDC  66

Query  433  sQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIE  609
              ++ADW R+RK+R     KE  +D+   ++EQ++NCN  DT D     N+DE  VAMIE
Sbjct  67   CSSIADWARNRKRRREDLKKE--IDV-VQRQEQVLNCNVPDTVDGLTYENRDEDAVAMIE  123

Query  610  EA---------QSGDEAANSEDSNWNID  666
             +         Q G++ A+   S+ N D
Sbjct  124  GSPSDVGLNCNQIGNDTAHDNYSSLNKD  151



>ref|XP_006290834.1| hypothetical protein CARUB_v10016944mg [Capsella rubella]
 gb|EOA23732.1| hypothetical protein CARUB_v10016944mg [Capsella rubella]
Length=562

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 82/142 (58%), Gaps = 7/142 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+   MD D+S   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  9    DLFDPKIQ-MDSDFSRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDVEGCTSI  67

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNG-NQDE--AVVAMI  606
            ADW RHRK+R     KE+ +   DI    EEQI+     D +    G N D+    +   
Sbjct  68   ADWARHRKRRREDIKKESGVTISDIVACPEEQILTDEQPDMDGCPGGENIDDEGEAMVEE  127

Query  607  EEAQSGDEAANSEDSNWNIDSS  672
            EEA SGDE   S + NW +D S
Sbjct  128  EEALSGDEDETSSEPNWGMDCS  149



>gb|KJB39679.1| hypothetical protein B456_007G025100 [Gossypium raimondii]
 gb|KJB39680.1| hypothetical protein B456_007G025100 [Gossypium raimondii]
Length=562

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 9/127 (7%)
 Frame = +1

Query  256  QILDLFDPRTAVMDPDYSPTSA----PPHPDFGFAFNDSNFSDRLLRIEVVadssdacsd  423
            ++ DLFD  T +M  D+SP  A       PDFGFAFNDSNFSDR+LRIE++ DS +  SD
Sbjct  5    KVPDLFDLST-IMVSDFSPGGAFGSDTTEPDFGFAFNDSNFSDRVLRIEIMPDSPETKSD  63

Query  424  sdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVA  600
             D   ++ADW R+RK+R   DFK+  +D+   ++EQ++NCN  DT D     N+D+  VA
Sbjct  64   GDCCSSIADWARNRKRR-REDFKKE-IDV-VQRQEQVLNCNVPDTVDGLTYENRDDDAVA  120

Query  601  MIEEAQS  621
            MIE + S
Sbjct  121  MIEGSPS  127



>ref|XP_003637209.1| Kelch-like protein [Medicago truncatula]
 gb|KEH18741.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=591

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP T VM+ +++   +    DFGFAFNDSNFSDR+LRIE++AD  D   DS
Sbjct  1    MKDLNSDLFDPVT-VMESEWAHGGSSSDADFGFAFNDSNFSDRVLRIEIMADPVDPQPDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAM  603
            +   ++ADW RHRK+R     KEN  D+    +EQI+N N  D +D   + NQ+E VVAM
Sbjct  60   ENCTSIADWARHRKRRREDIKKENVGDLP---DEQILNGNQPDMDDCVASENQEEEVVAM  116

Query  604  IEEAQSGDEAAN  639
            +EE+ SGDEA N
Sbjct  117  VEESPSGDEAVN  128



>gb|KEH18742.1| BTB/POZ domain protein POB1 [Medicago truncatula]
Length=559

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 5/132 (4%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            MKD   DLFDP T VM+ +++   +    DFGFAFNDSNFSDR+LRIE++AD  D   DS
Sbjct  1    MKDLNSDLFDPVT-VMESEWAHGGSSSDADFGFAFNDSNFSDRVLRIEIMADPVDPQPDS  59

Query  427  dasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAM  603
            +   ++ADW RHRK+R     KEN  D+    +EQI+N N  D +D   + NQ+E VVAM
Sbjct  60   ENCTSIADWARHRKRRREDIKKENVGDLP---DEQILNGNQPDMDDCVASENQEEEVVAM  116

Query  604  IEEAQSGDEAAN  639
            +EE+ SGDEA N
Sbjct  117  VEESPSGDEAVN  128



>gb|EYU40044.1| hypothetical protein MIMGU_mgv1a004127mg [Erythranthe guttata]
Length=543

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 81/136 (60%), Gaps = 14/136 (10%)
 Frame = +1

Query  292  MDPDYSPTSAPP--HPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHR  465
            M+ D SP +  P    DFGFAFND NFSDRLLRIE++ D   +  D+D   +LADW R+R
Sbjct  1    MESDTSPDTGSPVSSSDFGFAFNDVNFSDRLLRIEILPDLPGSKPDAD--DSLADWARNR  58

Query  466  KQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA---------Q  618
            K+R   D   NA++++  +EEQI+N N  D ED       E VVAM+EE          Q
Sbjct  59   KRRRD-DQLTNAVELADQREEQILNGNMPDLEDGVTYENQEEVVAMVEELPVGGEIATDQ  117

Query  619  SGDEAANSEDSNWNID  666
            SG EAA   +++ ++D
Sbjct  118  SGHEAAQRNEASSSMD  133



>ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
 gb|ESQ43918.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum]
Length=603

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 78/140 (56%), Gaps = 15/140 (11%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D++   +    DFGFAFNDSNFSDRLLRIE++   SD+ SD +   ++
Sbjct  61   DLFDPKTQ-MDSDFTRHGSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDGEGCTSI  119

Query  445  ADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEE  612
            ADW RHRK+R   + K+  +   DI    EEQI+     D E    G N D+        
Sbjct  120  ADWARHRKRRREDNNKKEFVTVSDIVACAEEQILTDEQPDMEGCPGGDNLDD--------  171

Query  613  AQSGDEAANSEDSNWNIDSS  672
               GDE   + + NW +D S
Sbjct  172  --EGDEEDTTSEPNWGMDCS  189



>emb|CDX95684.1| BnaC03g25650D [Brassica napus]
Length=539

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 77/139 (55%), Gaps = 17/139 (12%)
 Frame = +1

Query  265  DLFDPRTAV-MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQT  441
            DLFD +T+  MD   S   + P  DFGFAFNDSNFSDRLLRIE++ +            +
Sbjct  5    DLFDSKTSTDMDSILSRRDSSPGADFGFAFNDSNFSDRLLRIEILGEGCCT--------S  56

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVN-CNPIDTEDADNGNQDEAVVAMIEEAQ  618
            +ADW RHRK+      K    DI    EEQI+   N  D +D   G  DE   AM+EEA 
Sbjct  57   IADWARHRKRTRDDKNK----DIVACPEEQIITDNNQPDMDDCPGG--DEEGEAMVEEAL  110

Query  619  SGDEAAN-SEDSNWNIDSS  672
            SGD+  + S + NW +D S
Sbjct  111  SGDDDDDASSEPNWGMDHS  129



>ref|XP_009104327.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X4 
[Brassica rapa]
Length=551

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 78/139 (56%), Gaps = 14/139 (10%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDP+T  MD D+S   +    DFGFAFNDSNFSDRLLRIE++ + SD+ SD +   ++
Sbjct  8    DLFDPKTQ-MDSDFSRHGSSSEGDFGFAFNDSNFSDRLLRIEIMGNPSDSRSDVEGCTSI  66

Query  445  ADWTRHRKQRGGGDFKENAL--DISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ADW RHRK+R     KE+    DI    EEQI+     D +    G N D+         
Sbjct  67   ADWARHRKRRREDIKKESVTISDIVACPEEQILTDEQPDMDGCPGGDNLDD---------  117

Query  616  QSGDEAANSEDSNWNIDSS  672
              GDE   + + +W +D S
Sbjct  118  -EGDEEDTTSEPSWGMDCS  135



>ref|XP_009142670.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g46260 [Brassica rapa]
Length=564

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 88/147 (60%), Gaps = 15/147 (10%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYS---PTSAPPHPDFGFAFNDSNFSDRLLRIEVV---adssdacsds  426
            DLFDP+T  MD ++S    +S+    DFGFAFNDSNFSDRLLRIE++   +  S +    
Sbjct  9    DLFDPKTE-MDSNFSRHGSSSSSSEGDFGFAFNDSNFSDRLLRIEIMGGPSSDSTSDVGE  67

Query  427  dasQTLADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNGNQDEAVV  597
                ++ADW RHRK+R   + K++ +   DI    EEQI+  N  +  D D+   +E   
Sbjct  68   GGCTSIADWARHRKRRREDNNKKDNVTVSDIVACPEEQIITDN--NQPDLDDNLDEEGGE  125

Query  598  AMI--EEAQSGDEAANSEDSNWNIDSS  672
            AM+  EEA SGD+ A+SE  NW +D S
Sbjct  126  AMVEEEEALSGDDDASSE-PNWGMDQS  151



