BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF036N18

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57286.1|  V-type proton ATPase subunit                           325   4e-107   Ipomoea nil [qian niu]
ref|XP_006363973.1|  PREDICTED: V-type proton ATPase subunit C-like     304   9e-99    Solanum tuberosum [potatoes]
ref|XP_004235295.1|  PREDICTED: V-type proton ATPase subunit C          302   5e-98    Solanum lycopersicum
ref|XP_009786911.1|  PREDICTED: V-type proton ATPase subunit C          301   6e-98    Nicotiana sylvestris
ref|XP_009618992.1|  PREDICTED: V-type proton ATPase subunit C          300   4e-97    Nicotiana tomentosiformis
emb|CDP15722.1|  unnamed protein product                                288   1e-92    Coffea canephora [robusta coffee]
ref|XP_002512862.1|  vacuolar ATP synthase subunit C, putative          286   1e-91    Ricinus communis
gb|KCW64319.1|  hypothetical protein EUGRSUZ_G01949                     279   3e-91    Eucalyptus grandis [rose gum]
gb|EYU24479.1|  hypothetical protein MIMGU_mgv1a006812mg                286   3e-91    Erythranthe guttata [common monkey flower]
ref|XP_007215551.1|  hypothetical protein PRUPE_ppa007256mg             284   4e-91    Prunus persica
ref|XP_008231040.1|  PREDICTED: V-type proton ATPase subunit C          284   4e-91    Prunus mume [ume]
ref|XP_011083360.1|  PREDICTED: V-type proton ATPase subunit C-like     283   9e-91    Sesamum indicum [beniseed]
ref|XP_011073132.1|  PREDICTED: V-type proton ATPase subunit C-like     283   1e-90    Sesamum indicum [beniseed]
ref|XP_011468207.1|  PREDICTED: V-type proton ATPase subunit C          283   2e-90    Fragaria vesca subsp. vesca
gb|KDO47366.1|  hypothetical protein CISIN_1g017251mg                   278   3e-90    Citrus sinensis [apfelsine]
ref|XP_003518129.1|  PREDICTED: V-type proton ATPase subunit C-like     282   3e-90    Glycine max [soybeans]
gb|KDO47363.1|  hypothetical protein CISIN_1g017251mg                   278   1e-89    Citrus sinensis [apfelsine]
ref|XP_010096044.1|  V-type proton ATPase subunit C                     281   1e-89    
gb|KDP41839.1|  hypothetical protein JCGZ_26857                         280   1e-89    Jatropha curcas
ref|XP_010663792.1|  PREDICTED: V-type proton ATPase subunit C is...    278   1e-89    
ref|XP_003553974.1|  PREDICTED: V-type proton ATPase subunit C-like     280   2e-89    Glycine max [soybeans]
gb|KCW64313.1|  hypothetical protein EUGRSUZ_G019431                    275   2e-89    Eucalyptus grandis [rose gum]
ref|XP_010068642.1|  PREDICTED: V-type proton ATPase subunit C-like     278   3e-89    
ref|XP_008341246.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    277   3e-89    
ref|XP_009378027.1|  PREDICTED: V-type proton ATPase subunit C          279   3e-89    Pyrus x bretschneideri [bai li]
emb|CDY19421.1|  BnaC05g09300D                                          279   4e-89    Brassica napus [oilseed rape]
ref|XP_006599411.1|  PREDICTED: V-type proton ATPase subunit C-like     279   4e-89    Glycine max [soybeans]
ref|XP_007031994.1|  Vacuolar ATP synthase subunit C (VATC) / V-A...    279   4e-89    Theobroma cacao [chocolate]
gb|KHN28568.1|  V-type proton ATPase subunit C                          279   6e-89    Glycine soja [wild soybean]
gb|ABH07428.1|  vacuolar H+-ATPase subunit C                            277   2e-88    Gossypium hirsutum [American cotton]
ref|XP_002284444.1|  PREDICTED: V-type proton ATPase subunit C is...    277   2e-88    Vitis vinifera
ref|XP_007161646.1|  hypothetical protein PHAVU_001G086700g             277   3e-88    Phaseolus vulgaris [French bean]
gb|KJB40647.1|  hypothetical protein B456_007G072500                    275   3e-88    Gossypium raimondii
ref|XP_006373109.1|  hypothetical protein POPTR_0017s08810g             276   3e-88    
