BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF036P13

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFK35835.1|  unknown                                                 345   6e-118   Lotus japonicus
gb|EEC84771.1|  hypothetical protein OsI_31801                          344   1e-117   Oryza sativa Indica Group [Indian rice]
gb|ADU04386.1|  heat shock protein 90-1                                 361   3e-117   Nicotiana attenuata
gb|ADX06844.1|  molecular chaperone Hsp90                               361   3e-117   Nicotiana tabacum [American tobacco]
ref|XP_009785111.1|  PREDICTED: heat shock cognate protein 80           360   3e-117   Nicotiana sylvestris
gb|KJB81564.1|  hypothetical protein B456_013G150300                    357   4e-117   Gossypium raimondii
ref|XP_009591410.1|  PREDICTED: heat shock cognate protein 80           360   4e-117   Nicotiana tomentosiformis
gb|AAS79798.1|  heat shock protein 90                                   360   7e-117   Nicotiana tabacum [American tobacco]
gb|EEC83017.1|  hypothetical protein OsI_28083                          342   8e-117   Oryza sativa Indica Group [Indian rice]
gb|AAR12193.1|  molecular chaperone Hsp90-1                             359   9e-117   Nicotiana benthamiana
gb|AGA62462.1|  heat shock protein 90                                   359   2e-116   Gossypium hirsutum [American cotton]
ref|XP_011089536.1|  PREDICTED: heat shock cognate protein 80           358   2e-116   Sesamum indicum [beniseed]
gb|AEC11021.1|  heat shock protein 90                                   342   3e-116   Camellia sinensis [black tea]
ref|XP_011097724.1|  PREDICTED: heat shock cognate protein 80-like      358   4e-116   Sesamum indicum [beniseed]
dbj|BAD95030.1|  heat-shock protein                                     342   4e-116   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22184.1|  hypothetical protein B456_004G033900                    357   5e-116   Gossypium raimondii
gb|KJB81563.1|  hypothetical protein B456_013G150300                    357   6e-116   Gossypium raimondii
gb|KJB81562.1|  hypothetical protein B456_013G150300                    357   8e-116   Gossypium raimondii
gb|AAR12194.1|  molecular chaperone Hsp90-2                             357   1e-115   Nicotiana benthamiana
emb|CBI25731.3|  unnamed protein product                                353   1e-115   Vitis vinifera
ref|XP_010539340.1|  PREDICTED: heat shock protein 90-2-like            356   2e-115   Tarenaya hassleriana [spider flower]
ref|XP_004169769.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    353   2e-115   
gb|KJB22185.1|  hypothetical protein B456_004G034000                    355   3e-115   Gossypium raimondii
ref|XP_009758556.1|  PREDICTED: heat shock cognate protein 80-like      355   5e-115   Nicotiana sylvestris
ref|XP_009594054.1|  PREDICTED: heat shock cognate protein 80-like      355   5e-115   Nicotiana tomentosiformis
gb|ADU04387.1|  heat shock protein 90-2                                 355   6e-115   Nicotiana attenuata
ref|XP_009607645.1|  PREDICTED: heat shock cognate protein 80-like      354   8e-115   Nicotiana tomentosiformis
gb|KGN66052.1|  hypothetical protein Csa_1G569290                       352   8e-115   Cucumis sativus [cucumbers]
gb|KHN43913.1|  Heat shock cognate protein 80                           348   9e-115   Glycine soja [wild soybean]
gb|ACR35758.1|  unknown                                                 343   9e-115   Zea mays [maize]
gb|AAN61003.1|  putative heat shock protein 90                          349   1e-114   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG16518.1|  putative Hsp90-2                                       354   1e-114   Capsicum chinense [bonnet pepper]
gb|KDP32613.1|  hypothetical protein JCGZ_13163                         354   1e-114   Jatropha curcas
ref|NP_001234436.1|  molecular chaperone Hsp90-1                        353   1e-114   Solanum lycopersicum
gb|KHG19401.1|  Heat shock cognate 80                                   353   2e-114   Gossypium arboreum [tree cotton]
gb|AAK91366.1|  AT5g56010/MDA7_5                                        348   2e-114   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34381.3|  unnamed protein product                                341   2e-114   Vitis vinifera
emb|CAN62488.1|  hypothetical protein VITISV_029391                     353   2e-114   Vitis vinifera
gb|EAZ43234.1|  hypothetical protein OsJ_27834                          344   2e-114   Oryza sativa Japonica Group [Japonica rice]
gb|KHG22758.1|  Heat shock cognate 80                                   353   2e-114   Gossypium arboreum [tree cotton]
ref|XP_004135593.1|  PREDICTED: heat shock cognate protein 80-like      353   3e-114   
ref|XP_003635036.1|  PREDICTED: heat shock cognate protein 80           353   3e-114   Vitis vinifera
ref|XP_009763345.1|  PREDICTED: heat shock cognate protein 80-like      353   3e-114   Nicotiana sylvestris
gb|KGN66050.1|  hypothetical protein Csa_1G569270                       353   3e-114   Cucumis sativus [cucumbers]
pdb|2XCM|A  Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar...    337   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|ACX31585.1|  molecular chaperone Hsp90-3                             352   4e-114   Nicotiana benthamiana
ref|XP_010910639.1|  PREDICTED: heat shock protein 81-1                 348   5e-114   Elaeis guineensis
pdb|2JKI|A  Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain     336   7e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010252844.1|  PREDICTED: heat shock cognate protein 80-like      352   7e-114   Nelumbo nucifera [Indian lotus]
ref|NP_001274833.1|  Hsp90-2-like                                       352   1e-113   Solanum tuberosum [potatoes]
ref|XP_006287183.1|  hypothetical protein CARUB_v10000353mg             352   1e-113   Capsella rubella
ref|XP_006857538.1|  hypothetical protein AMTR_s00061p00036160          351   1e-113   Amborella trichopoda
ref|XP_010246543.1|  PREDICTED: heat shock cognate protein 80           351   1e-113   Nelumbo nucifera [Indian lotus]
ref|XP_010443242.1|  PREDICTED: heat shock protein 90-2                 351   1e-113   Camelina sativa [gold-of-pleasure]
emb|CDP13679.1|  unnamed protein product                                350   2e-113   Coffea canephora [robusta coffee]
gb|ABW96308.1|  heat shock protein 90                                   351   2e-113   Vitis pseudoreticulata
ref|XP_010552350.1|  PREDICTED: heat shock protein 90-2                 351   2e-113   Tarenaya hassleriana [spider flower]
ref|XP_010450563.1|  PREDICTED: heat shock protein 90-3-like            351   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_006280101.1|  hypothetical protein CARUB_v10025990mg             351   2e-113   Capsella rubella
ref|XP_011030250.1|  PREDICTED: heat shock protein 81-1-like            351   2e-113   Populus euphratica
gb|KJB13949.1|  hypothetical protein B456_002G103000                    351   2e-113   Gossypium raimondii
ref|XP_009126978.1|  PREDICTED: heat shock protein 90-2-like            350   2e-113   Brassica rapa
ref|XP_006344905.1|  PREDICTED: heat shock cognate protein 80-like      350   3e-113   Solanum tuberosum [potatoes]
gb|KHN31689.1|  Heat shock cognate protein 80                           350   3e-113   Glycine soja [wild soybean]
gb|KFK40163.1|  hypothetical protein AALP_AA3G338900                    350   3e-113   Arabis alpina [alpine rockcress]
gb|ADC45395.1|  HSP90-1                                                 350   3e-113   Glycine max [soybeans]
gb|EPS61618.1|  hypothetical protein M569_13176                         350   3e-113   Genlisea aurea
ref|XP_010675973.1|  PREDICTED: heat shock cognate protein 80           350   4e-113   Beta vulgaris subsp. vulgaris [field beet]
gb|ABX76302.1|  heat shock protein 90                                   350   4e-113   Ageratina adenophora
gb|EYU33725.1|  hypothetical protein MIMGU_mgv1a002215mg                350   6e-113   Erythranthe guttata [common monkey flower]
ref|XP_002273244.1|  PREDICTED: heat shock cognate protein 80-like      350   6e-113   Vitis vinifera
ref|XP_011039800.1|  PREDICTED: heat shock protein 90-2                 349   7e-113   Populus euphratica
ref|XP_010928158.1|  PREDICTED: heat shock protein 81-1-like            349   7e-113   Elaeis guineensis
ref|XP_007020406.1|  Heat shock protein 81.4                            349   8e-113   Theobroma cacao [chocolate]
ref|XP_006401391.1|  hypothetical protein EUTSA_v10012832mg             349   8e-113   Eutrema salsugineum [saltwater cress]
ref|XP_010483071.1|  PREDICTED: heat shock protein 90-3-like            349   8e-113   Camelina sativa [gold-of-pleasure]
ref|XP_008811147.1|  PREDICTED: heat shock protein 81-1-like            349   9e-113   Phoenix dactylifera
ref|XP_002300303.1|  HSP80 family protein                               349   9e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010483070.1|  PREDICTED: heat shock protein 90-3-like            349   9e-113   Camelina sativa [gold-of-pleasure]
ref|XP_003544594.1|  PREDICTED: heat shock cognate protein 80-like      349   1e-112   Glycine max [soybeans]
ref|XP_006280103.1|  hypothetical protein CARUB_v10025991mg             349   1e-112   Capsella rubella
ref|NP_200414.1|  heat shock protein 81-2                               349   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236599.1|  heat shock protein 90-2                            349   1e-112   
gb|AAN31859.1|  putative heat shock protein 81-2 (HSP81-2)              349   1e-112   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE71229.1|  putative HEAT SHOCK PROTEIN 81-2                       342   1e-112   Trifolium pratense [peavine clover]
ref|XP_010103960.1|  Heat shock cognate protein 80                      350   1e-112   
gb|KEH26332.1|  heat shock protein 81-2                                 348   1e-112   Medicago truncatula
ref|XP_010443241.1|  PREDICTED: heat shock protein 90-3-like            348   1e-112   Camelina sativa [gold-of-pleasure]
gb|AAB33937.1|  heat-shock Protein                                      348   1e-112   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234439.1|  heat shock cognate protein 80                      348   2e-112   Solanum lycopersicum
ref|NP_200412.1|  Heat shock protein 90-3                               348   2e-112   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27172.1|  hypothetical protein AALP_AA8G344900                    348   2e-112   Arabis alpina [alpine rockcress]
ref|XP_010913224.1|  PREDICTED: heat shock protein 81-1-like            348   2e-112   Elaeis guineensis
gb|AAL49788.1|  putative heat shock protein 90                          348   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866122.1|  heat shock protein 81-4                            348   2e-112   
emb|CBI22652.3|  unnamed protein product                                343   2e-112   Vitis vinifera
ref|XP_009391803.1|  PREDICTED: heat shock protein 81-1-like            348   3e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234835.1|  PREDICTED: heat shock protein 83                   348   3e-112   Prunus mume [ume]
ref|NP_200411.1|  Heat shock protein 90-4                               348   3e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537148.1|  PREDICTED: heat shock protein 83                   348   3e-112   Tarenaya hassleriana [spider flower]
gb|AEK20869.1|  heat shock protein 90-2                                 348   3e-112   Cryptocoryne ciliata
ref|XP_008776162.1|  PREDICTED: heat shock protein 81-1                 348   3e-112   Phoenix dactylifera
ref|XP_008439282.1|  PREDICTED: heat shock protein 83                   348   3e-112   Cucumis melo [Oriental melon]
ref|XP_004234218.1|  PREDICTED: heat shock protein 83                   348   3e-112   Solanum lycopersicum
ref|XP_007220219.1|  hypothetical protein PRUPE_ppa002187mg             348   3e-112   Prunus persica
ref|XP_002299048.1|  hypothetical protein POPTR_0001s47020g             347   3e-112   Populus trichocarpa [western balsam poplar]
ref|XP_007152171.1|  hypothetical protein PHAVU_004G107700g             347   4e-112   Phaseolus vulgaris [French bean]
ref|XP_009768512.1|  PREDICTED: heat shock protein 82                   347   5e-112   Nicotiana sylvestris
ref|XP_006352548.1|  PREDICTED: heat shock cognate protein 80-like      347   5e-112   Solanum tuberosum [potatoes]
ref|XP_004491531.1|  PREDICTED: heat shock cognate protein 80-lik...    346   6e-112   
tpg|DAA61990.1|  TPA: putative heat shock protein 90 family protein     345   6e-112   
ref|NP_001240230.1|  uncharacterized protein LOC100819568               347   6e-112   Glycine max [soybeans]
gb|AGU99972.1|  HSP90                                                   347   6e-112   Populus tomentosa [Chinese white poplar]
ref|XP_002307846.1|  HSP80 family protein                               347   7e-112   Populus trichocarpa [western balsam poplar]
ref|XP_011005759.1|  PREDICTED: heat shock cognate protein 80-like      347   8e-112   Populus euphratica
ref|XP_002532177.1|  heat shock protein, putative                       347   8e-112   Ricinus communis
ref|XP_009417329.1|  PREDICTED: heat shock protein 81-1                 347   8e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010047845.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock c...    347   9e-112   Eucalyptus grandis [rose gum]
ref|XP_011040123.1|  PREDICTED: heat shock protein 81-1                 347   9e-112   Populus euphratica
gb|AHB36893.1|  heat shock protein 90                                   346   9e-112   Matricaria chamomilla var. recutita [German chamomile]
ref|XP_010536759.1|  PREDICTED: heat shock protein 90-2-like            347   9e-112   Tarenaya hassleriana [spider flower]
ref|XP_002460433.1|  hypothetical protein SORBIDRAFT_02g028050          347   1e-111   Sorghum bicolor [broomcorn]
ref|XP_003533977.1|  PREDICTED: heat shock protein 83-like              346   1e-111   
ref|XP_002869603.1|  early-responsive to dehydration 8                  346   1e-111   Arabidopsis lyrata subsp. lyrata
ref|NP_001236612.1|  heat shock protein 90-1                            346   1e-111   
ref|XP_006373573.1|  HSP80 family protein                               346   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_011076104.1|  PREDICTED: heat shock protein 83                   346   1e-111   Sesamum indicum [beniseed]
ref|XP_009132345.1|  PREDICTED: heat shock protein 90-2                 346   1e-111   Brassica rapa
gb|EYU31897.1|  hypothetical protein MIMGU_mgv1a002208mg                346   1e-111   Erythranthe guttata [common monkey flower]
ref|XP_002513649.1|  heat shock protein, putative                       346   1e-111   Ricinus communis
ref|XP_010913223.1|  PREDICTED: heat shock protein 81-1-like            346   1e-111   Elaeis guineensis
ref|XP_009383207.1|  PREDICTED: heat shock protein 81-1-like            346   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN09298.1|  Heat shock protein 83                                   346   2e-111   Glycine soja [wild soybean]
ref|XP_009368732.1|  PREDICTED: heat shock protein 83                   346   2e-111   Pyrus x bretschneideri [bai li]
gb|KDP22224.1|  hypothetical protein JCGZ_26055                         346   2e-111   Jatropha curcas
ref|XP_010671625.1|  PREDICTED: heat shock protein 83                   346   2e-111   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004491530.1|  PREDICTED: heat shock cognate protein 80-lik...    346   2e-111   Cicer arietinum [garbanzo]
ref|XP_002305263.1|  hypothetical protein POPTR_0004s07190g             346   2e-111   Populus trichocarpa [western balsam poplar]
gb|KFK29176.1|  hypothetical protein AALP_AA7G099100                    346   2e-111   Arabis alpina [alpine rockcress]
ref|XP_002462554.1|  hypothetical protein SORBIDRAFT_02g028020          346   2e-111   Sorghum bicolor [broomcorn]
ref|XP_010483069.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    346   2e-111   
ref|XP_009607669.1|  PREDICTED: heat shock protein 82                   346   2e-111   Nicotiana tomentosiformis
ref|XP_004140753.1|  PREDICTED: heat shock protein 83-like              346   2e-111   Cucumis sativus [cucumbers]
ref|XP_006362664.1|  PREDICTED: heat shock protein 83-like              346   2e-111   Solanum tuberosum [potatoes]
dbj|BAD04054.1|  heat shock protein 90                                  345   2e-111   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063500.1|  Os09g0482100                                       345   2e-111   
ref|XP_006659612.1|  PREDICTED: heat shock protein 81-1-like            345   2e-111   Oryza brachyantha
ref|XP_009390627.1|  PREDICTED: heat shock protein 81-1-like            345   2e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001063503.1|  Os09g0482400                                       345   2e-111   