>ref|XP_010915728.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Elaeis 
guineensis]
Length=552

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 86/142 (61%), Gaps = 11/142 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFD R AVMD D+S  S     +F FAFN SNFSDR+LRIE++A+   + S+ + +   
Sbjct  5    DLFDHR-AVMDSDFSGASRSDQ-NFEFAFNSSNFSDRVLRIEIMAEPPGSKSEGEGAAAD  62

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAMIEEA--  615
             +W RH K++   D  +  ++ +  Q E I+NC+  DTED     N DE VVAMIEE+  
Sbjct  63   GEWARHPKRK--RDEIKKDIESAKCQPEHILNCDQPDTEDCVAYENNDEEVVAMIEESPP  120

Query  616  ---QSGDEAANSEDSNWNIDSS  672
               Q GD+ + S DS W+++ S
Sbjct  121  NVGQDGDD-SQSNDSTWSMECS  141



>ref|XP_004494778.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Cicer 
arietinum]
Length=551

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 84/137 (61%), Gaps = 11/137 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLF+    VM+P+ S        DFGFAFNDSNFSDR+LRIEV+            + T+
Sbjct  11   DLFET-LVVMEPETSGDGVYDD-DFGFAFNDSNFSDRILRIEVM-----EDPIETHTDTI  63

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD-NGNQDEAVVAMIEEAQS  621
            +DW+ HRK+R     KEN  D++   +E+I+N +  D +D   + N+D+   AM+EE+ S
Sbjct  64   SDWS-HRKRRREDIQKEN--DLAVLPDERIINGHQPDVDDCGPSENRDDEADAMLEESPS  120

Query  622  GDEAANSEDSNWNIDSS  672
            GDEAA+  ++ +N+D S
Sbjct  121  GDEAADRSNATFNMDCS  137



>emb|CDX80003.1| BnaA05g01530D [Brassica napus]
Length=513

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 88/147 (60%), Gaps = 15/147 (10%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYS---PTSAPPHPDFGFAFNDSNFSDRLLRIEVV---adssdacsds  426
            DLFDP+T  MD ++S    +S+    DFGFAFNDSNFSDRLLRIE++   +  S +    
Sbjct  9    DLFDPKTE-MDSNFSRHGSSSSSSEGDFGFAFNDSNFSDRLLRIEIMGGPSSDSTSDVGE  67

Query  427  dasQTLADWTRHRKQRGGGDFKENAL---DISTYQEEQIVNCNPIDTEDADNGNQDEAVV  597
                ++ADW RHRK+R   + K++ +   DI    EEQI+  N  +  D D+   +E   
Sbjct  68   GGCTSIADWARHRKRRREDNNKKDNVTVSDIVACPEEQIITDN--NQPDLDDNLDEEGGE  125

Query  598  AMIEEAQ--SGDEAANSEDSNWNIDSS  672
            AM+EE +  SGD+ A+SE  NW +D S
Sbjct  126  AMVEEEETLSGDDDASSE-PNWGMDQS  151



>gb|KJB22357.1| hypothetical protein B456_004G043000 [Gossypium raimondii]
Length=555

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DFGFAFNDSNFSDRLLRIE++   S+   D +    ++DW  HRK+R     KE  LD+S
Sbjct  29   DFGFAFNDSNFSDRLLRIEIMGVRSECHPDGEDCTGISDWDHHRKRRREDIKKEIVLDLS  88

Query  514  TYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA--QSGDEAANSEDSNWNIDSS  672
               EEQI+N +  D +D A   NQD    A+       SGDE  NS +S+W++D S
Sbjct  89   LCPEEQILNDSQPDMDDGAGCENQDAEAEAVAMAEEIHSGDEDENSNESSWSMDCS  144



>gb|KHG04418.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
 gb|KHG04419.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
 gb|KHG30490.1| BTB/POZ domain-containing POB1 -like protein [Gossypium arboreum]
Length=555

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 69/116 (59%), Gaps = 3/116 (3%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DFGFAFNDSNFSDRLLRIE++   S+   + +    ++DW  HRK+R     KE  LD+S
Sbjct  29   DFGFAFNDSNFSDRLLRIEIMGVPSECHPNGEDCTGISDWDHHRKRRREDIKKEIVLDLS  88

Query  514  TYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEA--QSGDEAANSEDSNWNIDSS  672
               EEQI+N N  D +D A   NQD    A+       SGDE  N  +S+W++D S
Sbjct  89   LCPEEQILNDNQPDMDDGAGCENQDAEAEAVAMAEEIHSGDEDENRNESSWSMDCS  144



>emb|CDY42028.1| BnaC04g01060D [Brassica napus]
Length=507

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 81/141 (57%), Gaps = 9/141 (6%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVV---adssdacsdsdas  435
            DLFDP+T +        S+    DFGFAFNDSNFSDRLLRIE+    +  S +       
Sbjct  9    DLFDPKTEMDSSFSRHGSSSSEGDFGFAFNDSNFSDRLLRIEITGGPSSDSTSDVGEGGC  68

Query  436  QTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMI--E  609
             ++ADW RHRK+R   + K++  +I    EEQI+  N  +  D D+   +E   AM+  E
Sbjct  69   ASIADWARHRKRRREDNNKKDN-EIVACPEEQIITDN--NQPDMDDNLDEEGGEAMVEEE  125

Query  610  EAQSGDEAANSEDSNWNIDSS  672
            EA SGD+ A+SE  NW +D S
Sbjct  126  EALSGDDDASSE-PNWGMDQS  145



>ref|XP_008392473.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Malus 
domestica]
Length=558

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 80/150 (53%), Gaps = 11/150 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHP--------DFGFAFNDSNFSDRLLRIEVVad  402
            M+   +DL  PR  + D   SP+              DF FAFND NFSDR+L IE+V D
Sbjct  1    MRKANVDLSRPRM-ITDSGASPSGLAGESGGSDKEVQDFAFAFNDRNFSDRVLVIEIVPD  59

Query  403  ssdacsdsdasQTLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTED-ADNGN  579
            S +A  D     T++DW R+RK+R     +++A DI+ ++EE ++NCN  DTED     N
Sbjct  60   SPEAKLDVVGCSTVSDWARNRKRRRAEIKRDSAEDIAVHREELVLNCNMPDTEDNTVFDN  119

Query  580  QDEAVVAMIEEAQSGDEAANSEDSNWNIDS  669
            QDE   AM  E  S       +D  WN+D 
Sbjct  120  QDEEAAAM-NEYPSAVGVNLGDDLAWNLDC  148



>ref|XP_010053177.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Eucalyptus 
grandis]
 gb|KCW77441.1| hypothetical protein EUGRSUZ_D01781 [Eucalyptus grandis]
Length=572

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 78/123 (63%), Gaps = 11/123 (9%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DFGFAFNDSNFSDR+LRIE+V D  D  SD +   ++ADW R+RK+R     K+N L+  
Sbjct  38   DFGFAFNDSNFSDRILRIEIVPDLPDFKSDGEGCTSIADWARNRKRRREEIRKDNVLEPV  97

Query  514  TYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIEEAQS---------GDEAANSEDSNWNI  663
             + EEQI++CN  DT+D A   NQDE  VAMIEE+ S         GDE A S  ++  +
Sbjct  98   QF-EEQILSCNMPDTDDGAGYENQDEEAVAMIEESPSDGVMSSQRLGDETAQSGGTSLTM  156

Query  664  DSS  672
            + S
Sbjct  157  ECS  159



>ref|XP_008794992.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Phoenix dactylifera]
Length=569

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 10/143 (7%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs-dsdasQT  441
            DLFD R AVMD D+   S     +F FAFN SNFSDR+LRIE++A+   + S    A+  
Sbjct  5    DLFDHR-AVMDSDFFGASGSDQ-NFEFAFNSSNFSDRMLRIEIMAEPPGSNSDGVGAAAA  62

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAMIEEA-  615
              +W RH K++     K+ A + +    E I++C+  DTED     N DE VVAMIEE+ 
Sbjct  63   FGEWARHAKRKRDEIKKDKATESAKCLPEHILSCDQPDTEDCVAYENDDEEVVAMIEESP  122

Query  616  ----QSGDEAANSEDSNWNIDSS  672
                Q GD+ + S DS W+++ S
Sbjct  123  PNVGQDGDD-SQSNDSTWSMECS  144



>ref|XP_004951269.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Setaria italica]
Length=538

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 74/134 (55%), Gaps = 17/134 (13%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            MDPD+SP      P F FAFN+ NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MDPDFSPGGG--GPSFEFAFNEVNFSDRELRIEVVAGDDDAPGSSGGGAGGGGLADWARH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAMIEEA-----QS  621
            RK+R     KE   + +T+  +Q  NCN ++ E+ D    NQ+E  VAMIEE+     Q 
Sbjct  59   RKRRREELLKEK--ESTTHMSDQ-TNCNEVEAEECDAYEENQEEP-VAMIEESPPDVGQD  114