gb|KJB40646.1|  hypothetical protein B456_007G072500                    275   4e-88    Gossypium raimondii
ref|XP_011001967.1|  PREDICTED: V-type proton ATPase subunit C          276   4e-88    Populus euphratica
ref|XP_003624472.1|  V-type proton ATPase subunit C                     276   4e-88    Medicago truncatula
ref|XP_006373110.1|  hypothetical protein POPTR_0017s08810g             276   5e-88    Populus trichocarpa [western balsam poplar]
ref|XP_006446960.1|  hypothetical protein CICLE_v10015638mg             276   5e-88    Citrus clementina [clementine]
gb|KEH23490.1|  vacuolar H+-ATPase subunit C                            276   5e-88    Medicago truncatula
ref|XP_003548919.2|  PREDICTED: V-type proton ATPase subunit C-like     276   6e-88    Glycine max [soybeans]
gb|ABD32569.1|  V-ATPase subunit C                                      276   6e-88    Medicago truncatula
ref|XP_007151733.1|  hypothetical protein PHAVU_004G070900g             276   6e-88    Phaseolus vulgaris [French bean]
gb|KJB40648.1|  hypothetical protein B456_007G072500                    276   1e-87    Gossypium raimondii
ref|XP_008379060.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    275   1e-87    
gb|KJB40645.1|  hypothetical protein B456_007G072500                    276   1e-87    Gossypium raimondii
ref|XP_004150739.1|  PREDICTED: V-type proton ATPase subunit C-like     275   1e-87    Cucumis sativus [cucumbers]
ref|XP_008463120.1|  PREDICTED: V-type proton ATPase subunit C          275   1e-87    Cucumis melo [Oriental melon]
ref|XP_006369829.1|  Vacuolar ATP synthase subunit C family protein     275   1e-87    
gb|EPS62747.1|  hypothetical protein M569_12043                         273   2e-87    Genlisea aurea
gb|KCW64312.1|  hypothetical protein EUGRSUZ_G019431                    274   2e-87    Eucalyptus grandis [rose gum]
ref|XP_008775428.1|  PREDICTED: V-type proton ATPase subunit C-li...    273   4e-87    
ref|XP_010494723.1|  PREDICTED: V-type proton ATPase subunit C          274   4e-87    Camelina sativa [gold-of-pleasure]
gb|KJB76317.1|  hypothetical protein B456_012G082900                    272   4e-87    Gossypium raimondii
ref|XP_010458722.1|  PREDICTED: V-type proton ATPase subunit C-like     274   4e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010693540.1|  PREDICTED: V-type proton ATPase subunit C          273   6e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002275510.1|  PREDICTED: V-type proton ATPase subunit C          273   8e-87    Vitis vinifera
gb|KJB76320.1|  hypothetical protein B456_012G082900                    272   9e-87    Gossypium raimondii
gb|KJB76319.1|  hypothetical protein B456_012G082900                    272   1e-86    Gossypium raimondii
ref|XP_008775427.1|  PREDICTED: V-type proton ATPase subunit C-li...    273   1e-86    Phoenix dactylifera
ref|XP_010066422.1|  PREDICTED: V-type proton ATPase subunit C          273   1e-86    Eucalyptus grandis [rose gum]
ref|NP_563916.1|  V-type proton ATPase subunit C                        273   1e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KJB76315.1|  hypothetical protein B456_012G082900                    272   2e-86    Gossypium raimondii
ref|XP_009148561.1|  PREDICTED: V-type proton ATPase subunit C          272   2e-86    Brassica rapa
ref|XP_010528136.1|  PREDICTED: V-type proton ATPase subunit C-like     272   2e-86    Tarenaya hassleriana [spider flower]
gb|AIY85415.1|  V-ATPase subunit C1                                     272   2e-86    Eriobotrya japonica [loquat]
emb|CDY21070.1|  BnaA08g24550D                                          272   2e-86    Brassica napus [oilseed rape]
ref|XP_010249179.1|  PREDICTED: V-type proton ATPase subunit C-like     272   2e-86    Nelumbo nucifera [Indian lotus]
emb|CDY66539.1|  BnaCnng51300D                                          272   3e-86    Brassica napus [oilseed rape]