emb|CDP05141.1|  unnamed protein product                                345   2e-111   Coffea canephora [robusta coffee]
ref|NP_001275844.1|  HSP90 protein                                      345   2e-111   Citrus sinensis [apfelsine]
ref|XP_006452664.1|  hypothetical protein CICLE_v10007633mg             345   3e-111   Citrus clementina [clementine]
ref|XP_006599549.1|  PREDICTED: heat shock protein 83-like              345   3e-111   Glycine max [soybeans]
ref|XP_009420064.1|  PREDICTED: heat shock protein 81-1-like            345   3e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004516872.1|  PREDICTED: heat shock protein 83-like              345   3e-111   Cicer arietinum [garbanzo]
ref|XP_008652859.1|  PREDICTED: heat shock protein 81-1                 345   3e-111   
ref|XP_006413166.1|  hypothetical protein EUTSA_v10024564mg             345   3e-111   Eutrema salsugineum [saltwater cress]
gb|EYU19581.1|  hypothetical protein MIMGU_mgv1a002166mg                345   3e-111   Erythranthe guttata [common monkey flower]
ref|XP_006372391.1|  hypothetical protein POPTR_0017s01160g             345   4e-111   
ref|XP_010060433.1|  PREDICTED: heat shock protein 83-like              345   4e-111   Eucalyptus grandis [rose gum]
ref|XP_002864186.1|  heat shock protein 81-1                            345   4e-111   
dbj|BAJ34368.1|  unnamed protein product                                345   4e-111   Eutrema halophilum
emb|CDY27839.1|  BnaC09g28660D                                          345   4e-111   Brassica napus [oilseed rape]
ref|XP_007142446.1|  hypothetical protein PHAVU_008G281300g             345   4e-111   Phaseolus vulgaris [French bean]
gb|AGC60019.1|  heat shock protein 90                                   345   4e-111   Saccharum hybrid cultivar SP80-3280
sp|P27323.3|HS901_ARATH  RecName: Full=Heat shock protein 90-1; S...    345   4e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200076.1|  heat shock protein 90.1                               345   4e-111   
ref|XP_008355028.1|  PREDICTED: heat shock protein 90-2                 345   5e-111   
ref|XP_006280097.1|  hypothetical protein CARUB_v10025984mg             345   5e-111   Capsella rubella
ref|XP_003617873.1|  Heat shock protein                                 345   5e-111   Medicago truncatula
ref|XP_004240717.1|  PREDICTED: heat shock protein 83-like              345   5e-111   
ref|XP_008811143.1|  PREDICTED: heat shock protein 81-1-like            345   5e-111   Phoenix dactylifera
prf||1908431A  heat shock protein HSP81-1                               345   5e-111
gb|KFK26865.1|  hypothetical protein AALP_AA8G303900                    345   5e-111   Arabis alpina [alpine rockcress]
dbj|BAA00615.1|  81kDa heat-shock protein                               345   5e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AFQ94045.1|  heat shock protein 90                                   344   5e-111   Lactuca sativa [cultivated lettuce]
sp|A2YWQ1.1|HSP81_ORYSI  RecName: Full=Heat shock protein 81-1; S...    344   6e-111   Oryza sativa Indica Group [Indian rice]
ref|XP_010442803.1|  PREDICTED: heat shock protein 90-1-like            345   6e-111   Camelina sativa [gold-of-pleasure]
ref|XP_011046024.1|  PREDICTED: heat shock protein 83                   344   6e-111   Populus euphratica
ref|XP_006659552.1|  PREDICTED: heat shock protein 81-1-like isof...    344   6e-111   
ref|XP_010482633.1|  PREDICTED: heat shock protein 90-1                 344   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_006439485.1|  hypothetical protein CICLE_v10019095mg             344   7e-111   Citrus clementina [clementine]
ref|XP_009132299.1|  PREDICTED: heat shock protein 90-2-like            344   7e-111   Brassica rapa
ref|XP_006659553.1|  PREDICTED: heat shock protein 81-1-like            344   7e-111   
ref|XP_002444804.1|  hypothetical protein SORBIDRAFT_07g028270          344   8e-111   Sorghum bicolor [broomcorn]
ref|XP_002274022.1|  PREDICTED: heat shock protein 83-like              344   8e-111   Vitis vinifera
ref|XP_009375529.1|  PREDICTED: heat shock protein 83-like              344   8e-111   Pyrus x bretschneideri [bai li]
ref|XP_004500151.1|  PREDICTED: heat shock cognate protein 80-like      344   8e-111   Cicer arietinum [garbanzo]
sp|P51819.1|HSP83_IPONI  RecName: Full=Heat shock protein 83            344   8e-111   Ipomoea nil [qian niu]
ref|XP_002278894.1|  PREDICTED: heat shock protein 83                   344   9e-111   Vitis vinifera
ref|NP_001170475.1|  LOC100384473                                       344   9e-111   Zea mays [maize]
gb|KFK25886.1|  hypothetical protein AALP_AA8G175000                    344   1e-110   Arabis alpina [alpine rockcress]
ref|XP_010261331.1|  PREDICTED: heat shock protein 83                   344   1e-110   Nelumbo nucifera [Indian lotus]
gb|AGB76029.1|  heat shock protein 90                                   344   1e-110   Salicornia europaea [chicken-claws]
ref|XP_008380194.1|  PREDICTED: heat shock protein 83-like              344   1e-110   
emb|CAN73318.1|  hypothetical protein VITISV_007727                     344   1e-110   Vitis vinifera
ref|XP_010035175.1|  PREDICTED: heat shock protein 83                   344   1e-110   Eucalyptus grandis [rose gum]
ref|XP_008376647.1|  PREDICTED: heat shock protein 83 isoform X1        344   1e-110   
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            343   1e-110   Tarenaya hassleriana [spider flower]
ref|XP_009367265.1|  PREDICTED: heat shock protein 90-2                 343   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_009362097.1|  PREDICTED: heat shock protein 90-2                 343   1e-110   Pyrus x bretschneideri [bai li]
ref|XP_009132342.1|  PREDICTED: heat shock protein 90-2-like            343   1e-110   Brassica rapa
gb|EAZ29453.1|  hypothetical protein OsJ_13528                          335   1e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010438732.1|  PREDICTED: heat shock protein 90-2-like            343   1e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010433476.1|  PREDICTED: heat shock protein 90-2-like            343   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006659551.1|  PREDICTED: heat shock protein 81-1-like isof...    343   2e-110   
gb|KJB52728.1|  hypothetical protein B456_008G274600                    343   2e-110   Gossypium raimondii
gb|AAQ08597.1|  heat shock protein                                      343   2e-110   Hevea brasiliensis [jebe]
ref|XP_008218765.1|  PREDICTED: heat shock protein 90-2                 343   2e-110   Prunus mume [ume]
ref|XP_009377558.1|  PREDICTED: heat shock protein 83-like              343   2e-110   Pyrus x bretschneideri [bai li]
emb|CAA72513.1|  heat shock protein                                     343   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|AIZ68157.1|  heat shock protein 83                                   343   2e-110   Ornithogalum longebracteatum [sea-onion]
gb|AAA32822.1|  heat shock protein 83                                   343   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010941080.1|  PREDICTED: heat shock protein 83                   343   2e-110   Elaeis guineensis
ref|XP_009802902.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    343   3e-110   Nicotiana sylvestris
ref|XP_008670278.1|  PREDICTED: heat shock protein 81-1-like            342   3e-110   Zea mays [maize]
emb|CAA68885.1|  heat shock protein 90A                                 343   3e-110   Arabidopsis thaliana [mouse-ear cress]
prf||1710352A  heat shock protein 83                                    343   3e-110
ref|XP_003592196.1|  Heat shock protein                                 342   3e-110   
ref|XP_004308051.1|  PREDICTED: heat shock protein 83                   342   3e-110   Fragaria vesca subsp. vesca
ref|XP_008801780.1|  PREDICTED: heat shock protein 83                   342   4e-110   Phoenix dactylifera
ref|XP_006413591.1|  hypothetical protein EUTSA_v10024561mg             342   4e-110   Eutrema salsugineum [saltwater cress]
ref|XP_010276895.1|  PREDICTED: heat shock protein 83-like              342   4e-110   Nelumbo nucifera [Indian lotus]
gb|KDO76323.1|  hypothetical protein CISIN_1g005321mg                   342   4e-110   Citrus sinensis [apfelsine]
ref|XP_010063241.1|  PREDICTED: heat shock cognate protein 80-like      342   5e-110   Eucalyptus grandis [rose gum]
ref|XP_006476504.1|  PREDICTED: heat shock protein 83-like              342   5e-110   Citrus sinensis [apfelsine]
ref|XP_004973824.1|  PREDICTED: heat shock protein 81-1-like            342   6e-110   
ref|XP_007208337.1|  hypothetical protein PRUPE_ppa002220mg             342   6e-110   Prunus persica
ref|XP_001777414.1|  predicted protein                                  342   6e-110   
dbj|BAO20259.1|  heat shock protein                                     342   7e-110   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_007038813.1|  Heat shock protein 90.1 isoform 1                  342   7e-110   
ref|XP_001779443.1|  predicted protein                                  342   7e-110   
gb|ADP89125.1|  heat shock protein 90                                   342   8e-110   Cenchrus americanus [bulrush millet]
ref|XP_011080917.1|  PREDICTED: heat shock protein 83-like              342   9e-110   Sesamum indicum [beniseed]
ref|XP_001777383.1|  predicted protein                                  341   1e-109   
ref|NP_001170480.1|  HSP protein                                        341   1e-109   Zea mays [maize]
ref|XP_006828794.1|  hypothetical protein AMTR_s00001p00118120          341   1e-109   Amborella trichopoda
gb|KHG00618.1|  Heat shock 90-1 -like protein                           341   2e-109   Gossypium arboreum [tree cotton]
ref|XP_004308050.1|  PREDICTED: heat shock protein 83-like              340   2e-109   Fragaria vesca subsp. vesca
gb|KJB20596.1|  hypothetical protein B456_003G155600                    340   2e-109   Gossypium raimondii
ref|XP_010445119.1|  PREDICTED: heat shock protein 90-1-like            340   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010934626.1|  PREDICTED: heat shock protein 83-like              340   3e-109   Elaeis guineensis
ref|XP_008797179.1|  PREDICTED: heat shock protein 83-like              340   3e-109   Phoenix dactylifera
gb|EYU25148.1|  hypothetical protein MIMGU_mgv1a002213mg                340   3e-109   Erythranthe guttata [common monkey flower]
gb|ACX37413.1|  cytosolic heat shock protein 90.1                       340   3e-109   Dactylis glomerata [cocksfoot]
ref|XP_004294900.1|  PREDICTED: heat shock protein 90-2                 340   3e-109   Fragaria vesca subsp. vesca
gb|KJB24312.1|  hypothetical protein B456_004G138600                    335   4e-109   Gossypium raimondii
ref|XP_007040338.1|  Heat shock protein 90.1                            340   4e-109   Theobroma cacao [chocolate]
ref|XP_010089052.1|  Heat shock protein 83                              340   4e-109   Morus notabilis
gb|ACN36206.1|  unknown                                                 339   5e-109   Zea mays [maize]
emb|CDY36772.1|  BnaA03g11140D                                          328   7e-109   Brassica napus [oilseed rape]
ref|XP_001780981.1|  predicted protein                                  339   7e-109   
gb|EAY92778.1|  hypothetical protein OsI_14582                          339   1e-108   Oryza sativa Indica Group [Indian rice]
gb|KDO56796.1|  hypothetical protein CISIN_1g005370mg                   338   1e-108   Citrus sinensis [apfelsine]
ref|XP_006422036.1|  hypothetical protein CICLE_v10004456mg             338   1e-108   Citrus clementina [clementine]
ref|XP_011084460.1|  PREDICTED: heat shock protein 83-like              338   1e-108   Sesamum indicum [beniseed]
gb|ABG57075.1|  heat shock protein 90                                   338   1e-108   Triticum aestivum [Canadian hard winter wheat]
gb|ADF31778.1|  heat shock protein 90                                   338   1e-108   Triticum dicoccoides [wild emmer wheat]
ref|XP_007142447.1|  hypothetical protein PHAVU_008G281400g             338   2e-108   Phaseolus vulgaris [French bean]
gb|EMT17245.1|  Heat shock protein 81-3                                 338   2e-108   
ref|XP_001766228.1|  predicted protein                                  338   2e-108   
ref|XP_010089053.1|  Heat shock protein 83                              338   2e-108   Morus notabilis
ref|XP_009413748.1|  PREDICTED: heat shock protein 83                   338   3e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010446135.1|  PREDICTED: heat shock protein 90-3-like            329   4e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011035346.1|  PREDICTED: heat shock protein 83-like isofor...    337   5e-108   Populus euphratica
gb|ADF31755.1|  heat shock protein 90                                   337   5e-108   Triticum aestivum [Canadian hard winter wheat]
gb|AIZ68152.1|  heat shock protein 81-1                                 337   6e-108   Ornithogalum longebracteatum [sea-onion]
gb|ADF31779.1|  heat shock protein 90                                   337   6e-108   Triticum dicoccoides [wild emmer wheat]
emb|CDY11921.1|  BnaC03g13470D                                          331   9e-108   Brassica napus [oilseed rape]
gb|ADF31760.1|  heat shock protein 90                                   336   1e-107   Triticum aestivum [Canadian hard winter wheat]
gb|KJB24311.1|  hypothetical protein B456_004G138600                    336   1e-107   Gossypium raimondii
dbj|BAJ99646.1|  predicted protein                                      336   1e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADF31756.1|  heat shock protein 90                                   336   1e-107   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ85535.1|  predicted protein                                      336   1e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAP87284.1|  cytosolic heat shock protein 90                         336   1e-107   Hordeum vulgare [barley]
gb|ADF31772.1|  heat shock protein 90                                   336   2e-107   Triticum urartu
gb|KFK38607.1|  hypothetical protein AALP_AA3G136000                    334   2e-107   Arabis alpina [alpine rockcress]
gb|ADF31757.1|  heat shock protein 90                                   335   2e-107   Triticum aestivum [Canadian hard winter wheat]
gb|ADF31759.1|  heat shock protein 90                                   335   2e-107   Triticum aestivum [Canadian hard winter wheat]
emb|CAE02770.2|  OSJNBb0085F13.17                                       335   2e-107   
dbj|BAJ86355.1|  predicted protein                                      335   2e-107   
ref|XP_009119805.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    335   2e-107   
gb|EMS59444.1|  Heat shock protein 81-3                                 335   2e-107   
gb|ADF31754.1|  heat shock protein 90                                   335   2e-107   
gb|AFR60309.1|  HSP90                                                   335   3e-107   
gb|ADF31775.1|  heat shock protein 90                                   335   4e-107   
emb|CDY06551.1|  BnaC02g12750D                                          330   7e-107   
emb|CDY20742.1|  BnaA02g08820D                                          329   1e-106   
ref|XP_009628903.1|  PREDICTED: heat shock protein 83-like              333   1e-106   
ref|XP_003580663.1|  PREDICTED: heat shock protein 82                   333   1e-106   
ref|NP_001190553.1|  heat shock protein 81-2                            334   1e-106   
gb|AGV54249.1|  heat-shock protein                                      333   1e-106   
emb|CDY36807.1|  BnaA03g10790D                                          329   2e-106   
emb|CDY64982.1|  BnaA02g35440D                                          328   2e-106   
emb|CAA67191.1|  HSP80-2                                                333   2e-106   
gb|ACX37414.1|  cytosolic heat shock protein 90.2                       333   2e-106   
ref|XP_010235286.1|  PREDICTED: heat shock protein 81-1-like            332   2e-106   
gb|ADF31773.1|  heat shock protein 90                                   332   2e-106   
ref|XP_003574727.1|  PREDICTED: heat shock protein 81-1                 332   2e-106   
gb|ADF31758.1|  heat shock protein 90                                   332   3e-106   
ref|XP_002973159.1|  hypothetical protein SELMODRAFT_271009             332   4e-106   
ref|XP_010235281.1|  PREDICTED: heat shock protein 81-1-like            332   4e-106   
ref|XP_006290237.1|  hypothetical protein CARUB_v100035110mg            324   4e-106   
gb|KHN23824.1|  Heat shock cognate protein 80                           331   7e-106   
ref|XP_002969937.1|  hypothetical protein SELMODRAFT_267300             330   1e-105   
ref|XP_006664928.1|  PREDICTED: heat shock protein 82-like              331   1e-105   
gb|KDP25390.1|  hypothetical protein JCGZ_20546                         330   3e-105   