Query  622  GDEAANSEDSNWNI  663
            GD+     DS+W +
Sbjct  115  GDDGPGI-DSSWTV  127



>ref|NP_001142262.1| uncharacterized protein LOC100274431 [Zea mays]
 gb|ACF81694.1| unknown [Zea mays]
 gb|ACF88032.1| unknown [Zea mays]
 gb|ACR36259.1| unknown [Zea mays]
 gb|ACR38764.1| unknown [Zea mays]
 gb|AFW71009.1| hypothetical protein ZEAMMB73_641376 [Zea mays]
 gb|AIB05715.1| orphans transcription factor, partial [Zea mays]
Length=539

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 74/134 (55%), Gaps = 17/134 (13%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            MDPD+SP      P F FAFN+ NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MDPDFSPGGG--GPSFEFAFNEVNFSDRELRIEVVAGDDYAPGSSGAGAGGGGLADWARH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAMIEEA-----QS  621
            RK+R     KE   + +T+  +Q  NCN ++ E+ D    NQ+E  VAM+EE+     Q 
Sbjct  59   RKRRREELLKEK--ESTTHMSDQ-TNCNEVEAEECDAYEENQEEP-VAMVEESPPDVGQD  114

Query  622  GDEAANSEDSNWNI  663
            GD+     DS+W +
Sbjct  115  GDD-GQGIDSSWTV  127



>ref|XP_010469101.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Camelina sativa]
Length=565

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYS----PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLFDP+T +   D+S     +S+    DFGFAFNDSNFSDRLLRIE++   SD+ SD + 
Sbjct  8    DLFDPKTQMDSSDFSRHGHGSSSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDVEG  67

Query  433  sQTLADWTRHRKQRGGGDFKEN--ALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAM  603
              ++ADW RHRK+R     K+   A DI    EEQI+     D +    G N D+   AM
Sbjct  68   CTSIADWARHRKRRREDIIKKESAAGDIVACPEEQILTDEQPDMDGCPGGDNLDDEGEAM  127

Query  604  IE--EAQSGDEAANSEDSNWNIDSS  672
            +E  EA SGDE   S + NW +D S
Sbjct  128  VEEQEALSGDEDETSSEPNWGMDCS  152



>ref|XP_011026945.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Populus euphratica]
Length=551

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 78/136 (57%), Gaps = 2/136 (1%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFDPR   MD   SP  +    DF FAFNDSNFSDR+L+IE+VA   D  S  D   ++
Sbjct  7    DLFDPRID-MDSYVSPVESRLDCDFSFAFNDSNFSDRVLKIEIVAGLPDVKSAGDGCSSI  65

Query  445  ADWTRHRKQRGGGDFKENALDISTYQE-EQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS  621
             +W R+RK+R     K+ A++I    E EQ + CN  DTED     +   + A ++  Q 
Sbjct  66   TEWARNRKRRRKDVKKDKAVEIVGQSEDEQALTCNIPDTEDTVAMVEGSPIDAQLDFHQR  125

Query  622  GDEAANSEDSNWNIDS  669
            GD A  S DS+W++D 
Sbjct  126  GDAAGPSSDSSWSMDC  141



>gb|ABK24446.1| unknown [Picea sitchensis]
Length=572

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 83/135 (61%), Gaps = 12/135 (9%)
 Frame = +1

Query  295  DPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQR  474
            D  YS +++ P P+F FAFNDSNFSDR+LRIE+++  +++ SD +   ++ADW R+RK+R
Sbjct  33   DSPYSASASAP-PNFAFAFNDSNFSDRILRIEIMSGPTESKSDGEGCNSIADWARNRKRR  91

Query  475  GGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEAQSGDEAANSE--  645
               D K+ A  +   +E  +++ +P DT+DA    N DE  VAMIEE+ +     +S   
Sbjct  92   -REDIKKEAGFLDGCEEHIMISSHP-DTDDAAAYENPDEEAVAMIEESPTTVAMLSSPAA  149

Query  646  ------DSNWNIDSS  672
                   S+W++D S
Sbjct  150  DDCGHGSSSWSMDCS  164



>ref|XP_010413379.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Camelina sativa]
Length=570

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 86/153 (56%), Gaps = 21/153 (14%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYS----PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLFDP+T  MD D+S     +S+    DFGFAFNDSNFSDRLLRIE++   SD+ SD + 
Sbjct  9    DLFDPKTQ-MDSDFSRHGHGSSSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDVEG  67

Query  433  sQTLADWTRHRKQR----------GGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-N  579
              ++ADW RHRK+R          GGG       DI    EEQI+     D +    G N
Sbjct  68   CTSIADWARHRKRRREDFIKKESAGGG---VTISDIVACPEEQILTDEQPDMDGCPVGDN  124

Query  580  QDEAVVAMIE--EAQSGDEAANSEDSNWNIDSS  672
             D+   AM+E  EA SGDE   S + NW +D S
Sbjct  125  LDDEGEAMVEEQEALSGDEDETSSEPNWGMDCS  157



>ref|XP_010512512.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Camelina 
sativa]
Length=568

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 87/149 (58%), Gaps = 14/149 (9%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYS----PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLFDP+T  MD D+S     +S+    DFGFAFNDSNFSDRLLRIE++   SD+ SD + 
Sbjct  8    DLFDPKTQ-MDSDFSRHGHGSSSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDVEG  66

Query  433  sQTLADWTRHRKQRGGGDFKENAL------DISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              ++ADW RHRK+R     K+++       DI    EEQI+     D +    G N D+ 
Sbjct  67   CTSIADWARHRKRRREDIIKKDSAAGVTISDIVACPEEQILTDEQPDMDGCPVGDNLDDE  126

Query  592  VVAMIE--EAQSGDEAANSEDSNWNIDSS  672
              AM+E  EA SGDE   S + NW +D S
Sbjct  127  GEAMVEEQEALSGDEDETSSEPNWGMDCS  155



>ref|XP_004951268.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Setaria italica]
Length=539

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 74/135 (55%), Gaps = 18/135 (13%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            MDPD+SP      P F FAFN+ NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MDPDFSPGGG--GPSFEFAFNEVNFSDRELRIEVVAGDDDAPGSSGGGAGGGGLADWARH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAMIEEAQ------  618
            RK+R     KE   + +T+  +Q  NCN ++ E+ D    NQ+E  VAMIEE+       
Sbjct  59   RKRRREELLKEK--ESTTHMSDQ-TNCNEVEAEECDAYEENQEEP-VAMIEESPPDVGQD  114

Query  619  SGDEAANSEDSNWNI  663
            +GD+     DS+W +
Sbjct  115  AGDDGPGI-DSSWTV  128



>ref|XP_002451902.1| hypothetical protein SORBIDRAFT_04g009720 [Sorghum bicolor]
 gb|EES04878.1| hypothetical protein SORBIDRAFT_04g009720 [Sorghum bicolor]
Length=538

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 74/134 (55%), Gaps = 17/134 (13%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            MDPD+SP      P F FAFN+ NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MDPDFSPGGG--GPSFEFAFNEVNFSDRELRIEVVAGDDDAPGSSGGGAGGGGLADWARH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAMIEEA-----QS  621
            RK+R     KE   + +T+  +Q  +CN ++ E+ D    NQ+E  VAMIEE+     Q 
Sbjct  59   RKRRREELLKEK--ESTTHMSDQ-TSCNGVEAEECDAYEENQEEP-VAMIEESPPDVGQD  114

Query  622  GDEAANSEDSNWNI  663
            GD+     DS+W +
Sbjct  115  GDD-GQGIDSSWTV  127



>ref|XP_010469099.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Camelina sativa]
Length=569

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 85/149 (57%), Gaps = 13/149 (9%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYS----PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda  432
            DLFDP+T +   D+S     +S+    DFGFAFNDSNFSDRLLRIE++   SD+ SD + 
Sbjct  8    DLFDPKTQMDSSDFSRHGHGSSSSSDGDFGFAFNDSNFSDRLLRIEIMGGPSDSRSDVEG  67

Query  433  sQTLADWTRHRKQRGGGDFKENAL------DISTYQEEQIVNCNPIDTEDADNG-NQDEA  591
              ++ADW RHRK+R     K+ +       DI    EEQI+     D +    G N D+ 
Sbjct  68   CTSIADWARHRKRRREDIIKKESAAGVTVSDIVACPEEQILTDEQPDMDGCPGGDNLDDE  127

Query  592  VVAMIE--EAQSGDEAANSEDSNWNIDSS  672
              AM+E  EA SGDE   S + NW +D S
Sbjct  128  GEAMVEEQEALSGDEDETSSEPNWGMDCS  156