ref|XP_002889973.1|  de-etiolated 3                                     272   3e-86    
ref|XP_011045799.1|  PREDICTED: V-type proton ATPase subunit C-li...    272   3e-86    Populus euphratica
gb|KFK43549.1|  hypothetical protein AALP_AA1G141200                    272   3e-86    Arabis alpina [alpine rockcress]
gb|KHM99227.1|  V-type proton ATPase subunit C                          272   3e-86    Glycine soja [wild soybean]
ref|XP_011045798.1|  PREDICTED: V-type proton ATPase subunit C-li...    272   3e-86    Populus euphratica
ref|XP_006417188.1|  hypothetical protein EUTSA_v10007948mg             271   3e-86    Eutrema salsugineum [saltwater cress]
ref|XP_008808181.1|  PREDICTED: V-type proton ATPase subunit C-like     271   5e-86    Phoenix dactylifera
ref|XP_006305100.1|  hypothetical protein CARUB_v10009467mg             271   6e-86    
tpg|DAA59221.1|  TPA: hypothetical protein ZEAMMB73_061434              264   1e-85    
gb|AAO72561.1|  putative vacuolar ATP synthase subunit C                271   2e-85    
ref|XP_010476263.1|  PREDICTED: V-type proton ATPase subunit C-like     270   2e-85    Camelina sativa [gold-of-pleasure]
emb|CDX71966.1|  BnaC08g29080D                                          269   5e-85    
ref|XP_009110617.1|  PREDICTED: V-type proton ATPase subunit C-like     269   5e-85    Brassica rapa
ref|NP_001056500.1|  Os05g0593100                                       269   5e-85    
ref|XP_009118052.1|  PREDICTED: V-type proton ATPase subunit C-like     268   6e-85    Brassica rapa
ref|XP_002441624.1|  hypothetical protein SORBIDRAFT_09g030620          268   7e-85    Sorghum bicolor [broomcorn]
ref|XP_006655657.1|  PREDICTED: V-type proton ATPase subunit C-like     268   9e-85    Oryza brachyantha
ref|NP_001147632.1|  LOC100281241                                       267   2e-84    Zea mays [maize]
ref|XP_010939292.1|  PREDICTED: V-type proton ATPase subunit C-li...    266   2e-84    Elaeis guineensis
ref|XP_004493016.1|  PREDICTED: V-type proton ATPase subunit C-like     267   2e-84    Cicer arietinum [garbanzo]
ref|XP_010939209.1|  PREDICTED: V-type proton ATPase subunit C-li...    266   4e-84    Elaeis guineensis
emb|CDY16036.1|  BnaC08g40870D                                          269   7e-84    Brassica napus [oilseed rape]
ref|XP_010556324.1|  PREDICTED: V-type proton ATPase subunit C          265   8e-84    Tarenaya hassleriana [spider flower]
ref|XP_002441755.1|  hypothetical protein SORBIDRAFT_08g001880          265   9e-84    Sorghum bicolor [broomcorn]
ref|XP_004977299.1|  PREDICTED: V-type proton ATPase subunit C-like     265   2e-83    Setaria italica
ref|XP_010925033.1|  PREDICTED: V-type proton ATPase subunit C-like     264   2e-83    Elaeis guineensis
ref|NP_001142247.1|  uncharacterized protein LOC100274416               264   3e-83    Zea mays [maize]
ref|XP_010554131.1|  PREDICTED: V-type proton ATPase subunit C-li...    263   6e-83    Tarenaya hassleriana [spider flower]
ref|XP_010554130.1|  PREDICTED: V-type proton ATPase subunit C-li...    264   1e-82    Tarenaya hassleriana [spider flower]
ref|XP_009386009.1|  PREDICTED: V-type proton ATPase subunit C-like     262   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY26596.1|  BnaA09g46810D                                          268   2e-82    Brassica napus [oilseed rape]
gb|KGN50885.1|  hypothetical protein Csa_5G312840                       261   3e-82    Cucumis sativus [cucumbers]
ref|XP_008654564.1|  PREDICTED: hypothetical protein isoform X1         261   4e-82    
ref|XP_006844509.1|  hypothetical protein AMTR_s00016p00139220          258   5e-81    Amborella trichopoda
ref|XP_009395792.1|  PREDICTED: V-type proton ATPase subunit C-like     258   6e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567787.1|  PREDICTED: V-type proton ATPase subunit C          257   2e-80    Brachypodium distachyon [annual false brome]