gb|KFK40822.1|  hypothetical protein AALP_AA2G045900                    314   3e-105   
ref|XP_002981406.1|  hypothetical protein SELMODRAFT_271484             330   4e-105   
ref|XP_010055687.1|  PREDICTED: heat shock protein 90-1-like            329   5e-105   
gb|ACN27969.1|  unknown                                                 329   7e-105   
gb|ADF31781.1|  heat shock protein 90                                   328   1e-104   
emb|CDP12067.1|  unnamed protein product                                327   2e-104   
ref|XP_002447413.1|  hypothetical protein SORBIDRAFT_06g000660          328   2e-104   
ref|XP_004974995.1|  PREDICTED: heat shock protein 82-like              328   2e-104   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              327   3e-104   
ref|XP_002509852.1|  heat shock protein, putative                       327   5e-104   
ref|XP_008384610.1|  PREDICTED: heat shock protein 90-2                 326   9e-104   
ref|XP_002976693.1|  hypothetical protein SELMODRAFT_151384             325   2e-103   
ref|XP_011398501.1|  Heat shock protein 90-2                            315   7e-103   
ref|XP_002499727.1|  predicted protein                                  323   1e-102   
gb|AAD11549.1|  heat shock protein 80                                   323   2e-102   
ref|NP_001135416.2|  heat shock protein 82                              323   2e-102   
ref|XP_005841364.1|  heat shock protein Hsp90, cytosolic protein        322   2e-102   
emb|CEF99333.1|  Histidine kinase-like ATPase, ATP-binding domain       322   2e-102   
ref|XP_001419938.1|  Heat Shock Protein 90, cytosolic                   322   2e-102   
ref|XP_005841337.1|  hypothetical protein GUITHDRAFT_83993              321   8e-102   
dbj|BAK08691.1|  heat shock protein 90                                  319   3e-101   
dbj|BAK08690.1|  heat shock protein 90                                  319   3e-101   
dbj|BAK08741.1|  heat shock protein 90                                  319   4e-101   
dbj|BAK08728.1|  heat shock protein 90                                  319   4e-101   
dbj|BAH97107.1|  heat shock protein of Hsp90                            319   4e-101   
ref|XP_003058104.1|  predicted protein                                  318   6e-101   
ref|XP_006401798.1|  hypothetical protein EUTSA_v10012817mg             318   7e-101   
ref|XP_007510316.1|  predicted protein                                  318   1e-100   
gb|KCW79839.1|  hypothetical protein EUGRSUZ_C01179                     317   1e-100   
gb|ACM50884.1|  heat shock protein 90A                                  318   1e-100   
dbj|BAK08742.1|  heat shock protein 90                                  317   1e-100   
gb|AAS20999.1|  heat shock protein 82                                   305   2e-100   
dbj|BAL45643.1|  heat shock protein 90                                  317   2e-100   
emb|CAN70887.1|  hypothetical protein VITISV_005592                     315   8e-100   
dbj|BAK08743.1|  heat shock protein 90                                  315   2e-99    
gb|KCW52046.1|  hypothetical protein EUGRSUZ_J01486                     298   1e-98    
gb|KDD75584.1|  heat shock protein 90 Hsp90                             312   1e-98    
ref|XP_005643103.1|  HSP90-domain-containing protein                    312   1e-98    
gb|KCW90631.1|  hypothetical protein EUGRSUZ_A02734                     312   2e-98    
gb|AFK39716.1|  unknown                                                 298   3e-98    
ref|XP_002947115.1|  hypothetical protein VOLCADRAFT_73112              311   4e-98    
gb|AFK31313.1|  heat shock protein 90                                   310   8e-98    
gb|AFK31312.1|  heat shock protein 90                                   309   2e-97    
emb|CEI86384.1|  Putative Heat shock protein 90-1                       293   4e-97    
ref|XP_008238949.1|  PREDICTED: heat shock protein 90-1-like            309   4e-97    
gb|KCW81281.1|  hypothetical protein EUGRSUZ_C02653                     304   6e-97    
gb|KCW84385.1|  hypothetical protein EUGRSUZ_B01235                     304   8e-97    
tpg|DAA34102.1|  TPA: heat shock protein 90                             288   2e-95    
gb|ACD88948.1|  hsp82                                                   305   2e-95    
gb|ACC43938.1|  82 kDa heat shock protein                               305   3e-95    
ref|XP_001695264.1|  heat shock protein 90A                             303   5e-95    
ref|XP_005777261.1|  hypothetical protein EMIHUDRAFT_443778             303   8e-95    
gb|ACC43967.1|  82 kDa heat shock protein                               303   8e-95    
gb|ACF16064.1|  hsp82                                                   303   1e-94    
gb|ACC43956.1|  82 kDa heat shock protein                               303   1e-94    
gb|ADV59561.1|  heat shock protein 90                                   302   1e-94    
emb|CBI39793.3|  unnamed protein product                                284   2e-94    
gb|AEI70669.1|  heat shock protein 90 alpha-1                           286   2e-94    
gb|ACO58574.1|  heat shock protein 90                                   288   2e-94    
gb|ACC43981.1|  82 kDa heat shock protein                               302   3e-94    
ref|XP_004367478.1|  heat shock protein 90 alpha, putative              301   3e-94    
gb|AAI60441.1|  Unknown (protein for IMAGE:7558608)                     288   4e-94    
gb|ETW37559.1|  hsp90-like protein                                      285   4e-94    
pdb|2BSM|A  Chain A, Novel, Potent Small Molecule Inhibitors Of T...    286   5e-94    
pdb|2YI0|A  Chain A, Structural Characterization Of 5-Aryl-4-(5-S...    286   5e-94    
pdb|1UY6|A  Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trim...    286   5e-94    
gb|ACD88973.1|  hsp82                                                   301   5e-94    
gb|ACO58579.1|  heat shock protein 90                                   287   6e-94    
pdb|3HHU|A  Chain A, Human Heat-Shock Protein 90 (Hsp90) In Compl...    285   6e-94    
pdb|3D0B|A  Chain A, Crystal Structure Of Benzamide Tetrahydro-4h...    286   6e-94    
pdb|3QDD|A  Chain A, Hsp90a N-Terminal Domain In Complex With Bii...    286   6e-94    
gb|ACO58578.1|  heat shock protein 90                                   287   6e-94    
pdb|3INW|A  Chain A, Hsp90 N-Terminal Domain With Pochoxime A           285   6e-94    
ref|XP_002754345.2|  PREDICTED: heat shock protein HSP 90-alpha         286   6e-94    
pdb|1OSF|A  Chain A, Human Hsp90 In Complex With 17-desmethoxy-17...    285   6e-94    
pdb|3BM9|A  Chain A, Discovery Of Benzisoxazoles As Potent Inhibi...    285   6e-94    
pdb|3TUH|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    285   7e-94    
pdb|2JJC|A  Chain A, Hsp90 Alpha Atpase Domain With Bound Small M...    285   7e-94    
pdb|3B24|A  Chain A, Hsp90 Alpha N-terminal Domain In Complex Wit...    285   7e-94    
pdb|3R4M|A  Chain A, Optimization Of Potent, Selective, And Orall...    285   7e-94    
pdb|4EGH|A  Chain A, Hsp90-Alpha Atpase Domain In Complex With (4...    285   7e-94    
pdb|3EKO|A  Chain A, Dihydroxylphenyl Amides As Inhibitors Of The...    285   7e-94    
pdb|2QFO|A  Chain A, Hsp90 Complexed With A143571 And A516383           285   7e-94    
pdb|1UYI|A  Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benz...    285   8e-94    
pdb|4LWE|A  Chain A, Crystal Structure Of The Human Hsp90-alpha N...    285   9e-94    
pdb|3K98|A  Chain A, Hsp90 N-Terminal Domain In Complex With (1r)...    285   9e-94    
gb|AAI02619.1|  HSPCA protein                                           286   9e-94    
pdb|2YJW|A  Chain A, Tricyclic Series Of Hsp90 Inhibitors               285   9e-94    
pdb|4NH7|A  Chain A, Correlation Between Chemotype-dependent Bind...    285   9e-94    
pdb|4EEH|A  Chain A, Hsp90 Alpha N-Terminal Domain In Complex Wit...    285   1e-93    
pdb|4AWO|A  Chain A, Complex Of Hsp90 Atpase Domain With Tropane ...    285   1e-93    
pdb|2XDU|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    285   1e-93    
pdb|4B7P|A  Chain A, Structure Of Hsp90 With Nms-e973 Inhibitor B...    285   1e-93    
pdb|2FWY|A  Chain A, Structure Of Human Hsp90-Alpha Bound To The ...    286   1e-93    
pdb|2CCS|A  Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Y...    285   1e-93    
gb|AAI51819.1|  HSPCA protein                                           285   1e-93    
pdb|3FT5|A  Chain A, Structure Of Hsp90 Bound With A Novel Fragment     285   2e-93    
pdb|2YE2|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    285   2e-93    
pdb|3K97|A  Chain A, Hsp90 N-Terminal Domain In Complex With 4-Ch...    285   2e-93    
pdb|2YEE|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    285   2e-93    
pdb|2QF6|A  Chain A, Hsp90 Complexed With A56322                        283   2e-93    
pdb|2K5B|A  Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr       283   2e-93    
pdb|1BYQ|A  Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg            284   2e-93    
pdb|2YE7|A  Chain A, Hsp90 Inhibitors And Drugs From Fragment And...    285   2e-93    
gb|AEE01388.1|  heat shock protein 90                                   284   2e-93    
pdb|3K60|A  Chain A, Crystal Structure Of N-Terminal Domain Of Pl...    284   2e-93    
gb|ADQ64484.1|  hypothetical protein                                    284   3e-93    
dbj|BAC40681.1|  unnamed protein product                                285   3e-93    
gb|AAF01787.1|AF143849_1  82 kD heat shock protein 1                    286   4e-93    
pdb|2XJG|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    284   4e-93    
dbj|BAF75925.1|  heat shock protein 90                                  297   4e-93    
pdb|1YC1|A  Chain A, Crystal Structures Of Human Hsp90alpha Compl...    285   5e-93    
ref|XP_308799.3|  AGAP006959-PA                                         289   7e-93    
gb|AAF74276.1|AF250004_1  82 kDa heat shock protein 4                   285   7e-93    
gb|AJG42174.1|  heat shock protein 90                                   281   8e-93    
sp|O16087.1|HSP83_DROMI  RecName: Full=Heat shock protein 83; Alt...    284   1e-92    
ref|XP_308797.3|  AGAP006961-PA                                         287   1e-92    
gb|AAC07917.1|  82 kDa heat shock protein                               284   1e-92    
gb|AAF74274.1|AF250002_1  82 kDa heat shock protein 3                   285   1e-92    
emb|CAM34507.1|  putative heat shock protein 90                         280   1e-92    
emb|CAG32523.1|  hypothetical protein RCJMB04_28d6                      281   1e-92    
gb|AAF01789.1|  82 kD heat shock protein 1                              284   1e-92    
gb|AAL83217.1|AF473560_1  heat shock protein 90 alpha                   282   2e-92    
emb|CAA30255.1|  unnamed protein product                                285   2e-92    
emb|CDY11961.1|  BnaC03g13870D                                          286   2e-92    
gb|AAF74269.1|AF249997_1  82 kDa heat shock protein 2                   284   2e-92    
pdb|2XJJ|A  Chain A, Structure Of Hsp90 With Small Molecule Inhib...    282   2e-92    
gb|AAC07938.1|  82 kDa heat shock protein                               283   2e-92    
gb|AEX08891.1|  heat-shock protein 90                                   281   2e-92    
gb|ADQ20111.1|  heat shock protein 90                                   296   3e-92    
emb|CAG31600.1|  hypothetical protein RCJMB04_8j21                      281   3e-92    
gb|EGV94858.1|  Heat shock protein HSP 90-alpha                         285   3e-92    
gb|AAC07946.1|  82 kDa heat shock protein                               283   3e-92    
ref|XP_006408893.1|  hypothetical protein EUTSA_v10002229mg             295   3e-92    
emb|CAG31138.1|  hypothetical protein RCJMB04_2l3                       281   3e-92    
gb|AGT28483.1|  heat shock protein 90                                   296   4e-92    
gb|AEP39605.1|  heat shock protein 90                                   295   6e-92    
gb|AAC07919.1|  82 kDa heat shock protein                               282   7e-92    
gb|AAF74271.1|AF249999_1  82 kDa heat shock protein 3                   283   7e-92    
gb|AAC07939.1|  82 kDa heat shock protein                               282   7e-92    
gb|AAF01788.1|  82 kD heat shock protein 1                              283   7e-92    
gb|AAC07928.1|  82 kDa heat shock protein                               282   7e-92    
emb|CEJ04800.1|  Putative Heat shock protein 82                         295   8e-92    
gb|AAC07942.1|  82 kDa heat shock protein                               281   8e-92    
gb|AEV53616.1|  heat shock protein 90-beta                              278   9e-92    
emb|CCQ18614.1|  Molecular chaperone (HSP90 family)                     295   1e-91    
gb|AAC07921.1|  82 kDa heat shock protein                               281   1e-91    
gb|KCW82680.1|  hypothetical protein EUGRSUZ_C04059                     288   1e-91    
gb|AIL52741.1|  heat shock protein 90                                   295   1e-91    
emb|CEG72304.1|  Putative Heat shock protein 90                         294   1e-91    
dbj|BAK20463.1|  heat shock protein 90                                  282   1e-91    
gb|AAC07927.1|  82 kDa heat shock protein                               281   1e-91    
gb|AAC07914.1|  82 kDa heat shock protein                               281   1e-91    
gb|AAF74272.1|AF250000_1  82 kDa heat shock protein 2                   282   1e-91    
gb|AAC07936.1|  82 kDa heat shock protein                               281   1e-91    
gb|AEA42008.1|  heat shock protein 90                                   295   1e-91    
gb|AAC07915.1|  82 kDa heat shock protein                               281   2e-91    
gb|AAF74273.1|AF250001_1  82 kDa heat shock protein 3                   281   2e-91    
gb|AAA37868.1|  heat-shock protein hsp86                                283   2e-91    
gb|AAX10949.1|  heat shock protein 90                                   290   2e-91    
sp|P04811.1|HSP83_DROVI  RecName: Full=Heat shock protein 83; Alt...    284   2e-91    
gb|AAC07924.1|  82 kDa heat shock protein                               280   2e-91    
gb|AAF74270.1|AF249998_1  82 kDa heat shock protein 2                   281   3e-91    
ref|XP_007986070.1|  PREDICTED: heat shock protein HSP 90-alpha         284   3e-91    
gb|AAB46685.1|  heat shock protein 83                                   284   3e-91    
ref|XP_002021280.1|  Hsp83                                              283   3e-91    
gb|AAC32131.1|  heat shock protein                                      278   3e-91    
gb|AAB46677.1|  heat shock protein 83                                   283   4e-91    
gb|AAC07947.1|  82 kDa heat shock protein                               280   4e-91    
ref|XP_009029869.1|  hypothetical protein HELRODRAFT_158018             293   4e-91    
emb|CEG62768.1|  Putative Heat shock protein 90 homolog                 293   5e-91    
sp|P04810.1|HSP83_DROSI  RecName: Full=Heat shock protein 83; Alt...    283   5e-91    
gb|AAC07923.1|  82 kDa heat shock protein                               280   5e-91    
gb|AAC07935.1|  82 kDa heat shock protein                               280   6e-91    
gb|AAC07940.1|  82 kDa heat shock protein                               279   6e-91    
gb|ACZ97018.1|  heat shock protein 90                                   293   6e-91    
gb|AIU47029.1|  heat shock protein                                      284   7e-91    
ref|XP_005855339.1|  molecular chaperone HtpG                           292   7e-91    
ref|XP_001649752.1|  AAEL014843-PA                                      292   8e-91    
emb|CEI87928.1|  Putative Heat shock protein hsp90-like protein         292   8e-91    
ref|XP_961298.1|  heat shock protein 80                                 292   8e-91    
gb|EDM18741.1|  rCG43497, isoform CRA_b                                 277   8e-91    
gb|AAC07922.1|  82 kDa heat shock protein                               279   9e-91    
ref|XP_009847246.1|  hypothetical protein NEUTE1DRAFT_56764             292   9e-91    
gb|EWM29604.1|  heat shock protein 90                                   292   9e-91    
emb|CDJ58300.1|  hypothetical protein EMWEY_00014950                    285   1e-90    
gb|EIE88925.1|  heat shock protein 90-1                                 291   1e-90    
gb|EIE86519.1|  heat shock protein 90-1                                 291   1e-90    
gb|AAC07920.1|  82 kDa heat shock protein                               279   1e-90    
ref|XP_729157.1|  heat shock protein 81-2                               285   1e-90    
gb|ACQ90225.1|  heat shock protein 90-1                                 292   1e-90    
gb|AAQ97223.1|  Hsp82                                                   280   1e-90    
gb|AAA36024.1|  heat shock protein 86                                   280   1e-90    