>ref|XP_007040415.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
 gb|EOY24916.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao]
Length=473

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYSPTSAPPH----PDFGFAFNDSNFSDRLLRIEVVadssdacsdsd  429
            +DLFDPRT +MD D+SP  A        DFGFAFNDSNFSDR+LRIE++ D  +  +D D
Sbjct  6    VDLFDPRT-IMDSDFSPGEASGSGSGDSDFGFAFNDSNFSDRVLRIEIMPDLRETKADGD  64

Query  430  asQTLADWTRHRKQRGGGDFKENAL  504
               ++ADW R+RK+R     KEN L
Sbjct  65   GCSSIADWARNRKRRREDIKKENEL  89



>ref|XP_010925790.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Elaeis guineensis]
Length=557

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 83/146 (57%), Gaps = 14/146 (10%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFD R AVMD D+S  S     +F FAFN SNFSDR+LRIE++A+   + SD ++    
Sbjct  5    DLFDHR-AVMDSDFSGASGSDQ-NFEFAFNSSNFSDRVLRIEIMAEPPGSKSDGESGAAA  62

Query  445  ADWTRHRKQRGGGDFKENALDISTYQE----EQIVNCNPIDTEDADNG-NQDEAVVAMIE  609
             +W R  K R   + K++   ++T       E I+NC+  DTED     N DE  VAMIE
Sbjct  63   VEWARQPK-RKREEIKKDKESLATESAKSPPEHILNCDQPDTEDCVAFENNDEDAVAMIE  121

Query  610  EA-----QSGDEAANSEDSNWNIDSS  672
            E+     + GD+ A S DS W ++ S
Sbjct  122  ESPPNIGRDGDD-AQSNDSTWGMECS  146



>ref|XP_010676365.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Beta 
vulgaris subsp. vulgaris]
Length=553

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 77/129 (60%), Gaps = 7/129 (5%)
 Frame = +1

Query  301  DYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGG  480
            D  P+S+    DFGFAFNDSNFSDR+L++E+V D  D  SD+D   T+ADW ++RK+R  
Sbjct  19   DLRPSSS--ESDFGFAFNDSNFSDRILKVEIVPDLPDIKSDADGCTTIADWAKNRKRRRE  76

Query  481  GDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS-----GDEAANSE  645
               K++  D+    ++QI+N +  D++     + D   VAMIEE+ S     GDE   + 
Sbjct  77   DIKKDHGADVILQPDDQILNGSMPDSDGVAYESLDGEAVAMIEESPSIDDFVGDETLQNI  136

Query  646  DSNWNIDSS  672
            D +  +D S
Sbjct  137  DISLRMDCS  145



>emb|CBI40464.3| unnamed protein product [Vitis vinifera]
Length=501

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +1

Query  439  TLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA  615
            ++ADW RHRK+R     KEN  DI    EEQI+NCN  D +D     N+DE  VAMIEE+
Sbjct  16   SIADWARHRKRRREDIKKEN--DIVACPEEQILNCNQPDVDDVVACENEDEEAVAMIEES  73

Query  616  QSGDEAANSEDSNWNIDSS  672
             SGDEA    +S WN+D S
Sbjct  74   ASGDEAEVGNNSAWNMDCS  92



>ref|XP_008794993.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Phoenix dactylifera]
Length=567

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 83/143 (58%), Gaps = 12/143 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacs-dsdasQT  441
            DLFD R AVMD D+   S     +F FAFN SNFSDR+LRIE++A+   + S    A+  
Sbjct  5    DLFDHR-AVMDSDFFGASGSDQ-NFEFAFNSSNFSDRMLRIEIMAEPPGSNSDGVGAAAA  62

Query  442  LADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAMIEEA-  615
              +W RH K R   + K++  + +    E I++C+  DTED     N DE VVAMIEE+ 
Sbjct  63   FGEWARHAK-RKRDEIKKDK-ESAKCLPEHILSCDQPDTEDCVAYENDDEEVVAMIEESP  120

Query  616  ----QSGDEAANSEDSNWNIDSS  672
                Q GD+ + S DS W+++ S
Sbjct  121  PNVGQDGDD-SQSNDSTWSMECS  142



>ref|XP_008793877.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Phoenix dactylifera]
Length=557

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (57%), Gaps = 12/145 (8%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFD R AVMD D+   S     +F FAFN SNFSDR+LRIE++A+   + SD +     
Sbjct  5    DLFDHR-AVMDSDFCGASGGDQ-NFEFAFNSSNFSDRVLRIEIMAEPPGSKSDGEGGAAA  62

Query  445  ADWTRHRKQRG---GGDFKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEE  612
             +W RH K++      D +  A + +    E I+N + +DTED     N DE  VAMIEE
Sbjct  63   VEWARHPKRKREEIKKDKESLAAESAKSPTEHILNYDQLDTEDCVAFENNDEDAVAMIEE  122

Query  613  A-----QSGDEAANSEDSNWNIDSS  672
            +     + GD+ + S DS W+++ S
Sbjct  123  SPPNIGRDGDD-SQSNDSTWSMECS  146



>ref|XP_011463940.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=548

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = +1

Query  322  PPHP--DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKE  495
            PP P  DF FAFND NFSDR+LRIE++ D   + SD +A  + +DW  +RK+R      +
Sbjct  16   PPSPELDFTFAFNDPNFSDRVLRIEILPDIPVSQSDVEAYVSNSDWGHNRKRRRAESKNQ  75

Query  496  NALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIE  609
            +A DI    EEQ+++CN +DTED     NQDE  +A  E
Sbjct  76   SAEDIVVQCEEQVLHCNMLDTEDFVVCENQDEDAMATTE  114



>ref|XP_009410863.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=536

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 72/128 (56%), Gaps = 8/128 (6%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQ  471
            M+P +S  S     +F FAFN SNFSDR+LRIE+V DS +  +    +  LA   RHRK+
Sbjct  1    MEPVFS-FSGSADQNFEFAFNSSNFSDRVLRIEIVPDSPEDTTGGVGTSGLA---RHRKR  56

Query  472  RGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEA-VVAMIEEAQSGDEAANSED  648
            R     KE A++ +        + N ID +D   G  +E   VAMIEE  SGDE +   D
Sbjct  57   RRADVKKERAVEFNLV---SFPHSNQIDDDDGLTGANNEGEAVAMIEEFSSGDELSQCSD  113

Query  649  SNWNIDSS  672
            ++W+++ S
Sbjct  114  ASWSMECS  121



>gb|KHN27269.1| BTB/POZ domain-containing protein POB1 [Glycine soja]
Length=502

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  439  TLADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQ  618
            T+ADW RHRK+R     K+N  D+++  +EQ++N +  + ++ +N  QDE   AM+EE  
Sbjct  16   TIADWARHRKRRREDIKKDNGADLASVPDEQVLNGHQSEADECEN--QDEEADAMVEEPH  73

Query  619  SGDEAANSEDSNWNIDSS  672
            SGDEA NS DS+W++D S
Sbjct  74   SGDEATNSNDSDWSMDCS  91



>ref|NP_001146028.1| hypothetical protein [Zea mays]
 gb|ACL53061.1| unknown [Zea mays]
Length=537

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 60/109 (55%), Gaps = 11/109 (10%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            M+PD+S    P    F FAFN++NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MEPDFSTVGGP---SFEFAFNEANFSDRELRIEVVAGDYDAPGSTGGGSGGGGLADWARH  57

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAM  603
            RK+R    FKE   + +TY  +Q  N N ++ E+ D    NQ+E V  M
Sbjct  58   RKRRREELFKEK--ESTTYMSDQ-TNFNEVEAEECDAYEENQEEPVAMM  103



>gb|AFW65829.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=537

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 60/109 (55%), Gaps = 11/109 (10%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            M+PD+S    P    F FAFN++NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MEPDFSTVGGP---SFEFAFNEANFSDRELRIEVVAGDYDAPGSTGGGSGGGGLADWARH  57

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAM  603
            RK+R    FKE   + +TY  +Q  N N ++ E+ D    NQ+E V  M
Sbjct  58   RKRRREELFKEK--ESTTYMSDQ-TNFNEVEAEECDAYEENQEEPVAMM  103



>ref|XP_004298859.1| PREDICTED: BTB/POZ domain-containing protein At2g46260-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=543

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = +1

Query  322  PPHP--DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKE  495
            PP P  DF FAFND NFSDR+LRIE++ D   + SD +A  + +DW  +RK+R     + 
Sbjct  16   PPSPELDFTFAFNDPNFSDRVLRIEILPDIPVSQSDVEAYVSNSDWGHNRKRR-----RA  70