ref|XP_010250562.1|  PREDICTED: V-type proton ATPase subunit C          252   1e-78    Nelumbo nucifera [Indian lotus]
gb|ABG23314.1|  vacuolar proton-ATPase C subunit                        251   4e-78    Triticum aestivum [Canadian hard winter wheat]
gb|ACT34062.1|  vacuolar ATP synthetase subunit C                       251   4e-78    Aegilops tauschii
sp|Q9SCB9.1|VATC_HORVU  RecName: Full=V-type proton ATPase subuni...    250   4e-78    Hordeum vulgare [barley]
gb|KJB76316.1|  hypothetical protein B456_012G082900                    244   7e-76    Gossypium raimondii
gb|ADE77882.1|  unknown                                                 231   2e-70    Picea sitchensis
ref|XP_002980160.1|  hypothetical protein SELMODRAFT_111716             218   2e-65    Selaginella moellendorffii
ref|XP_001773067.1|  predicted protein                                  202   4e-59    
gb|EMS67397.1|  V-type proton ATPase subunit C                          183   8e-52    Triticum urartu
gb|KHG11234.1|  V-type proton ATPase subunit C -like protein            181   2e-51    Gossypium arboreum [tree cotton]
gb|EMT09400.1|  V-type proton ATPase subunit C                          175   6e-49    
gb|AGJ98217.1|  DET3                                                    172   1e-48    Petunia x hybrida [garden petunia]
ref|XP_001756840.1|  predicted protein                                  160   6e-43    
gb|AFW81321.1|  hypothetical protein ZEAMMB73_736936                    149   3e-41    
ref|XP_001696429.1|  vacuolar H+ ATPase V1 sector, subunit C            141   4e-36    Chlamydomonas reinhardtii
ref|XP_005651974.1|  vacuolar H+ ATPase V1 sector, subunit C            137   9e-35    Coccomyxa subellipsoidea C-169
gb|ADI46924.1|  ATPvC1m                                                 135   6e-34    Volvox carteri f. nagariensis
ref|XP_002503957.1|  H+-or Na+-translocating f-type, v-type and A...    131   2e-32    Micromonas commoda
ref|XP_002954527.1|  vacuolar ATP synthase, subunit C                   130   3e-32    Volvox carteri f. nagariensis
ref|XP_005847214.1|  hypothetical protein CHLNCDRAFT_35880              125   3e-30    Chlorella variabilis
gb|ABE96876.1|  putative vacuolar ATP synthase subunit C                117   2e-29    Triticum monococcum [einkorn wheat]
ref|XP_011399399.1|  V-type proton ATPase subunit C                     117   2e-27    Auxenochlorella protothecoides
gb|EMT10509.1|  hypothetical protein F775_43622                         109   1e-26    
ref|XP_007886138.1|  PREDICTED: V-type proton ATPase subunit C 1        112   2e-25    Callorhinchus milii [Australian ghost shark]
gb|AAB51350.1|  C subunit of V-ATPase                                   111   3e-25    Amblyomma americanum
gb|EKC32287.1|  V-type proton ATPase subunit C 1                        111   4e-25    Crassostrea gigas
ref|XP_001418773.1|  F-ATPase family transporter: protons (vacuolar)    110   5e-25    Ostreococcus lucimarinus CCE9901
ref|XP_009029568.1|  hypothetical protein HELRODRAFT_103807             110   8e-25    Helobdella robusta
ref|XP_011414828.1|  PREDICTED: V-type proton ATPase subunit C 1-...    110   9e-25    Crassostrea gigas
dbj|BAE87614.1|  unnamed protein product                                108   1e-24    Macaca fascicularis [crab eating macaque]
ref|XP_010898239.1|  PREDICTED: V-type proton ATPase subunit C 1-...    109   2e-24    
ref|XP_006028579.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    108   2e-24    Alligator sinensis
ref|XP_006028578.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    108   3e-24    
gb|EPY74837.1|  V-type proton ATPase subunit C 1                        107   3e-24    Camelus ferus
emb|CDQ87771.1|  unnamed protein product                                108   3e-24    Oncorhynchus mykiss
ref|XP_004679736.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    108   3e-24    