>gb|AFK35835.1| unknown [Lotus japonicus]
Length=190

 Score =   345 bits (885),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL++IDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTLIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE+LGR TKITL+LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGESLGRRTKITLYLK  179



>gb|EEC84771.1| hypothetical protein OsI_31801 [Oryza sativa Indica Group]
Length=184

 Score =   344 bits (883),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>gb|ADU04386.1| heat shock protein 90-1 [Nicotiana attenuata]
Length=699

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|ADX06844.1| molecular chaperone Hsp90 [Nicotiana tabacum]
Length=699

 Score =   361 bits (926),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_009785111.1| PREDICTED: heat shock cognate protein 80 [Nicotiana sylvestris]
Length=699

 Score =   360 bits (925),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|KJB81564.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=587

 Score =   357 bits (916),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_009591410.1| PREDICTED: heat shock cognate protein 80 [Nicotiana tomentosiformis]
 dbj|BAE97400.1| heat shock protein 90 [Nicotiana tabacum]
 dbj|BAM24708.1| Heat shock protein 90 [Nicotiana tabacum]
Length=699

 Score =   360 bits (925),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|AAS79798.1| heat shock protein 90 [Nicotiana tabacum]
Length=699

 Score =   360 bits (923),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKE+FLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEVFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|EEC83017.1| hypothetical protein OsI_28083 [Oryza sativa Indica Group]
Length=184

 Score =   342 bits (877),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLII TFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIIKTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>gb|AAR12193.1| molecular chaperone Hsp90-1 [Nicotiana benthamiana]
Length=699

 Score =   359 bits (922),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSG+NLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGDNLGRGTKITLFLK  179



>gb|AGA62462.1| heat shock protein 90 [Gossypium hirsutum]
Length=699

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEN+GRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENIGRGTKITLFLK  179



>ref|XP_011089536.1| PREDICTED: heat shock cognate protein 80 [Sesamum indicum]
Length=699

 Score =   358 bits (920),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/179 (97%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|AEC11021.1| heat shock protein 90, partial [Camellia sinensis]
Length=240

 Score =   342 bits (878),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIV +KHNDDEQYVWESQAGGSFTVTRDT+ E+LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVVSKHNDDEQYVWESQAGGSFTVTRDTTDESLGRGTKMTLYLK  179



>ref|XP_011097724.1| PREDICTED: heat shock cognate protein 80-like [Sesamum indicum]
Length=699

 Score =   358 bits (918),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>dbj|BAD95030.1| heat-shock protein [Arabidopsis thaliana]
Length=246

 Score =   342 bits (878),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK+N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  179



>gb|KJB22184.1| hypothetical protein B456_004G033900 [Gossypium raimondii]
Length=699

 Score =   357 bits (917),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|KJB81563.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=684

 Score =   357 bits (916),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|KJB81562.1| hypothetical protein B456_013G150300 [Gossypium raimondii]
Length=699

 Score =   357 bits (916),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|AAR12194.1| molecular chaperone Hsp90-2 [Nicotiana benthamiana]
Length=699

 Score =   357 bits (915),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>emb|CBI25731.3| unnamed protein product [Vitis vinifera]
Length=579

 Score =   353 bits (905),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLK  179



>ref|XP_010539340.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   356 bits (913),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLHLK  179



>ref|XP_004169769.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like, 
partial [Cucumis sativus]
Length=587

 Score =   353 bits (905),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLK  179



>gb|KJB22185.1| hypothetical protein B456_004G034000 [Gossypium raimondii]
Length=666

 Score =   355 bits (910),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_009758556.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLYLK  179



>ref|XP_009594054.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   355 bits (911),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLYLK  179