Query  496  NALDISTYQEEQIVNCNPIDTED-ADNGNQDEAVVAMIE  609
               DI    EEQ+++CN +DTED     NQDE  +A  E
Sbjct  71   ETEDIVVQCEEQVLHCNMLDTEDFVVCENQDEDAMATTE  109



>ref|XP_006842893.1| hypothetical protein AMTR_s00075p00053230 [Amborella trichopoda]
 gb|ERN04568.1| hypothetical protein AMTR_s00075p00053230 [Amborella trichopoda]
Length=105

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 48/74 (65%), Gaps = 3/74 (4%)
 Frame = +1

Query  250  KDQILDLFDPRTAVMDPDYSPTSAPPH---PDFGFAFNDSNFSDRLLRIEVVadssdacs  420
            K+  +DLF+P   VMD +YS   +       +F FAFNDSNFSDR+LRIE+++   ++ S
Sbjct  3    KETGVDLFEPPRGVMDSEYSGGGSGAGGSTANFAFAFNDSNFSDRILRIEIISGLMESKS  62

Query  421  dsdasQTLADWTRH  462
            + +   ++ADW R+
Sbjct  63   EGEGCNSIADWARN  76



>ref|XP_006360698.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum 
tuberosum]
Length=546

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 73/138 (53%), Gaps = 7/138 (5%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DL DP T +    Y   +     DF FA+N++ FSDR+L I++V              T 
Sbjct  4    DLSDPLTKMDTLGYGSGTGS---DFSFAYNNATFSDRILTIQIVPYFKSEGEGCS--STA  58

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDA-DNGNQDEAVVAMIEEAQS  621
             DW R RK+R     K+N  D+ T  E+++VNC  +DTED     NQDE  VAM EE+ S
Sbjct  59   GDWDRKRKRRREETNKQNDADMLTQCEDEVVNCTMLDTEDVLAYENQDEEAVAMAEESPS  118

Query  622  -GDEAANSEDSNWNIDSS  672
             G  A+ S DS   ++S+
Sbjct  119  GGGVASKSTDSFTYLNSA  136



>ref|XP_006343902.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006343903.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Solanum tuberosum]
Length=552

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGG-DFKENALDI  510
            D+GFAF+DSNFSDR+L IEVV D  +  ++ +    + DW R RK+R    + + N  D+
Sbjct  19   DYGFAFDDSNFSDRVLMIEVVPDLPELKTEEEGLSLVVDWARKRKRRREEINRRGNDADV  78

Query  511  STYQEEQIVNCNPIDTED--ADNGNQDEAVVAMIEEAQSG  624
               ++EQ+VNC  ++ ED  AD+  ++EAVV M+EE+ SG
Sbjct  79   VVQRDEQVVNCTALEMEDGLADDEREEEAVV-MLEESPSG  117



>ref|XP_011073542.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Sesamum 
indicum]
Length=546

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 73/123 (59%), Gaps = 13/123 (11%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            DF FAFND NFSDR+LRIE++       S  D   +LADW R+RK+R   D   NA + +
Sbjct  19   DFAFAFNDVNFSDRVLRIEIL--PDTTGSKPDPDDSLADWARNRKRR-RDDQLSNADERA  75

Query  514  TYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEA---------QSGDEAANSEDSNWNI  663
              +EEQI+NCN  D ED     NQ+E  VAM+EE+         QSG EAA   +++ ++
Sbjct  76   EQREEQILNCNMPDLEDGVTYENQEEEAVAMVEESPAGAETTINQSGQEAAQGSEASSSM  135

Query  664  DSS  672
            D S
Sbjct  136  DYS  138



>ref|NP_001142889.1| hypothetical protein [Zea mays]
 gb|ACG27332.1| hypothetical protein [Zea mays]
 gb|AFW71010.1| hypothetical protein ZEAMMB73_641376 [Zea mays]
Length=99

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 38/64 (59%), Gaps = 5/64 (8%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            MDPD+SP      P F FAFN+ NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MDPDFSPGGG--GPSFEFAFNEVNFSDRELRIEVVAGDDYAPGSSGAGAGGGGLADWARH  58

Query  463  RKQR  474
            RK+R
Sbjct  59   RKRR  62



>ref|XP_009419783.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=559

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            +F FAFN SNFSDR+LRIEV+A++  A +          W  HRK+R     KE A + +
Sbjct  32   NFEFAFNSSNFSDRVLRIEVMAETLGAGA-----GAGIGWDGHRKRRRNDGSKEEAPEFA  86

Query  514  TYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA  615
             Y  E I +C P   E A+  NQDE    M+EE+
Sbjct  87   RYSSELISSCEPDTEECAEYENQDEEDEPMLEES  120



>ref|XP_006830392.1| hypothetical protein AMTR_s00116p00144700 [Amborella trichopoda]
 gb|ERM97808.1| hypothetical protein AMTR_s00116p00144700 [Amborella trichopoda]
Length=106

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +1

Query  322  PPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGG--GDFK  492
            P  PDF FAFNDSNFSDR+LRIE++A+  D  SDS+   T+A+W + RK+  G   DF+
Sbjct  12   PSSPDFSFAFNDSNFSDRILRIEIMAEPPDKESDSEDCNTVAEWAKKRKRYWGENSDFR  70



>gb|ACG45607.1| hypothetical protein [Zea mays]
 gb|AFW65827.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=138

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 6/73 (8%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            M+PD+S    P    F FAFN++NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MEPDFSTVGGP---SFEFAFNEANFSDRELRIEVVAGDYDAPGSTGGGSGGGGLADWARH  57

Query  463  RKQRGGGDFKENA  501
            RK+R    FKE  
Sbjct  58   RKRRREELFKEKG  70



>ref|XP_009410864.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=514

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 61/127 (48%), Gaps = 28/127 (22%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQ  471
            M+P +S  S     +F FAFN SNFSDR+LRIE+V DS +  +    +  LA   RHRK+
Sbjct  1    MEPVFS-FSGSADQNFEFAFNSSNFSDRVLRIEIVPDSPEDTTGGVGTSGLA---RHRKR  56

Query  472  RGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEAANSEDS  651
            R                          D +     N +   VAMIEE  SGDE +   D+
Sbjct  57   RRA------------------------DVKKERGANNEGEAVAMIEEFSSGDELSQCSDA  92

Query  652  NWNIDSS  672
            +W+++ S
Sbjct  93   SWSMECS  99



>ref|XP_010522933.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Tarenaya hassleriana]
Length=549

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 16/137 (12%)
 Frame = +1

Query  283  TAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEV-----VadssdacsdsdasQTLA  447
            T VMD D S +++    DF FAFND NFSDRLLRIE+             +    S ++ 
Sbjct  9    TMVMDSDPSLSTSANDGDFRFAFNDVNFSDRLLRIEISGGEPSTSELRTDAGELGSCSIV  68

Query  448  DWTRHRKQRGGGDFKE--NALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS  621
            DW R RK+R   D K+  +A D++T  + +       D    DN + D+  +A++EE+QS
Sbjct  69   DWVRDRKRR-REDVKKDDHAFDLATEPDMKGDQPETDDCGGEDNEHGDD--MAIVEESQS  125

Query  622  GDEAANSEDSNWNIDSS  672
             +E      SNW +DSS
Sbjct  126  DNE------SNWGMDSS  136



>ref|XP_010522934.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Tarenaya hassleriana]
Length=545

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 73/137 (53%), Gaps = 16/137 (12%)
 Frame = +1

Query  283  TAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEV-----VadssdacsdsdasQTLA  447
            T VMD D S +++    DF FAFND NFSDRLLRIE+             +    S ++ 
Sbjct  9    TMVMDSDPSLSTSANDGDFRFAFNDVNFSDRLLRIEISGGEPSTSELRTDAGELGSCSIV  68

Query  448  DWTRHRKQRGGGDFKE--NALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS  621
            DW R RK+R   D K+  +A D++T  + +       D    DN + D+  +A++EE+QS
Sbjct  69   DWVRDRKRR-REDVKKDDHAFDLATEPDMKGDQPETDDCGGEDNEHGDD--MAIVEESQS  125

Query  622  GDEAANSEDSNWNIDSS  672
             +E      SNW +DSS
Sbjct  126  DNE------SNWGMDSS  136



>ref|XP_009380541.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=555

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 61/115 (53%), Gaps = 9/115 (8%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            +F FAFN SNFSDR+LRIEVVA+  +  +D       A W  +RK+R     KE A + +
Sbjct  33   NFEFAFNSSNFSDRVLRIEVVAEPDEGGAD-------AGWAGYRKRRRDDGAKEKASESA  85

Query  514  TYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQ--SGDEAANSEDSNWNIDSS  672
             Y  E I +C P   E  +  N DE    M+EE     G   A++E+ + N+  S
Sbjct  86   KYSLELISSCEPDTEECMEYENHDEEDEPMLEELAPGVGRAGADTENDSSNVGGS  140