emb|CAH93171.1|  hypothetical protein                                   108   3e-24    Pongo abelii [orang utan]
ref|XP_006796085.1|  PREDICTED: V-type proton ATPase subunit C 1-...    108   3e-24    Neolamprologus brichardi [lyretail cichlid]
ref|XP_002733333.1|  PREDICTED: V-type proton ATPase subunit C 1-...    108   3e-24    Saccoglossus kowalevskii
gb|AIC48333.1|  ATP6V1C1                                                108   4e-24    synthetic construct
ref|XP_005627900.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    
emb|CAH93365.1|  hypothetical protein                                   108   4e-24    Pongo abelii [orang utan]
ref|XP_009890115.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Charadrius vociferus
ref|XP_006760332.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Myotis davidii
ref|XP_008934370.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Merops nubicus
ref|XP_004275371.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Orcinus orca [Orca]
ref|NP_001686.1|  V-type proton ATPase subunit C 1                      108   4e-24    Homo sapiens [man]
ref|XP_006122461.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_009918407.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Haliaeetus albicilla
ref|XP_009864623.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Apaloderma vittatum
ref|XP_005231036.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    
ref|XP_004663082.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    108   4e-24    Jaculus jaculus
ref|XP_003459431.1|  PREDICTED: V-type proton ATPase subunit C 1-...    108   4e-24    Oreochromis niloticus
ref|XP_003480143.1|  PREDICTED: V-type proton ATPase subunit C 1        108   4e-24    Cavia porcellus [guinea pig]
ref|XP_004903962.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    108   4e-24    
gb|ACO11255.1|  Vacuolar proton pump subunit C                          108   4e-24    Caligus rogercresseyi
ref|XP_010139291.1|  PREDICTED: V-type proton ATPase subunit C 1        108   5e-24    Buceros rhinoceros silvestris
ref|XP_005306086.1|  PREDICTED: V-type proton ATPase subunit C 1        108   5e-24    Chrysemys picta bellii
ref|XP_005499457.1|  PREDICTED: V-type proton ATPase subunit C 1        108   5e-24    Columba livia [carrier pigeon]
ref|XP_007932994.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   5e-24    Orycteropus afer afer
ref|XP_009510884.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Phalacrocorax carbo [common cormorant]
ref|XP_005879352.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Myotis brandtii
ref|XP_009700298.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Cariama cristata
ref|XP_002759363.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Callithrix jacchus [common marmoset]
ref|XP_003408473.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Loxodonta africana [African bush elephant]
ref|XP_008051075.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Carlito syrichta
ref|XP_008146706.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   6e-24    Eptesicus fuscus
ref|XP_006145636.1|  PREDICTED: V-type proton ATPase subunit C 1        107   6e-24    Tupaia chinensis
ref|XP_005316338.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   7e-24    Ictidomys tridecemlineatus
gb|ERL87116.1|  hypothetical protein D910_04516                         107   7e-24    Dendroctonus ponderosae
ref|XP_004768925.1|  PREDICTED: V-type proton ATPase subunit C 1        107   7e-24    Mustela putorius furo [black ferret]
ref|XP_008574309.1|  PREDICTED: V-type proton ATPase subunit C 1        107   7e-24    Galeopterus variegatus [Malayan flying lemur]
ref|XP_006192890.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   7e-24    Camelus ferus