>gb|ADU04387.1| heat shock protein 90-2 [Nicotiana attenuata]
Length=699

 Score =   355 bits (910),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_009607645.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana tomentosiformis]
Length=699

 Score =   354 bits (909),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|KGN66052.1| hypothetical protein Csa_1G569290 [Cucumis sativus]
Length=631

 Score =   352 bits (904),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLK  179



>gb|KHN43913.1| Heat shock cognate protein 80 [Glycine soja]
Length=494

 Score =   348 bits (893),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA+KVIVTTKHNDDEQYVWES AGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGRGTKITLFLK  180



>gb|ACR35758.1| unknown [Zea mays]
 gb|ACR36747.1| unknown [Zea mays]
 tpg|DAA47843.1| TPA: putative heat shock protein 90 family protein isoform 1 
[Zea mays]
 tpg|DAA47844.1| TPA: putative heat shock protein 90 family protein isoform 2 
[Zea mays]
Length=351

 Score =   343 bits (880),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLK  180



>gb|AAN61003.1| putative heat shock protein 90 [Arabidopsis thaliana]
 gb|AAN64168.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=526

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>dbj|BAG16518.1| putative Hsp90-2 [Capsicum chinense]
Length=699

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD+ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADSETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+I+DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKI LFLK
Sbjct  121  FGVGFYSAYLVAEKVLVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKIVLFLK  179



>gb|KDP32613.1| hypothetical protein JCGZ_13163 [Jatropha curcas]
Length=699

 Score =   354 bits (908),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGENLGRGTKITLFLK  179



>ref|NP_001234436.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
 gb|AAR12195.1| molecular chaperone Hsp90-1 [Solanum lycopersicum]
Length=699

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLFLK  179



>gb|KHG19401.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEKLGRGTKITLFLK  179



>gb|AAK91366.1| AT5g56010/MDA7_5 [Arabidopsis thaliana]
Length=527

 Score =   348 bits (893),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>emb|CBI34381.3| unnamed protein product [Vitis vinifera]
Length=320

 Score =   341 bits (874),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD +GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVNGEQLGRGTKITLFLK  179



>emb|CAN62488.1| hypothetical protein VITISV_029391 [Vitis vinifera]
Length=699

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLK  179



>gb|EAZ43234.1| hypothetical protein OsJ_27834 [Oryza sativa Japonica Group]
Length=423

 Score =   344 bits (883),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>gb|KHG22758.1| Heat shock cognate 80 [Gossypium arboreum]
Length=699

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDT+GE++GRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTTGESIGRGTKITLFLK  179



>ref|XP_004135593.1| PREDICTED: heat shock cognate protein 80-like [Cucumis sativus]
Length=699

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLK  179



>ref|XP_003635036.1| PREDICTED: heat shock cognate protein 80 [Vitis vinifera]
Length=699

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLK  179



>ref|XP_009763345.1| PREDICTED: heat shock cognate protein 80-like [Nicotiana sylvestris]
Length=699

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|KGN66050.1| hypothetical protein Csa_1G569270 [Cucumis sativus]
Length=699

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANGTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLK  179



>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 
Domain
 pdb|2XCM|B Chain B, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 
Domain
Length=214

 Score =   337 bits (863),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/180 (89%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  75   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  254
            A  + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct  4    AATETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  63

Query  255  QPELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  434
            QPELFIHI+PDK  ++L+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIG
Sbjct  64   QPELFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIG  123

Query  435  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            QFGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  124  QFGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLK  183



>gb|ACX31585.1| molecular chaperone Hsp90-3 [Nicotiana benthamiana]
Length=700

 Score =   352 bits (904),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQ LSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD+Q
Sbjct  1    MAEAETFAFQAEINQQLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_010910639.1| PREDICTED: heat shock protein 81-1, partial [Elaeis guineensis]
Length=565

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEKLGRGTKITLFLK  180



>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
 pdb|2JKI|B Chain B, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
 pdb|2JKI|C Chain C, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain
Length=223

 Score =   336 bits (862),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +3

Query  84   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  263
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  10   ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  69

Query  264  LFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  443
            LFIHI+PDK  ++L+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  70   LFIHIIPDKATSTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  129

Query  444  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  130  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMVLYLK  186



>ref|XP_010252844.1| PREDICTED: heat shock cognate protein 80-like [Nelumbo nucifera]
Length=699

 Score =   352 bits (903),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN++SIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTISIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE+LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGESLGRGTKITLFLK  179



>ref|NP_001274833.1| Hsp90-2-like [Solanum tuberosum]
 gb|ABB55365.1| Hsp90-2-like [Solanum tuberosum]
Length=700

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MSDIETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMVLYLK  179



>ref|XP_006287183.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
 gb|EOA20081.1| hypothetical protein CARUB_v10000353mg [Capsella rubella]
Length=699

 Score =   352 bits (902),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  179



>ref|XP_006857538.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
 gb|ERN19005.1| hypothetical protein AMTR_s00061p00036160 [Amborella trichopoda]
Length=699

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDK +N+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKASNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD+SGE+LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDSSGESLGRGTKITLFLK  179



>ref|XP_010246543.1| PREDICTED: heat shock cognate protein 80 [Nelumbo nucifera]
Length=699

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEDLGRGTKITLFLK  179



>ref|XP_010443242.1| PREDICTED: heat shock protein 90-2 [Camelina sativa]
Length=699

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMTLYLK  179



>emb|CDP13679.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PE FIHI+PDKTNN+LSI+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PEFFIHIIPDKTNNTLSIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGENLGRGTK+TLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDASGENLGRGTKMTLFLK  179



>gb|ABW96308.1| heat shock protein 90 [Vitis pseudoreticulata]
Length=699

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT KHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTAKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLYLK  179



>ref|XP_010552350.1| PREDICTED: heat shock protein 90-2 [Tarenaya hassleriana]
Length=699

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRIVPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TLFLK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLFLK  179



>ref|XP_010450563.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  179



>ref|XP_006280101.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
 gb|EOA12999.1| hypothetical protein CARUB_v10025990mg [Capsella rubella]
Length=699

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  179



>ref|XP_011030250.1| PREDICTED: heat shock protein 81-1-like [Populus euphratica]
Length=706

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>gb|KJB13949.1| hypothetical protein B456_002G103000 [Gossypium raimondii]
Length=699

 Score =   351 bits (900),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQ+VWESQAGGSFTVTRDT+GE++GRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQFVWESQAGGSFTVTRDTTGESIGRGTKITLFLK  179



>ref|XP_009126978.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=696

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+I+DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLHLK  179



>ref|XP_006344905.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFQSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTV RDTSGE+LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEDLGRGTKITLFLK  179



>gb|KHN31689.1| Heat shock cognate protein 80 [Glycine soja]
Length=700

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+I+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKITLFLK  179



>gb|KFK40163.1| hypothetical protein AALP_AA3G338900 [Arabis alpina]
Length=701

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDMETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK+NN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMTLYLK  179



>gb|ADC45395.1| HSP90-1 [Glycine max]
Length=702

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNNSL+I+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNSLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKITLFLK  179



>gb|EPS61618.1| hypothetical protein M569_13176 [Genlisea aurea]
Length=701

 Score =   350 bits (899),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 171/179 (96%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKITLHLK  179



>ref|XP_010675973.1| PREDICTED: heat shock cognate protein 80 [Beta vulgaris subsp. 
vulgaris]
Length=698

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKL+AQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLEAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNNSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEPLGRGTKMTLYLK  179



>gb|ABX76302.1| heat shock protein 90 [Ageratina adenophora]
Length=697

 Score =   350 bits (898),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNALTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMTLYLK  179



>gb|EYU33725.1| hypothetical protein MIMGU_mgv1a002215mg [Erythranthe guttata]
Length=700

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL++Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLESQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  179



>ref|XP_002273244.1| PREDICTED: heat shock cognate protein 80-like [Vitis vinifera]
Length=704

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            P+LFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGERLGRGTKITLHLK  179



>ref|XP_011039800.1| PREDICTED: heat shock protein 90-2 [Populus euphratica]
Length=699

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKT+N+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKI L+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKIVLYLK  179



>ref|XP_010928158.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=702

 Score =   349 bits (896),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 176/178 (99%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKGSNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>ref|XP_007020406.1| Heat shock protein 81.4 [Theobroma cacao]
 gb|EOY11931.1| Heat shock protein 81.4 [Theobroma cacao]
Length=699

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNNSLSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDDAGEKLGRGTKITLFLK  179



>ref|XP_006401391.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
 dbj|BAJ33984.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42844.1| hypothetical protein EUTSA_v10012832mg [Eutrema salsugineum]
Length=699

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+I+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+TL LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMTLHLK  179



>ref|XP_010483071.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   349 bits (896),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVT+DTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGRGTKMTLYLK  179



>ref|XP_008811147.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=701

 Score =   349 bits (896),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 169/178 (95%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>ref|XP_002300303.1| HSP80 family protein [Populus trichocarpa]
 gb|EEE85108.1| HSP80 family protein [Populus trichocarpa]
Length=706

 Score =   349 bits (896),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_010483070.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   349 bits (895),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVT+DTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGRGTKMTLYLK  179



>ref|XP_003544594.1| PREDICTED: heat shock cognate protein 80-like [Glycine max]
Length=700

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA+KVIVTTKHNDDEQYVWES AGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGRGTKITLFLK  180



>ref|XP_006280103.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
 gb|EOA13001.1| hypothetical protein CARUB_v10025991mg [Capsella rubella]
Length=699

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            P+LFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  179



>ref|NP_200414.1| heat shock protein 81-2 [Arabidopsis thaliana]
 sp|P55737.1|HS902_ARATH RecName: Full=Heat shock protein 90-2; Short=AtHSP90.2; AltName: 
Full=Heat shock protein 81-2; Short=HSP81-2; AltName: Full=Protein 
EARLY-RESPONSIVE TO DEHYDRATION 8; AltName: Full=Protein 
LOSS OF RECOGNITION OF AVRRPM1 2 [Arabidopsis thaliana]
 dbj|BAB09285.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAL32828.1| HEAT SHOCK PROTEIN 81-2 (HSP81-2) [Arabidopsis thaliana]
 gb|AAM91205.1| heat shock protein 81-2 [Arabidopsis thaliana]
 gb|AAN71943.1| putative heat-shock protein HSP81-2 [Arabidopsis thaliana]
 gb|AAO00895.1| Unknown protein [Arabidopsis thaliana]
 gb|AED96711.1| heat shock protein 81-2 [Arabidopsis thaliana]
 prf||1908431B heat shock protein HSP81-2
Length=699

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMVLYLK  179



>ref|NP_001236599.1| heat shock protein 90-2 [Glycine max]
 gb|ACI31551.1| heat shock protein 90-2 [Glycine max]
Length=700

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA+KVIVTTKHNDDEQYVWES AGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVADKVIVTTKHNDDEQYVWESHAGGSFTVTRDTSGENLGRGTKITLFLK  180



>gb|AAN31859.1| putative heat shock protein 81-2 (HSP81-2) [Arabidopsis thaliana]
Length=699

 Score =   349 bits (895),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGETLGRGTKMVLYLK  179



>dbj|BAE71229.1| putative HEAT SHOCK PROTEIN 81-2 [Trifolium pratense]
Length=478

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARS TKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSATKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLILK  179



>ref|XP_010103960.1| Heat shock cognate protein 80 [Morus notabilis]
 gb|EXB97663.1| Heat shock cognate protein 80 [Morus notabilis]
Length=732

 Score =   350 bits (897),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEILGRGTKITLHLK  179



>gb|KEH26332.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK NN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKITLFLK  179



>ref|XP_010443241.1| PREDICTED: heat shock protein 90-3-like [Camelina sativa]
Length=699

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELF+HI+PDKTNN+L+IID GVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFVHIIPDKTNNTLTIIDRGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  179



>gb|AAB33937.1| heat-shock Protein [Arabidopsis thaliana]
Length=699

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>ref|NP_001234439.1| heat shock cognate protein 80 [Solanum lycopersicum]
 sp|P36181.1|HSP80_SOLLC RecName: Full=Heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAB01376.1| heat shock cognate protein 80 [Solanum lycopersicum]
 gb|AAR12196.1| molecular chaperone Hsp90-2 [Solanum lycopersicum]
 prf||1909348A heat shock protein hsp80
Length=699

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKMVLYLK  179



>ref|NP_200412.1| Heat shock protein 90-3 [Arabidopsis thaliana]
 sp|P51818.2|HS903_ARATH RecName: Full=Heat shock protein 90-3; Short=AtHSP90.3; AltName: 
Full=HSP81.2; AltName: Full=Heat shock protein 81-3; Short=HSP81-3 
[Arabidopsis thaliana]
 dbj|BAB09283.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL32910.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AAL91191.1| heat shock protein 90 [Arabidopsis thaliana]
 gb|AED96709.1| heat shock protein 81-3 [Arabidopsis thaliana]
Length=699

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>gb|KFK27172.1| hypothetical protein AALP_AA8G344900 [Arabis alpina]
Length=699

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>ref|XP_010913224.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>gb|AAL49788.1| putative heat shock protein 90 [Arabidopsis thaliana]
Length=699

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>ref|XP_002866122.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42381.1| heat shock protein 81-4 [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>emb|CBI22652.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_009391803.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=699

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDK  N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD SGE+LGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGESLGRGTKITLFLK  180



>ref|XP_008234835.1| PREDICTED: heat shock protein 83 [Prunus mume]
Length=703

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|NP_200411.1| Heat shock protein 90-4 [Arabidopsis thaliana]
 sp|O03986.1|HS904_ARATH RecName: Full=Heat shock protein 90-4; Short=AtHSP90.4; AltName: 
Full=Heat shock protein 81-4; Short=HSP81-4 [Arabidopsis 
thaliana]
 emb|CAA72514.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAB09282.1| heat shock protein [Arabidopsis thaliana]
 dbj|BAE99287.1| heat shock protein [Arabidopsis thaliana]
 gb|AED96708.1| Heat shock protein 90-4 [Arabidopsis thaliana]
Length=699

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMILYLK  179



>ref|XP_010537148.1| PREDICTED: heat shock protein 83 [Tarenaya hassleriana]
Length=702

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>gb|AEK20869.1| heat shock protein 90-2 [Cryptocoryne ciliata]
Length=700

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NNSLS IDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNSLSTIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRDTSGENLGRGTK+TLFLK
Sbjct  123  GVGFYSAYLVAEKVIVTSKHNDDEQYIWESQAGGSFTVTRDTSGENLGRGTKMTLFLK  180



>ref|XP_008776162.1| PREDICTED: heat shock protein 81-1 [Phoenix dactylifera]
Length=700

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>ref|XP_008439282.1| PREDICTED: heat shock protein 83 [Cucumis melo]
Length=703

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|XP_004234218.1| PREDICTED: heat shock protein 83 [Solanum lycopersicum]
Length=704

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEQLGRGTKITLFLK  184



>ref|XP_007220219.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
 gb|EMJ21418.1| hypothetical protein PRUPE_ppa002187mg [Prunus persica]
Length=703

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|XP_002299048.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
 gb|EEE83853.1| hypothetical protein POPTR_0001s47020g [Populus trichocarpa]
Length=699

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHIVPDKT+N+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIVPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTV RDTSGE LGRGTKI L+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVIRDTSGEPLGRGTKIVLYLK  179



>ref|XP_007152171.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
 gb|ESW24165.1| hypothetical protein PHAVU_004G107700g [Phaseolus vulgaris]
Length=700

 Score =   347 bits (891),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPD+ N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDQANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTDGEQLGRGTKITLFLK  179



>ref|XP_009768512.1| PREDICTED: heat shock protein 82 [Nicotiana sylvestris]
Length=703

 Score =   347 bits (891),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEQLGRGTKITLFLK  184



>ref|XP_006352548.1| PREDICTED: heat shock cognate protein 80-like [Solanum tuberosum]
Length=699

 Score =   347 bits (891),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTV RDTSGE+LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVARDTSGESLGRGTKMILYLK  179



>ref|XP_004491531.1| PREDICTED: heat shock cognate protein 80-like isoform X2 [Cicer 
arietinum]
Length=660

 Score =   346 bits (887),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLILK  179



>tpg|DAA61990.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=629

 Score =   345 bits (885),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  84   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  263
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  264  LFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  443
            LFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  444  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLK  180



>ref|NP_001240230.1| uncharacterized protein LOC100819568 [Glycine max]
 gb|ADC45396.1| HSP90-2 [Glycine max]
 gb|KHN01774.1| Heat shock cognate protein 80 [Glycine soja]
Length=699

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+I+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGRGTKITLYLK  179



>gb|AGU99972.1| HSP90 [Populus tomentosa]
Length=699

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKT+N+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTSNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKI L+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDNSGEPLGRGTKIVLYLK  179



>ref|XP_002307846.1| HSP80 family protein [Populus trichocarpa]
 gb|ABK95597.1| unknown [Populus trichocarpa]
 gb|EEE91369.1| HSP80 family protein [Populus trichocarpa]
Length=699

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NNSL+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYS+YLVA+KV+VT+KHNDDEQYVWESQAGGSFTVTRDTSGENLGRG+KITLFLK
Sbjct  121  FGVGFYSSYLVADKVVVTSKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGSKITLFLK  179



>ref|XP_011005759.1| PREDICTED: heat shock cognate protein 80-like [Populus euphratica]
Length=699

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NNSL+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYS+YLVA+KV+VT+KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSSYLVADKVVVTSKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  179



>ref|XP_002532177.1| heat shock protein, putative [Ricinus communis]
 gb|EEF30214.1| heat shock protein, putative [Ricinus communis]
Length=698

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 170/179 (95%), Positives = 175/179 (98%), Gaps = 1/179 (1%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRD SGENLGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRD-SGENLGRGTKITLHLK  178



>ref|XP_009417329.1| PREDICTED: heat shock protein 81-1 [Musa acuminata subsp. malaccensis]
Length=699

 Score =   347 bits (889),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK  N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLFLK  180



>ref|XP_010047845.1| PREDICTED: LOW QUALITY PROTEIN: heat shock cognate protein 80-like 
[Eucalyptus grandis]
Length=702

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLREL+SN+SDALDKIRFESLTDK+KLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELVSNASDALDKIRFESLTDKTKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +NSL+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNSLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FG GFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITL+LK
Sbjct  121  FGXGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLYLK  179



>ref|XP_011040123.1| PREDICTED: heat shock protein 81-1 [Populus euphratica]
Length=698

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK  N+L+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKVTNTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VT+KHNDDEQYVWESQAGGSFT+TRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVADKVVVTSKHNDDEQYVWESQAGGSFTITRDTSGENLGRGTKITLFLK  179



>gb|AHB36893.1| heat shock protein 90 [Matricaria chamomilla var. recutita]
Length=698

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNS DALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSFDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+I+DSGVGMTKADLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIVDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMTLYLK  179



>ref|XP_010536759.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
 ref|XP_010536760.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   347 bits (889),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEILGRGTKITLHLK  179



>ref|XP_002460433.1| hypothetical protein SORBIDRAFT_02g028050 [Sorghum bicolor]
 gb|EER96954.1| hypothetical protein SORBIDRAFT_02g028050 [Sorghum bicolor]
Length=699

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  84   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  263
            D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    DTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  264  LFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  443
            LFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  444  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLK  180



>ref|XP_003533977.1| PREDICTED: heat shock protein 83-like [Glycine max]
 gb|KHN42443.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKDNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKITLFLK  179



>ref|XP_002869603.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45862.1| early-responsive to dehydration 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=700

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  179



>ref|NP_001236612.1| heat shock protein 90-1 [Glycine max]
 gb|ACI31552.1| heat shock protein 90-1 [Glycine max]
Length=702

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+I+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDNTGEVLGRGTKITLYLK  179



>ref|XP_006373573.1| HSP80 family protein [Populus trichocarpa]
 gb|ERP51370.1| HSP80 family protein [Populus trichocarpa]
Length=698

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 176/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRF+SLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFDSLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK  N+L+I+DSG+GMTK+DLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKATNTLTIVDSGIGMTKSDLVNNLGTIARSGTKEFMEAVTAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VT+KHNDDEQYVWESQAGGSFT+TRDTSGENLGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVADKVVVTSKHNDDEQYVWESQAGGSFTITRDTSGENLGRGTKITLFLK  179



>ref|XP_011076104.1| PREDICTED: heat shock protein 83 [Sesamum indicum]
Length=698

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  179



>ref|XP_009132345.1| PREDICTED: heat shock protein 90-2 [Brassica rapa]
Length=699

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINT YSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTLYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHLK  179



>gb|EYU31897.1| hypothetical protein MIMGU_mgv1a002208mg [Erythranthe guttata]
Length=701

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK+KLD+Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKAKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL+AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALSAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYL AEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTS E LGRG+KITL+LK
Sbjct  121  FGVGFYSAYLAAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSDETLGRGSKITLYLK  179



>ref|XP_002513649.1| heat shock protein, putative [Ricinus communis]
 gb|EEF49052.1| heat shock protein, putative [Ricinus communis]
Length=703

 Score =   346 bits (888),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|XP_010913223.1| PREDICTED: heat shock protein 81-1-like [Elaeis guineensis]
Length=700

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDK +++LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKASSTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>ref|XP_009383207.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK  N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA++V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLK
Sbjct  123  GVGFYSAYLVADRVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLFLK  180



>gb|KHN09298.1| Heat shock protein 83 [Glycine soja]
Length=699

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTK+TLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKMTLFLK  179



>ref|XP_009368732.1| PREDICTED: heat shock protein 83 [Pyrus x bretschneideri]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLK  184



>gb|KDP22224.1| hypothetical protein JCGZ_26055 [Jatropha curcas]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSI+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSILDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLK  184



>ref|XP_010671625.1| PREDICTED: heat shock protein 83 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT+GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTTGEQLGRGTKITLFLK  184



>ref|XP_004491530.1| PREDICTED: heat shock cognate protein 80-like isoform X1 [Cicer 
arietinum]
Length=699

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLILK  179



>ref|XP_002305263.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
 gb|EEE85774.1| hypothetical protein POPTR_0004s07190g [Populus trichocarpa]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDKTNN+LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>gb|KFK29176.1| hypothetical protein AALP_AA7G099100 [Arabis alpina]
Length=700

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK+NN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVVVITKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  179



>ref|XP_002462554.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
 gb|EER99075.1| hypothetical protein SORBIDRAFT_02g028020 [Sorghum bicolor]
Length=699

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  84   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  263
            D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    DTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  264  LFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  443
            LFIH+VPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHLVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  444  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLK  180



>ref|XP_010483069.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 90-3-like 
[Camelina sativa]
Length=699

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTF SNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFXSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVT+DTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTKDTSGEPLGRGTKMTLYLK  179



>ref|XP_009607669.1| PREDICTED: heat shock protein 82 [Nicotiana tomentosiformis]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|XP_004140753.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 ref|XP_004157188.1| PREDICTED: heat shock protein 83-like [Cucumis sativus]
 gb|KGN57413.1| hypothetical protein Csa_3G183950 [Cucumis sativus]
Length=703

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|XP_006362664.1| PREDICTED: heat shock protein 83-like [Solanum tuberosum]
Length=704

 Score =   346 bits (887),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>dbj|BAD04054.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|EAZ09522.1| hypothetical protein OsI_31797 [Oryza sativa Indica Group]
Length=699

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>ref|NP_001063500.1| Os09g0482100 [Oryza sativa Japonica Group]
 sp|Q69QQ6.1|HSP82_ORYSJ RecName: Full=Heat shock protein 81-2; Short=HSP81-2; AltName: 
Full=Heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD33406.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25414.1| Os09g0482100 [Oryza sativa Japonica Group]
Length=699

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>ref|XP_006659612.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=686

 Score =   345 bits (885),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+VIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>ref|XP_009390627.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=700

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    AETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDK  N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKATNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA++V+VT+KHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVADRVVVTSKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>ref|NP_001063503.1| Os09g0482400 [Oryza sativa Japonica Group]
 ref|NP_001175894.1| Os09g0482610 [Oryza sativa Japonica Group]
 sp|Q07078.2|HSP83_ORYSJ RecName: Full=Heat shock protein 81-3; Short=HSP81-3; AltName: 
Full=Gravity-specific protein GSC 381 [Oryza sativa Japonica 
Group]
 dbj|BAD33409.1| putative heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAF25417.1| Os09g0482400 [Oryza sativa Japonica Group]
 gb|ACJ54894.1| heat shock protein [Oryza sativa Japonica Group]
 dbj|BAG88166.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH01431.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94622.1| Os09g0482610 [Oryza sativa Japonica Group]
Length=699

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>emb|CDP05141.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTSGEQLGRGTKITLFLK  184



>ref|NP_001275844.1| HSP90 protein [Citrus sinensis]
 gb|AFF58924.1| Hsp90 [Citrus sinensis]
Length=700

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  123  GVGFYSAYLVAEKVIVTAKHNDDEQYIWESQAGGSFTVTRDTSGEPLGRGTKITLHLK  180



>ref|XP_006452664.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|AFF58923.1| Hsp90 [Citrus sinensis]
 gb|ESR65904.1| hypothetical protein CICLE_v10007633mg [Citrus clementina]
 gb|KDO59214.1| hypothetical protein CISIN_1g045760mg [Citrus sinensis]
Length=700

 Score =   345 bits (886),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNNSLSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNSLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVT KHNDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  123  GVGFYSAYLVAEKVIVTAKHNDDEQYIWESQAGGSFTVTRDTSGELLGRGTKITLHLK  180



>ref|XP_006599549.1| PREDICTED: heat shock protein 83-like [Glycine max]
Length=699

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LS+IDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSVIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTK+TLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKMTLFLK  179



>ref|XP_009420064.1| PREDICTED: heat shock protein 81-1-like [Musa acuminata subsp. 
malaccensis]
Length=698

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  84   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  263
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  264  LFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  443
            LFIHIVPDK  N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  444  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTKITLFLK
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKITLFLK  180



>ref|XP_004516872.1| PREDICTED: heat shock protein 83-like [Cicer arietinum]
Length=699

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADGETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTDGEQLGRGTKITLFLK  179



>ref|XP_008652859.1| PREDICTED: heat shock protein 81-1 [Zea mays]
 tpg|DAA61991.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 166/177 (94%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = +3

Query  84   DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  263
            + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE
Sbjct  4    ETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQPE  63

Query  264  LFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQFG  443
            LFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQFG
Sbjct  64   LFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQFG  123

Query  444  VGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            VGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  124  VGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLK  180



>ref|XP_006413166.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
 gb|ESQ54619.1| hypothetical protein EUTSA_v10024564mg [Eutrema salsugineum]
Length=700

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK+NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  179