>ref|XP_009380540.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=557

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            +F FAFN SNFSDR+LRIEVVA+  +  +D       A W  +RK+R     KE A + +
Sbjct  33   NFEFAFNSSNFSDRVLRIEVVAEPDEGGAD-------AGWAGYRKRRRDDGAKEKASESA  85

Query  514  TYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSG----DEAANSEDSNWNIDSS  672
             Y  E I +C P   E  +  N DE    M+EE   G       A++E+ + N+  S
Sbjct  86   KYSLELISSCEPDTEECMEYENHDEEDEPMLEELAPGVGRAGTCADTENDSSNVGGS  142



>gb|EPS68073.1| hypothetical protein M569_06692, partial [Genlisea aurea]
Length=577

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +1

Query  262  LDLFDPRTAVMDPDYS--PTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdas  435
            LDLFD R   MD D    P S    P+FGFAFND NFSDR+LR+++V+D  D  S+S+  
Sbjct  2    LDLFDHRVTSMDSDCGSLPPSGNSDPNFGFAFNDVNFSDRVLRLDIVSDPMDRESESEDG  61

Query  436  QTLADWTRHRKQ  471
             T+A W   R++
Sbjct  62   VTVAGWASRRRR  73



>ref|XP_008677104.1| PREDICTED: uncharacterized protein LOC100279559 isoform X1 [Zea 
mays]
 gb|ACN28605.1| unknown [Zea mays]
 gb|AFW65828.1| hypothetical protein ZEAMMB73_711899 [Zea mays]
Length=493

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 6/72 (8%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad---ssdacsdsdasQTLADWTRH  462
            M+PD+S    P    F FAFN++NFSDR LRIEVVA    +  +         LADW RH
Sbjct  1    MEPDFSTVGGP---SFEFAFNEANFSDRELRIEVVAGDYDAPGSTGGGSGGGGLADWARH  57

Query  463  RKQRGGGDFKEN  498
            RK+R    FKE 
Sbjct  58   RKRRREELFKEK  69



>dbj|BAJ93322.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 29/143 (20%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            M+PD+S  S    P + FAFN  NFSDR+LRIE+VA         +  +   ++ADW RH
Sbjct  1    MEPDFSRASG--GPSYEFAFNSVNFSDRVLRIEIVAGDDAPGTKGAAGEGCSSIADWARH  58

Query  463  --------RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQ-DEAVVAMIEEA  615
                    R+++GG ++ +   + S  +         I+ E+ D   +  E  VAMIEE+
Sbjct  59   RKRRREDLRREKGGEEYGKYMFEPSNVK---------IEAEEHDTYEETGEEPVAMIEES  109

Query  616  -----QSGDEAANSEDSNWNIDS  669
                 Q G++  NS DS+WN++ 
Sbjct  110  PPDIGQDGEDGQNS-DSSWNMEC  131



>gb|AAT40121.1| GAMYB-binding protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 74/143 (52%), Gaps = 29/143 (20%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            M+PD+S  S    P + FAFN  NFSDR+LRIE+VA         +  +   ++ADW RH
Sbjct  42   MEPDFSRASG--GPSYEFAFNSVNFSDRVLRIEIVAGDDAPGAKGAAGEGCSSIADWARH  99

Query  463  --------RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQ-DEAVVAMIEEA  615
                    R+++GG ++ +   + S  +         I+ E+ D   +  E  VAMIEE+
Sbjct  100  RKRRREDLRREKGGEEYGKYMFEPSNVK---------IEAEEHDTYEETGEEPVAMIEES  150

Query  616  -----QSGDEAANSEDSNWNIDS  669
                 Q G++  NS DS+WN++ 
Sbjct  151  PPDIGQDGEDGENS-DSSWNMEC  172



>ref|XP_009419784.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=557

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 7/94 (7%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            +F FAFN SNFSDR+LRIEV+     A +    +     W  HRK+R     KE   + +
Sbjct  32   NFEFAFNSSNFSDRVLRIEVM-----AETLGAGAGAGIGWDGHRKRRRNDGSKEE--EFA  84

Query  514  TYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA  615
             Y  E I +C P   E A+  NQDE    M+EE+
Sbjct  85   RYSSELISSCEPDTEECAEYENQDEEDEPMLEES  118



>ref|XP_010522935.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X3 
[Tarenaya hassleriana]
Length=543

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 67/135 (50%), Gaps = 18/135 (13%)
 Frame = +1

Query  283  TAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEV-----VadssdacsdsdasQTLA  447
            T VMD D S +++    DF FAFND NFSDRLLRIE+             +    S ++ 
Sbjct  9    TMVMDSDPSLSTSANDGDFRFAFNDVNFSDRLLRIEISGGEPSTSELRTDAGELGSCSIV  68

Query  448  DWTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGD  627
            DW R RK+R     K++        + +  +C   D E  D+       +A++EE+QS +
Sbjct  69   DWVRDRKRRREDVKKDDHEPDMKGDQPETDDCGGEDNEHGDD-------MAIVEESQSDN  121

Query  628  EAANSEDSNWNIDSS  672
            E      SNW +DSS
Sbjct  122  E------SNWGMDSS  130



>gb|AFW76704.1| hypothetical protein ZEAMMB73_633282 [Zea mays]
Length=212

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 56/111 (50%), Gaps = 9/111 (8%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            MDPD+SP S    P F FAFN  NFSDR+LRIE+VA         +  +   +LADW  H
Sbjct  1    MDPDFSPASG--GPSFEFAFNSVNFSDRVLRIEIVAGDDALGAKGATGEGCSSLADWACH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA  615
            RK+R     +      S        NC  ++ E+ D   +    VAMIEE+
Sbjct  59   RKRR---REELRRDKESRKYMPDPANCK-VEAEECDAYEEGNEPVAMIEES  105



>ref|XP_001771535.1| predicted protein [Physcomitrella patens]
 gb|EDQ63735.1| predicted protein [Physcomitrella patens]
Length=539

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 59/124 (48%), Gaps = 11/124 (9%)
 Frame = +1

Query  316  SAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKE  495
            SAP    + FAFNDSNFSDR+LRIEVVA S    + S +S+       HR    G    +
Sbjct  12   SAPT--TYTFAFNDSNFSDRVLRIEVVAVSEKNDAGSASSRQKKRRRAHRHSEAGSGVSK  69

Query  496  NA-----LDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEAANSEDSNWN  660
                     +   QEEQ++       ED      DE  VAMIEE    +   ++    WN
Sbjct  70   LLGGPVEAQLGEGQEEQVMYVG----EDVAPQEADEEAVAMIEEPHGVNSMFSALGGTWN  125

Query  661  IDSS  672
            +D+S
Sbjct  126  MDTS  129



>ref|XP_010098414.1| hypothetical protein L484_000083 [Morus notabilis]
 gb|EXC43993.1| hypothetical protein L484_000083 [Morus notabilis]
Length=96

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 5/70 (7%)
 Frame = +1

Query  247  MKDQILDLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsds  426
            M+   ++LFD RT +MD   S + +    DF FAFNDSNFSDR+LRIE++ D  +  SD 
Sbjct  1    MRRSKVNLFDRRT-IMDSATSTSDS----DFFFAFNDSNFSDRILRIEIIPDLPETKSDG  55

Query  427  dasQTLADWT  456
            +   +LADWT
Sbjct  56   EGCTSLADWT  65



>dbj|BAJ95490.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 70/142 (49%), Gaps = 30/142 (21%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            MDPD+S  S    P F FAFN  NFSDR+LRIE+VA         +  +   ++ADW RH
Sbjct  1    MDPDFSRASG--GPSFEFAFNSVNFSDRVLRIEIVAGDDAPGAKGAAGEGCSSIADWARH  58

Query  463  --------RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA-  615
                    R+++  G +     +I    +E+       DT +  N    E  VAMIEE+ 
Sbjct  59   RKRRREDLRREKECGKYISEPANIKIEADER-------DTYEETN----EEPVAMIEESP  107

Query  616  ----QSGDEAANSEDSNWNIDS  669
                Q GD+   S DS+WN++ 
Sbjct  108  PDIGQDGDD-GESSDSSWNMEC  128



>emb|CDX71727.1| BnaC08g31470D [Brassica napus]
Length=554

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 73/140 (52%), Gaps = 22/140 (16%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            D+  P T  +D   S + A    DFGFAFNDSNFSDRLLRIE++   S+  ++     ++
Sbjct  13   DMLGPHTHYLDSSSSSSEA----DFGFAFNDSNFSDRLLRIEIMGRGSNPDAEGYG--SI  66