>gb|EYU19581.1| hypothetical protein MIMGU_mgv1a002166mg [Erythranthe guttata]
Length=706

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDDDGEQLGRGTKITLFLK  184



>ref|XP_006372391.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
 gb|ERP50188.1| hypothetical protein POPTR_0017s01160g [Populus trichocarpa]
Length=703

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDKTNN+LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LK
Sbjct  126  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLYLK  184



>ref|XP_010060433.1| PREDICTED: heat shock protein 83-like [Eucalyptus grandis]
 gb|KCW90632.1| hypothetical protein EUGRSUZ_A02734 [Eucalyptus grandis]
Length=704

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+E LTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYEGLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDKTN +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLK  184



>ref|XP_002864186.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40445.1| heat shock protein 81-1 [Arabidopsis lyrata subsp. lyrata]
Length=705

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>dbj|BAJ34368.1| unnamed protein product [Thellungiella halophila]
Length=705

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>emb|CDY27839.1| BnaC09g28660D [Brassica napus]
Length=705

 Score =   345 bits (885),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>ref|XP_007142446.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
 gb|ESW14440.1| hypothetical protein PHAVU_008G281300g [Phaseolus vulgaris]
Length=699

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MSETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFTVTRDT GE+LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTVTRDTDGESLGRGTKMTLYLK  179



>gb|AGC60019.1| heat shock protein 90 [Saccharum hybrid cultivar SP80-3280]
Length=698

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKVTLYLK  180



>sp|P27323.3|HS901_ARATH RecName: Full=Heat shock protein 90-1; Short=AtHSP90.1; AltName: 
Full=Heat shock protein 81-1; Short=HSP81-1; AltName: Full=Heat 
shock protein 83 [Arabidopsis thaliana]
Length=700

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK+N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  179



>ref|NP_200076.1| heat shock protein 90.1 [Arabidopsis thaliana]
 dbj|BAA98082.1| heat-shock protein [Arabidopsis thaliana]
 gb|AAM91104.1| AT5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AAN46890.1| At5g52640/F6N7_13 [Arabidopsis thaliana]
 gb|AED96244.1| heat shock protein 90.1 [Arabidopsis thaliana]
Length=705

 Score =   345 bits (884),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK+N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>ref|XP_008355028.1| PREDICTED: heat shock protein 90-2 [Malus domestica]
Length=694

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL+AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALSAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLHLK  179



>ref|XP_006280097.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
 gb|EOA12995.1| hypothetical protein CARUB_v10025984mg [Capsella rubella]
Length=705

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>ref|XP_003617873.1| Heat shock protein [Medicago truncatula]
 ref|XP_003617876.1| Heat shock protein [Medicago truncatula]
 gb|AET00832.1| heat shock protein 81-2 [Medicago truncatula]
 gb|AET00835.1| heat shock protein 81-2 [Medicago truncatula]
Length=699

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD+Q
Sbjct  1    MAEQETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEA+ AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEAIAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEALGRGTKITLILK  179



>ref|XP_004240717.1| PREDICTED: heat shock protein 83-like [Solanum lycopersicum]
Length=704

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGRGTKITLFLK  184



>ref|XP_008811143.1| PREDICTED: heat shock protein 81-1-like [Phoenix dactylifera]
Length=700

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
             + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  3    GETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +NSLSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNSLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VTTK+NDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK
Sbjct  123  GVGFYSAYLVAEKVVVTTKNNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  180



>prf||1908431A heat shock protein HSP81-1
Length=705

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK+N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>gb|KFK26865.1| hypothetical protein AALP_AA8G303900 [Arabis alpina]
Length=705

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>dbj|BAA00615.1| 81kDa heat-shock protein [Arabidopsis thaliana]
Length=700

 Score =   345 bits (884),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK+N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKSNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  179



>gb|AFQ94045.1| heat shock protein 90 [Lactuca sativa]
Length=698

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MGDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEA+TAGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  179



>sp|A2YWQ1.1|HSP81_ORYSI RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Indica Group]
 sp|Q0J4P2.2|HSP81_ORYSJ RecName: Full=Heat shock protein 81-1; Short=HSP81-1; AltName: 
Full=Heat shock protein 82 [Oryza sativa Japonica Group]
 emb|CAA77978.1| heat shock protein 82 (HSP82) [Oryza sativa]
 dbj|BAD08818.1| heat shock protein 82 [Oryza sativa Japonica Group]
 dbj|BAD08897.1| heat shock protein 82 [Oryza sativa Japonica Group]
 gb|EAZ07512.1| hypothetical protein OsI_29768 [Oryza sativa Indica Group]
 gb|ADM86854.1| 82kDa heat shock protein [Oryza sativa Japonica Group]
Length=699

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>ref|XP_010442803.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=705

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>ref|XP_011046024.1| PREDICTED: heat shock protein 83 [Populus euphratica]
Length=703

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDKTNN+LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LK
Sbjct  126  FGVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEQLGRGTKITLYLK  184



>ref|XP_006659552.1| PREDICTED: heat shock protein 81-1-like isoform X2 [Oryza brachyantha]
Length=699

 Score =   344 bits (883),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>ref|XP_010482633.1| PREDICTED: heat shock protein 90-1 [Camelina sativa]
Length=705

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRMVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKITLFLK  184



>ref|XP_006439485.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
 gb|ESR52725.1| hypothetical protein CICLE_v10019095mg [Citrus clementina]
Length=702

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKALSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_009132299.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=699

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIIN FYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINPFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHLK  179



>ref|XP_006659553.1| PREDICTED: heat shock protein 81-1-like [Oryza brachyantha]
Length=699

 Score =   344 bits (883),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  180



>ref|XP_002444804.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
 gb|EES14299.1| hypothetical protein SORBIDRAFT_07g028270 [Sorghum bicolor]
Length=698

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLK  180



>ref|XP_002274022.1| PREDICTED: heat shock protein 83-like [Vitis vinifera]
Length=704

 Score =   344 bits (883),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_009375529.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   344 bits (883),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MHDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKITLFLK  184



>ref|XP_004500151.1| PREDICTED: heat shock cognate protein 80-like [Cicer arietinum]
Length=699

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+I+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIVDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQYVWESQAGGSFT+TRDTSGE LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVAEKVIVTSKHNDDEQYVWESQAGGSFTITRDTSGEILGRGTKITLYLK  179



>sp|P51819.1|HSP83_IPONI RecName: Full=Heat shock protein 83 [Ipomoea nil]
 gb|AAA33748.1| heat shock protein 83 [Ipomoea nil]
 prf||1909372A heat shock protein 83
Length=703

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDKTN +LSIIDSGVGM KADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNKTLSIIDSGVGMAKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVDGEQLGRGTKITLFLK  184



>ref|XP_002278894.1| PREDICTED: heat shock protein 83 [Vitis vinifera]
Length=703

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  75   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  254
            AM +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDA
Sbjct  5    AMGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDA  64

Query  255  QPELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  434
            QPELFI +VPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIG
Sbjct  65   QPELFIRLVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG  124

Query  435  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            QFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD +GE LGRGTKITLFLK
Sbjct  125  QFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVNGEQLGRGTKITLFLK  184



>ref|NP_001170475.1| LOC100384473 [Zea mays]
 gb|ACO35045.1| heat shock protein 90 [Zea mays]
Length=697

 Score =   344 bits (882),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLK  180



>gb|KFK25886.1| hypothetical protein AALP_AA8G175000 [Arabis alpina]
Length=700

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+V TKHNDDEQYVWESQAGGSFTVT DTSGE LGRGTK+TL+LK
Sbjct  121  FGVGFYSAYLVAEKVVVITKHNDDEQYVWESQAGGSFTVTLDTSGEKLGRGTKMTLYLK  179



>ref|XP_010261331.1| PREDICTED: heat shock protein 83 [Nelumbo nucifera]
Length=703

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>gb|AGB76029.1| heat shock protein 90 [Salicornia europaea]
Length=696

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 173/179 (97%), Gaps = 1/179 (1%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NNSL+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNSLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDT-GEPLGRGTKITLILK  178



>ref|XP_008380194.1| PREDICTED: heat shock protein 83-like [Malus domestica]
Length=703

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MHDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKITLFLK  184



>emb|CAN73318.1| hypothetical protein VITISV_007727 [Vitis vinifera]
Length=704

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_010035175.1| PREDICTED: heat shock protein 83 [Eucalyptus grandis]
 gb|KCW46468.1| hypothetical protein EUGRSUZ_K00295 [Eucalyptus grandis]
Length=700

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPD+ N +L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDRANKTLAIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLFLK  179



>ref|XP_008376647.1| PREDICTED: heat shock protein 83 isoform X1 [Malus domestica]
 ref|XP_008376648.1| PREDICTED: heat shock protein 83 isoform X2 [Malus domestica]
Length=703

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSF VTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFIVTRDVSGEQLGRGTKITLFLK  184



>ref|XP_010545291.1| PREDICTED: heat shock protein 90-2-like [Tarenaya hassleriana]
Length=700

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLI NTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADTETFAFQAEINQLLSLITNTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMILHLK  179



>ref|XP_009367265.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLYLK  179



>ref|XP_009362097.1| PREDICTED: heat shock protein 90-2 [Pyrus x bretschneideri]
Length=699

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKASNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDT+GE LGRGTKITL+LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTTGEVLGRGTKITLYLK  179



>ref|XP_009132342.1| PREDICTED: heat shock protein 90-2-like [Brassica rapa]
Length=698

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTF+SNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFHSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L +K
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHIK  179



>gb|EAZ29453.1| hypothetical protein OsJ_13528 [Oryza sativa Japonica Group]
Length=434

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  9    MAEKETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  68

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VP K + +LSIIDSGVGMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  69   PELFIRLVPYKPSKTLSIIDSGVGMTKSDLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  128

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVT DT+GE LGRGTKITLFLK
Sbjct  129  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTLDTAGERLGRGTKITLFLK  187



>ref|XP_010438732.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=706

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            +D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QP
Sbjct  3    SDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA+KV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVADKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  180



>ref|XP_010433476.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448245.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448246.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010448248.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
 ref|XP_010491086.1| PREDICTED: heat shock protein 90-2-like [Camelina sativa]
Length=701

 Score =   343 bits (881),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            +D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD QP
Sbjct  3    SDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHI+PDKTNN+L+IIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIIPDKTNNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA+KV+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVADKVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLK  180



>ref|XP_006659551.1| PREDICTED: heat shock protein 81-1-like isoform X1 [Oryza brachyantha]
Length=699

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKMTLYLK  180



>gb|KJB52728.1| hypothetical protein B456_008G274600 [Gossypium raimondii]
Length=703

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>gb|AAQ08597.1| heat shock protein [Hevea brasiliensis]
Length=698

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNASDALDKIRFESLTDKSKLDAQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +G+ LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGDQLGRGTKITLFLK  179



>ref|XP_008218765.1| PREDICTED: heat shock protein 90-2 [Prunus mume]
Length=699

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDNSGEVLGRGTKITLHLK  179



>ref|XP_009377558.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
 ref|XP_009377599.1| PREDICTED: heat shock protein 83-like [Pyrus x bretschneideri]
Length=703

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MHDAETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKITLFLK  184



>emb|CAA72513.1| heat shock protein [Arabidopsis thaliana]
Length=699

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSN EIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNLEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLV NLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVKNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KV+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+ L+LK
Sbjct  121  FGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEALGRGTKMVLYLK  179



>gb|AIZ68157.1| heat shock protein 83 [Ornithogalum saundersiae]
Length=701

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDKTN +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKTNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTK+NDDEQY+WESQAGGSFTVTRDTSGE LGRGTKITL+LK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKNNDDEQYIWESQAGGSFTVTRDTSGEQLGRGTKITLYLK  184



>gb|AAA32822.1| heat shock protein 83 [Arabidopsis thaliana]
Length=705

 Score =   343 bits (880),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKI+LFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKISLFLK  184



>ref|XP_010941080.1| PREDICTED: heat shock protein 83 [Elaeis guineensis]
Length=702

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITL+LK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLYLK  184



>ref|XP_009802902.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein 83-like [Nicotiana 
sylvestris]
Length=703

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MAEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITL LK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLLLK  184



>ref|XP_008670278.1| PREDICTED: heat shock protein 81-1-like [Zea mays]
 tpg|DAA40366.1| TPA: putative heat shock protein 90 family protein [Zea mays]
Length=698

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIH+VPDK  N+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHLVPDKATNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVA++V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTKITLFLK
Sbjct  123  GVGFYSAYLVADRVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEQLGRGTKITLFLK  180



>emb|CAA68885.1| heat shock protein 90A [Arabidopsis thaliana]
Length=704

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKPNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKI+LFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKISLFLK  184



>prf||1710352A heat shock protein 83
Length=705

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD  GE LGRGTKI+LFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLGRGTKISLFLK  184



>ref|XP_003592196.1| Heat shock protein [Medicago truncatula]
 gb|AES62447.1| heat shock protein 81-2 [Medicago truncatula]
Length=689

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MCDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>ref|XP_004308051.1| PREDICTED: heat shock protein 83 [Fragaria vesca subsp. vesca]
Length=703

 Score =   342 bits (878),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 174/180 (97%), Gaps = 1/180 (1%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAG-ADVSMIG  434
            PELFI +VPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL +G +DVSMIG
Sbjct  66   PELFIRLVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALASGVSDVSMIG  125

Query  435  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            QFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  QFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  185



>ref|XP_008801780.1| PREDICTED: heat shock protein 83 [Phoenix dactylifera]
Length=703

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITL+LK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLYLK  184



>ref|XP_006413591.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
 gb|ESQ55044.1| hypothetical protein EUTSA_v10024561mg [Eutrema salsugineum]
Length=700

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M+D ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MSDTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK+NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKSNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAE+V+V TKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL LK
Sbjct  121  FGVGFYSAYLVAERVVVVTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLHLK  179



>ref|XP_010276895.1| PREDICTED: heat shock protein 83-like [Nelumbo nucifera]
Length=701

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            + DAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    IGDAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDVNGEQLGRGTKITLFLK  184



>gb|KDO76323.1| hypothetical protein CISIN_1g005321mg [Citrus sinensis]
Length=702

 Score =   342 bits (878),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_010063241.1| PREDICTED: heat shock cognate protein 80-like [Eucalyptus grandis]
 gb|KCW70449.1| hypothetical protein EUGRSUZ_F03673 [Eucalyptus grandis]
Length=703

 Score =   342 bits (877),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK NN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKANNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKH DDEQYVWESQAGGSFTVTRDTSGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVAEKVVVTTKHYDDEQYVWESQAGGSFTVTRDTSGEILGRGTKITLLLK  179



>ref|XP_006476504.1| PREDICTED: heat shock protein 83-like [Citrus sinensis]
Length=701

 Score =   342 bits (877),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFE LTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_004973824.1| PREDICTED: heat shock protein 81-1-like [Setaria italica]
Length=698

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  180



>ref|XP_007208337.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
 gb|EMJ09536.1| hypothetical protein PRUPE_ppa002220mg [Prunus persica]
Length=699

 Score =   342 bits (876),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MA+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLD Q
Sbjct  1    MAETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            P+LFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PDLFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITL LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDNSGEVLGRGTKITLHLK  179



>ref|XP_001777414.1| predicted protein [Physcomitrella patens]
 gb|EDQ57818.1| predicted protein [Physcomitrella patens]
Length=704

 Score =   342 bits (877),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A  ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK+D QP
Sbjct  6    AQVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKMDGQP  65

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+LSIIDSG+GMTKAD+VNNLGTIARSGTKEFMEALTAGADVSMIGQF
Sbjct  66   ELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALTAGADVSMIGQF  125

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I L+LK
Sbjct  126  GVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEQLGRGTHIKLYLK  183



>dbj|BAO20259.1| heat shock protein [Brassica rapa subsp. chinensis]
Length=699

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  1    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDK +N+L+I DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKADNTLTISDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVA+KVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGE+LGRGTK+ L LK
Sbjct  121  FGVGFYSAYLVADKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGESLGRGTKMVLHLK  179



>ref|XP_007038813.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
 gb|EOY23314.1| Heat shock protein 90.1 isoform 1 [Theobroma cacao]
Length=703

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVT+KHNDDEQY+WESQAGGSFTVTRD +GE LGRGTK+TL+LK
Sbjct  126  FGVGFYSAYLVAEKVIVTSKHNDDEQYIWESQAGGSFTVTRDVNGEPLGRGTKMTLYLK  184



>ref|XP_001779443.1| predicted protein [Physcomitrella patens]
 gb|EDQ55721.1| predicted protein [Physcomitrella patens]
Length=697

 Score =   342 bits (876),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 173/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  75   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  254
            A A+ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL A
Sbjct  2    AAAEVETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLGA  61

Query  255  QPELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  434
            QPELFIHIVPDK NN+LSIIDSG+GMTKAD+VNNLGTIARSGTKEFMEAL+AGADVSMIG
Sbjct  62   QPELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALSAGADVSMIG  121

Query  435  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            QFGVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I LFLK
Sbjct  122  QFGVGFYSAYLVAEKVVVTSKHNDDEQYMWESQAGGSFTITRDTSGEQLGRGTHIKLFLK  181



>gb|ADP89125.1| heat shock protein 90 [Cenchrus americanus]
 gb|ADP89126.1| heat shock protein 90 [Cenchrus americanus]
Length=698

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK +N+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKASNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTVTRDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEPLGRGTKMTLYLK  180



>ref|XP_011080917.1| PREDICTED: heat shock protein 83-like [Sesamum indicum]
Length=704

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M ++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKL++Q
Sbjct  6    MGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLESQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  184



>ref|XP_001777383.1| predicted protein [Physcomitrella patens]
 gb|EDQ57787.1| predicted protein [Physcomitrella patens]
Length=707

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  75   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  254
            A  + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSK+D 
Sbjct  7    ASPEIETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKMDG  66

Query  255  QPELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  434
            QPELFIHIVPDK NN+LSIIDSG+GMTKAD+VNNLGTIARSGTKEFMEALTAGADVSMIG
Sbjct  67   QPELFIHIVPDKANNTLSIIDSGIGMTKADMVNNLGTIARSGTKEFMEALTAGADVSMIG  126

Query  435  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            QFGVGFYSAYLVAEKV+VT+KHNDDEQY+WESQAGGSFT+TRDTSGE LGRGT I L+LK
Sbjct  127  QFGVGFYSAYLVAEKVVVTSKHNDDEQYIWESQAGGSFTITRDTSGEQLGRGTHIKLYLK  186



>ref|NP_001170480.1| HSP protein [Zea mays]
 gb|ACO72989.1| HSP protein [Zea mays]
 gb|AFW65179.1| putative heat shock protein 90 family protein [Zea mays]
Length=699

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK+KLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKTKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+L+IIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTV RDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEQLGRGTKMTLYLK  180



>ref|XP_006828794.1| hypothetical protein AMTR_s00001p00118120 [Amborella trichopoda]
 gb|ERM96210.1| hypothetical protein AMTR_s00001p00118120 [Amborella trichopoda]
Length=705

 Score =   341 bits (875),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/180 (93%), Positives = 172/180 (96%), Gaps = 0/180 (0%)
 Frame = +3

Query  75   AMADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  254
            A  +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct  7    AGGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  66

Query  255  QPELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIG  434
            QPELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIG
Sbjct  67   QPELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIG  126

Query  435  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITLFLK
Sbjct  127  QFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVNGEPLGRGTKITLFLK  186



>gb|KHG00618.1| Heat shock 90-1 -like protein [Gossypium arboreum]
Length=707

 Score =   341 bits (874),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  9    AESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  68

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFI I+PDK N +LSI+DSG+GMTKA+LVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  69   ELFIRIIPDKANKTLSIVDSGIGMTKAELVNNLGTIARSGTKEFMEALQAGADVSMIGQF  128

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  129  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  186



>ref|XP_004308050.1| PREDICTED: heat shock protein 83-like [Fragaria vesca subsp. 
vesca]
Length=700

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 175/181 (97%), Gaps = 2/181 (1%)
 Frame = +3

Query  78   MADA-ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  254
            MADA ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA
Sbjct  1    MADAAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA  60

Query  255  QPELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAG-ADVSMI  431
            QPELFI +VPDKTNN+LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL +G +DVSMI
Sbjct  61   QPELFIRLVPDKTNNTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALASGVSDVSMI  120

Query  432  GQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFL  611
            GQFGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD SGE LGRGTKITLFL
Sbjct  121  GQFGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVSGEQLGRGTKITLFL  180

Query  612  K  614
            K
Sbjct  181  K  181



>gb|KJB20596.1| hypothetical protein B456_003G155600 [Gossypium raimondii]
Length=707

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            A++ETFAFQAEINQLLSLIINTFYSNKEIFLRE+ISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  9    AESETFAFQAEINQLLSLIINTFYSNKEIFLREIISNSSDALDKIRFESLTDKSKLDAQP  68

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFI I+PDK N +LSI+DSGVGMTKA+LVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  69   ELFIRIIPDKANKTLSIVDSGVGMTKAELVNNLGTIARSGTKEFMEALQAGADVSMIGQF  128

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  129  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  186



>ref|XP_010445119.1| PREDICTED: heat shock protein 90-1-like [Camelina sativa]
Length=706

 Score =   340 bits (873),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/180 (93%), Positives = 171/180 (95%), Gaps = 1/180 (1%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLD Q
Sbjct  6    MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGEN-LGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD  GE  LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVDGEPLLGRGTKITLFLK  185



>ref|XP_010934626.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
 ref|XP_010934627.1| PREDICTED: heat shock protein 83-like [Elaeis guineensis]
Length=702

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M +AETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+E LTDKSKLDAQ
Sbjct  6    MGEAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYEGLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKANKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKV+VTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKITL+LK
Sbjct  126  FGVGFYSAYLVAEKVVVTTKHNDDEQYIWESQAGGSFTVTRDVSGEQLGRGTKITLYLK  184



>ref|XP_008797179.1| PREDICTED: heat shock protein 83-like [Phoenix dactylifera]
Length=701

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M ++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIR+ESLTDKSKLDAQ
Sbjct  6    MGESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI IVPDK N +LSIIDSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRIVPDKVNKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYS+YLVAEKV+VTTKHNDDEQYVWESQAGGSFTVTRD +GE LGRGTKITL+LK
Sbjct  126  FGVGFYSSYLVAEKVVVTTKHNDDEQYVWESQAGGSFTVTRDVNGEPLGRGTKITLYLK  184



>gb|EYU25148.1| hypothetical protein MIMGU_mgv1a002213mg [Erythranthe guttata]
Length=700

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLD+Q
Sbjct  1    MADGETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDSQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK N +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIRLVPDKVNKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFT+TRD  GE LGRGTKITLFLK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTITRDVDGEQLGRGTKITLFLK  179



>gb|ACX37413.1| cytosolic heat shock protein 90.1 [Dactylis glomerata]
Length=699

 Score =   340 bits (872),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+LSIIDSG+GMTK+DLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLSIIDSGIGMTKSDLVNNLGTIARSGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQY+WESQAGGSFTV RDT+GE LGRGTK+ L+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYIWESQAGGSFTVARDTTGEQLGRGTKMVLYLK  180



>ref|XP_004294900.1| PREDICTED: heat shock protein 90-2 [Fragaria vesca subsp. vesca]
Length=697

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 1/179 (1%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            MAD ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKL++Q
Sbjct  1    MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLESQ  60

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFIHI+PDKTNN+L+IIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  61   PELFIHIIPDKTNNTLTIIDSGIGMTKADLVNNLGTIARSGTKEFMEALAAGADVSMIGQ  120

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD SGE LGRGTKI L LK
Sbjct  121  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRD-SGEPLGRGTKICLHLK  178



>gb|KJB24312.1| hypothetical protein B456_004G138600 [Gossypium raimondii]
Length=543

 Score =   335 bits (859),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            +++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFE LTDKSKLDAQP
Sbjct  8    SESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFEGLTDKSKLDAQP  67

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFI I+PDK N +LSI+DSGVGMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  68   ELFIRIIPDKANKTLSIVDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  127

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRD  GE LGRGTKITLFLK
Sbjct  128  GVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDLGGEPLGRGTKITLFLK  185



>ref|XP_007040338.1| Heat shock protein 90.1 [Theobroma cacao]
 gb|EOY24839.1| Heat shock protein 90.1 [Theobroma cacao]
Length=705

 Score =   340 bits (872),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            +++ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQP
Sbjct  8    SESETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQP  67

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFI I+PDK N +LSI+DSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQF
Sbjct  68   ELFIRIIPDKINKTLSIVDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQF  127

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRD SGE LGRGTKITLFLK
Sbjct  128  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLK  185



>ref|XP_010089052.1| Heat shock protein 83 [Morus notabilis]
 gb|EXB37299.1| Heat shock protein 83 [Morus notabilis]
Length=703

 Score =   340 bits (871),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = +3

Query  78   MADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQ  257
            M + ETFAFQAEINQLLSLIINTFYSNKEIFLRELISN+SDALDKIRFESLTDKSKLDAQ
Sbjct  6    MGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNASDALDKIRFESLTDKSKLDAQ  65

Query  258  PELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQ  437
            PELFI +VPDK + +LSIIDSG+GMTKADLVNNLGTIARSGTKEFMEAL AGADVSMIGQ
Sbjct  66   PELFIRLVPDKASKTLSIIDSGIGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQ  125

Query  438  FGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            FGVGFYSAYLVAEKVIVTTKHNDDEQY+WESQAGGSFTVTRDT GE LGRGTKITLFLK
Sbjct  126  FGVGFYSAYLVAEKVIVTTKHNDDEQYIWESQAGGSFTVTRDTEGEQLGRGTKITLFLK  184



>gb|ACN36206.1| unknown [Zea mays]
Length=699

 Score =   339 bits (870),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +3

Query  81   ADAETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDAQP  260
            ++ ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDK+KLDAQP
Sbjct  3    SETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKTKLDAQP  62

Query  261  ELFIHIVPDKTNNSLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALTAGADVSMIGQF  440
            ELFIHIVPDK NN+L+IIDSG+GMTK+DLVNNLGTIAR GTKEFMEAL AGADVSMIGQF
Sbjct  63   ELFIHIVPDKANNTLTIIDSGIGMTKSDLVNNLGTIARPGTKEFMEALAAGADVSMIGQF  122

Query  441  GVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDTSGENLGRGTKITLFLK  614
            GVGFYSAYLVAE+V+VTTKHNDDEQYVWESQAGGSFTV RDTSGE LGRGTK+TL+LK
Sbjct  123  GVGFYSAYLVAERVVVTTKHNDDEQYVWESQAGGSFTVARDTSGEQLGRGTKMTLYLK  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090