Query  445  ADWTRHRKQRGGGDFKENALDIS----TYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEE  612
            ADW R RK+R     K+ ++ IS      +E  + N  P    D D G       AMIEE
Sbjct  67   ADWARRRKRRREDTIKKESVTISDILAGAEERVLTNEQP----DMDEGE------AMIEE  116

Query  613  AQSG--DEAANSEDSNWNID  666
            A SG  DE   +   NW ++
Sbjct  117  AFSGSDDEDDVTSAPNWGLE  136



>gb|ACN26008.1| unknown [Zea mays]
 gb|AFW76705.1| GAMYB-binding protein [Zea mays]
Length=536

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 65/134 (49%), Gaps = 13/134 (10%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            MDPD+SP S    P F FAFN  NFSDR+LRIE+VA         +  +   +LADW  H
Sbjct  1    MDPDFSPASG--GPSFEFAFNSVNFSDRVLRIEIVAGDDALGAKGATGEGCSSLADWACH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEA---  633
            RK+R     +      S        NC  ++ E+ D   +    VAMIEE+    EA   
Sbjct  59   RKRRRE---ELRRDKESRKYMPDPANCK-VEAEECDAYEEGNEPVAMIEESPPDIEADGE  114

Query  634  -ANSEDSNWNIDSS  672
               S DS  +++ +
Sbjct  115  DGKSSDSYCSMECT  128



>gb|AIB05667.1| TRAF transcription factor, partial [Zea mays]
Length=536

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 65/134 (49%), Gaps = 13/134 (10%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            MDPD+SP S    P F FAFN  NFSDR+LRIE+VA         +  +   +LADW  H
Sbjct  1    MDPDFSPASG--GPSFEFAFNSVNFSDRVLRIEIVAGDDALGAKGATGEGCSSLADWACH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEA---  633
            RK+R     +      S        NC  ++ E+ D   +    VAMIEE+    EA   
Sbjct  59   RKRRRE---ELRRDKESRKYMPDPANCK-VEAEECDAYEEGNEPVAMIEESPPDIEADGE  114

Query  634  -ANSEDSNWNIDSS  672
               S DS  +++ +
Sbjct  115  DGKSSDSYCSMECT  128



>ref|XP_002961299.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
 gb|EFJ38838.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
Length=542

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 55/114 (48%), Gaps = 13/114 (11%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda-sQTLADWTRHRK  468
            MD D    S    P F FAFNDSNFSDR+L IE+VA +S     S     T+  W R +K
Sbjct  1    MDTD--TCSGGTSPSFAFAFNDSNFSDRVLHIEIVAGASGEAKSSGEPCSTVGAWARQKK  58

Query  469  QRGGGDFKENALDISTYQ-----EEQIVNCNPIDTEDADNGNQDEAVVAMIEEA  615
            +R G D K+     S        EEQI+     + +DA+          MIEE+
Sbjct  59   RRRGADAKDKGTLFSCLSFYLSFEEQIMTGTQPEPDDAEEEGD-----VMIEES  107



>ref|XP_006590500.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Glycine 
max]
Length=520

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 61/113 (54%), Gaps = 15/113 (13%)
 Frame = +1

Query  334  DFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFKENALDIS  513
            +F FAFN+ NFSDR+L IEV+ D     + S +  TLA    +RK+R     K N + + 
Sbjct  14   NFSFAFNNINFSDRILNIEVIPDPHFIRAQSHSLSTLAP---NRKRRRLSLMKANDVLL-  69

Query  514  TYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
              Q E+ +NCN  D E+         VVA+ E + SGDE ++  DS+  +  S
Sbjct  70   --QPEEKLNCNLPDAEE---------VVAITEASLSGDEVSHGNDSSLGMSWS  111



>ref|XP_001760430.1| predicted protein [Physcomitrella patens]
 gb|EDQ74821.1| predicted protein [Physcomitrella patens]
Length=542

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 65/137 (47%), Gaps = 31/137 (23%)
 Frame = +1

Query  313  TSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLADWTRHRKQRGGGDFK  492
            TSAP    + FAFNDSNFSDR+LRIEVVA S    + S +        R +K+R      
Sbjct  11   TSAPT--TYTFAFNDSNFSDRVLRIEVVAASEKNDAGSTS-------ARQKKRRRADRNT  61

Query  493  ENALDISTY------------QEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQ-----S  621
            E  L +S              QEEQ++       ED      DE  VAMIEE       +
Sbjct  62   EAGLGVSKLLGGASETQLGEGQEEQVMYV----AEDVAPQEADEEAVAMIEETYGVTNFA  117

Query  622  GDEAANSEDSNWNIDSS  672
            G++   S  S WN+D++
Sbjct  118  GEDGGTSSGS-WNMDTA  133



>ref|XP_002983257.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
 gb|EFJ15599.1| ubiquitin-protein ligase, POB1 [Selaginella moellendorffii]
Length=542

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 56/114 (49%), Gaps = 13/114 (11%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsda-sQTLADWTRHRK  468
            MD D    S    P F FAFNDSNFSDR+L IE+VA +S     S     T+  W R +K
Sbjct  1    MDTD--TCSGGTSPSFAFAFNDSNFSDRVLHIEIVAGASGEAKSSGEPCSTVGAWARQKK  58

Query  469  QRGGGDFKE-----NALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA  615
            +R G D K+     + L      EEQI+     + +DA+          MIEE+
Sbjct  59   RRRGADAKDKGTLFSCLFFCLSFEEQIMTGTQPEPDDAEEEGD-----VMIEES  107



>ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
 gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao]
Length=468

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  487  FKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEAQSGDEAANSEDSNWNI  663
            F  + LD+S   +EQI+N N  D +D     N DE  VAM+EE QSGDE ANS +S+W++
Sbjct  20   FVFSVLDLSLCPDEQILNGNQPDMDDGVGCENLDEDAVAMVEETQSGDEDANSNESSWSM  79

Query  664  DSS  672
            D S
Sbjct  80   DFS  82



>gb|KCW78131.1| hypothetical protein EUGRSUZ_D02337 [Eucalyptus grandis]
Length=492

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 2/58 (3%)
 Frame = +1

Query  499  ALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
            ALDI+   EEQI+N  P D +D D     +  VAM+EE+ SGDEAA+S DS W++DSS
Sbjct  28   ALDITGCPEEQILN-EP-DMDDCDGPENQDDTVAMVEESPSGDEAASSNDSGWSMDSS  83



>ref|NP_001046484.1| Os02g0260700 [Oryza sativa Japonica Group]
 dbj|BAD20083.1| putative BTB/POZ domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAD20129.1| putative BTB/POZ domain-containing protein [Oryza sativa Japonica 
Group]
 dbj|BAF08398.1| Os02g0260700 [Oryza sativa Japonica Group]
 dbj|BAG94789.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56691.1| hypothetical protein OsJ_06150 [Oryza sativa Japonica Group]
Length=558

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 38/68 (56%), Gaps = 8/68 (12%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQ-------TLAD  450
            MDPD+S       P F FAFN  NFSDR+LRIEVVA   D   D            +L+D
Sbjct  14   MDPDFSGGGGG-GPSFEFAFNSVNFSDRVLRIEVVAGDDDDDDDHAPGSSRDGGAGSLSD  72

Query  451  WTRHRKQR  474
            W RHRK+R
Sbjct  73   WARHRKRR  80



>gb|EEC72875.1| hypothetical protein OsI_06647 [Oryza sativa Indica Group]
Length=558

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 38/68 (56%), Gaps = 8/68 (12%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQ-------TLAD  450
            MDPD+S       P F FAFN  NFSDR+LRIEVVA   D   D            +L+D
Sbjct  14   MDPDFSGGGGG-GPSFEFAFNSVNFSDRVLRIEVVAGDDDDDDDHAPGSSRDGGAGSLSD  72

Query  451  WTRHRKQR  474
            W RHRK+R
Sbjct  73   WARHRKRR  80



>ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao]
 gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao]
Length=525

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = +1

Query  487  FKENALDISTYQEEQIVNCNPIDTEDADNG-NQDEAVVAMIEEAQSGDEAANSEDSNWNI  663
            F  + LD+S   +EQI+N N  D +D     N DE  VAM+EE QSGDE ANS +S+W++
Sbjct  20   FVFSVLDLSLCPDEQILNGNQPDMDDGVGCENLDEDAVAMVEETQSGDEDANSNESSWSM  79

Query  664  DSS  672
            D S
Sbjct  80   DFS  82



>ref|XP_009116827.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Brassica 
rapa]
Length=549

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 52/137 (38%), Positives = 75/137 (55%), Gaps = 22/137 (16%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            D+F P    +D      S+   PDFGFAFND NFSDRLLRIE++A  S+  ++     ++
Sbjct  15   DMFGPPGLYLD------SSSSEPDFGFAFNDRNFSDRLLRIEIMAPGSNPGAEGFG--SI  66

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIV-NCNPIDTEDADNGNQDEAVVAMIEEAQS  621
            +DW R RK+R   +   N  D+    EEQ++ N  P    D D G       AMI+EA +
Sbjct  67   SDWARRRKRR--REESVNVSDVLAGAEEQVLTNEKP----DMDEGE------AMIQEAFA  114

Query  622  GDEAANSEDS-NWNIDS  669
            GD+  +  ++ NW  +S
Sbjct  115  GDDEDDVTNAPNWGFES  131



>ref|XP_003572201.1| PREDICTED: BTB/POZ domain-containing protein POB1 [Brachypodium 
distachyon]
Length=552

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 9/113 (8%)
 Frame = +1

Query  286  AVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVad-ssdacsdsdasQTLADWTRH  462
            A MDPD+S  S    P F FAFN  NFSDR+LRIEVV    +       A  +L+DW RH
Sbjct  16   AEMDPDFS--SGEGGPSFEFAFNSVNFSDRVLRIEVVGTDDAPGSRGDVAGGSLSDWARH  73

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDAD--NGNQDEAVVAMIEEA  615
            RK+R          + +T+  +Q  NCN ++ E+ D    NQ+E  VAMIEE+
Sbjct  74   RKRRREE--LRKEKECATHMSDQ-TNCNDVEAEECDAYEENQEEP-VAMIEES  122



>ref|NP_001148937.1| GAMYB-binding protein [Zea mays]
 gb|ACG33542.1| GAMYB-binding protein [Zea mays]
Length=536

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 65/134 (49%), Gaps = 13/134 (10%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            MDPD+SP S    P F FAFN  NFSDR+L+IE+VA         +  +   +LADW  H
Sbjct  1    MDPDFSPASG--GPSFEFAFNSVNFSDRVLQIEIVAGDDALGAKGATGEGCSSLADWACH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQSGDEA---  633
            RK+R     +      S        NC  ++ E+ D   +    VAMIEE+    EA   
Sbjct  59   RKRRRE---ELRRDKESRKYMPDPANCK-VEAEECDAYEEGNEPVAMIEESPPDIEADGE  114

Query  634  -ANSEDSNWNIDSS  672
               S DS  +++ +
Sbjct  115  DGKSSDSYCSMECT  128



>ref|XP_011093067.1| PREDICTED: BTB/POZ domain-containing protein POB1-like isoform 
X3 [Sesamum indicum]
Length=476

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = +1

Query  499  ALDISTYQEEQIVNCNPIDTEDAD-NGNQDEAVVAMIEEAQSGDEAANSEDSNWNIDSS  672
            ALDI+ + EEQI++C P D E+ D + N DE  +   E++ SGDEAA S+DSNW+ D S
Sbjct  7    ALDINNFPEEQILDCQP-DAEEGDGDENHDEEEIPTTEDSPSGDEAALSDDSNWSGDGS  64



>gb|EMT31791.1| hypothetical protein F775_32011 [Aegilops tauschii]
Length=662

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 16/135 (12%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWTRH  462
            M+PD+S  SA     + FAFN  NFSDR+LRIE+VA         +  +   ++ADW RH
Sbjct  1    MEPDFSRASA--GGSYEFAFNSVNFSDRVLRIEIVAGDDGPGAKGAAGEGCSSIADWARH  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQD-EAVVAMIEEA-----QSG  624
            RK+R          +   Y  E   +   I+ E+ D   +  E  VAMIEE+     Q G
Sbjct  59   RKRRRED--LRRDKECGKYMLEP--STVKIEAEECDTYEETGEEPVAMIEESPPDIGQDG  114

Query  625  DEAANSEDSNWNIDS  669
             +  NS DS+WN++ 
Sbjct  115  GDGENS-DSSWNMEC  128



>emb|CDY11366.1| BnaA09g39320D [Brassica napus]
Length=550

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 73/138 (53%), Gaps = 23/138 (17%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            D+F P    +D      S+   PDFGFAFND NFSDRLLRIE++A  S+  ++     ++
Sbjct  15   DMFGPPGLYLD------SSSSEPDFGFAFNDRNFSDRLLRIEIMAPGSNPGAEGFG--SI  66

Query  445  ADWTRHRKQRGGGDFKENALDISTYQEEQIV-NCNPIDTEDADNGNQDEAVVAMIEEAQS  621
            +DW R RK+R   +   N  D+    EEQ++ N  P    D D G       AMI+EA +
Sbjct  67   SDWARRRKRR--REESVNVSDVLAGAEEQVLTNEKP----DMDEGE------AMIQEAFA  114

Query  622  G--DEAANSEDSNWNIDS  669
            G  DE   +   NW  +S
Sbjct  115  GSDDEDDVTNAPNWGFES  132



>ref|NP_001057726.2| Os06g0507400 [Oryza sativa Japonica Group]
 dbj|BAD61652.1| putative GAMYB-binding protein [Oryza sativa Japonica Group]
 dbj|BAG89960.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80707.1| hypothetical protein OsI_23149 [Oryza sativa Indica Group]
 gb|EEE65789.1| hypothetical protein OsJ_21492 [Oryza sativa Japonica Group]
 dbj|BAF19640.2| Os06g0507400 [Oryza sativa Japonica Group]
Length=536

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 69/135 (51%), Gaps = 15/135 (11%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVV---adssdacsdsdasQTLADWTRH  462
            MDPD+S   A   P F FAFN  NFSDR+LRIE+V     +    +  +   +LADW   
Sbjct  1    MDPDFS--RASRGPSFAFAFNSVNFSDRVLRIEIVAGDDAAGAKGAAGEGCSSLADWAHQ  58

Query  463  RKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA-----QSGD  627
            RK+R     +E      T  E   V     DT + +N    E  VAMIEE+     Q G+
Sbjct  59   RKRRREELRREKESGKYTDLETCKVEAEECDTYEENN----EEPVAMIEESPPDIGQDGE  114

Query  628  EAANSEDSNWNIDSS  672
            +  +S DS+W+++ +
Sbjct  115  D-GDSCDSSWSMECT  128



>ref|XP_004252576.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X1 
[Solanum lycopersicum]
Length=555

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 74/144 (51%), Gaps = 17/144 (12%)
 Frame = +1

Query  274  DPRTAVMDP-DYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTLAD  450
            DP T  MDP  Y   +     +F FA++++ FSDR+L I++V +S           T  D
Sbjct  7    DPLTK-MDPLGYGSGTGS---NFSFAYDNAAFSDRILTIQIVPNSKSDGEGCS--STAGD  60

Query  451  WTRHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEAQS---  621
              R RK+R     K+N  D+ T  +++++NC  +DTE     NQDE  VAM EE+ S   
Sbjct  61   LDRKRKRRREETSKQNDADVLTQHKDKVLNCTMLDTEVLAYENQDEEAVAMAEESSSRVE  120

Query  622  -------GDEAANSEDSNWNIDSS  672
                   G  A+ S DS  +++S+
Sbjct  121  MTTDHPGGGVASKSTDSFTHLNSA  144



>ref|XP_006656117.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Oryza 
brachyantha]
Length=537

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 31/143 (22%)
 Frame = +1

Query  292  MDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVa---dssdacsdsdasQTLADWT--  456
            MDPD+S  S    P F FAFN  NFSDR+LRIE+VA         +  +   +LADW   
Sbjct  1    MDPDFSRASG--GPSFEFAFNSVNFSDRVLRIEIVAGDDAPGAKGAAGEGCSSLADWARQ  58

Query  457  ------RHRKQRGGGDFKENALDISTYQEEQIVNCNPIDTEDADNGNQDEAVVAMIEEA-  615
                    R+ +  G F     D+ T + EQ       DT + +N    E  VAMIEE+ 
Sbjct  59   RKRRREELRRGKESGKFT----DLETCKVEQ----EECDTYEENN----EEPVAMIEESP  106

Query  616  ----QSGDEAANSEDSNWNIDSS  672
                Q G++   S DS+W+++ +
Sbjct  107  PDIGQDGED-GESSDSSWSMECT  128



>ref|XP_010925791.1| PREDICTED: BTB/POZ domain-containing protein POB1 isoform X2 
[Elaeis guineensis]
Length=507

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +1

Query  265  DLFDPRTAVMDPDYSPTSAPPHPDFGFAFNDSNFSDRLLRIEVVadssdacsdsdasQTL  444
            DLFD R AVMD D+S  S     +F FAFN SNFSDR+LRIE++A+   + SD ++    
Sbjct  5    DLFDHR-AVMDSDFSGASGSDQ-NFEFAFNSSNFSDRVLRIEIMAEPPGSKSDGESGAAA  62

Query  445  ADWTRHRKQR  474
             +W R  K++
Sbjct  63   VEWARQPKRK  72



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600