ref|XP_002710769.1|  PREDICTED: V-type proton ATPase subunit C 1        107   7e-24    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006212223.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   7e-24    Vicugna pacos
ref|XP_007075876.1|  PREDICTED: V-type proton ATPase subunit C 1        107   7e-24    Panthera tigris altaica
ref|XP_004402384.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   7e-24    Odobenus rosmarus divergens
ref|XP_010954093.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    107   7e-24    Camelus bactrianus [camel]
ref|XP_010980173.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    107   8e-24    Camelus dromedarius [camel]
ref|XP_002922648.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    107   8e-24    Ailuropoda melanoleuca
ref|XP_004607741.1|  PREDICTED: V-type proton ATPase subunit C 1        107   1e-23    Sorex araneus [Eurasian shrew]
ref|XP_004697744.1|  PREDICTED: V-type proton ATPase subunit C 1        106   1e-23    
gb|KDR10550.1|  V-type proton ATPase subunit C                          107   1e-23    Zootermopsis nevadensis
gb|ELR53809.1|  V-type proton ATPase subunit C 1                        107   1e-23    Bos mutus
ref|XP_007423656.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    107   1e-23    Python bivittatus
ref|NP_001177134.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...    107   1e-23    Sus scrofa [pigs]
ref|XP_005238220.1|  PREDICTED: V-type proton ATPase subunit C 2        107   1e-23    Falco peregrinus [peregrine]
ref|XP_009482486.1|  PREDICTED: V-type proton ATPase subunit C 1-...    103   1e-23    Pelecanus crispus
ref|XP_008321927.1|  PREDICTED: V-type proton ATPase subunit C 1        107   1e-23    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005797406.1|  PREDICTED: V-type proton ATPase subunit C 1-...    107   1e-23    Xiphophorus maculatus
ref|NP_788849.1|  V-type proton ATPase subunit C 1                      107   1e-23    Bos taurus [bovine]
sp|Q9U5N1.1|VATC_MANSE  RecName: Full=V-type proton ATPase subuni...    107   1e-23    Manduca sexta [Carolina sphinx]
ref|XP_004011849.1|  PREDICTED: V-type proton ATPase subunit C 1        106   1e-23    Ovis aries [domestic sheep]
ref|XP_003080507.1|  putative vacuolar ATP synthase subunit C (ISS)     106   1e-23    Ostreococcus tauri
ref|XP_007518917.1|  PREDICTED: V-type proton ATPase subunit C 1        106   1e-23    Erinaceus europaeus [common hedgehog]
ref|XP_005382051.1|  PREDICTED: V-type proton ATPase subunit C 1        107   1e-23    
ref|XP_004431292.1|  PREDICTED: V-type proton ATPase subunit C 1        106   1e-23    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010744926.1|  PREDICTED: V-type proton ATPase subunit C 1-...    106   1e-23    
ref|XP_001494151.1|  PREDICTED: V-type proton ATPase subunit C 1        106   1e-23    
ref|XP_006916693.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    106   2e-23    
ref|XP_004340673.1|  Vtype proton ATPase subunit C, putative            106   2e-23    Acanthamoeba castellanii str. Neff
ref|XP_009896480.1|  PREDICTED: V-type proton ATPase subunit C 1        106   2e-23    Picoides pubescens
ref|XP_003782477.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    106   2e-23    Otolemur garnettii
ref|XP_010223600.1|  PREDICTED: V-type proton ATPase subunit C 1        106   2e-23    Tinamus guttatus
ref|NP_001088261.1|  V-type proton ATPase subunit C 1                   106   2e-23    Xenopus laevis [clawed frog]
dbj|BAE40727.1|  unnamed protein product                                106   2e-23    Mus musculus [mouse]
ref|XP_006982882.1|  PREDICTED: V-type proton ATPase subunit C 1        105   2e-23    Peromyscus maniculatus bairdii
ref|XP_005367598.1|  PREDICTED: V-type proton ATPase subunit C 1        105   2e-23    Microtus ochrogaster [prairie voles]
ref|XP_003509877.1|  PREDICTED: V-type proton ATPase subunit C 1        105   2e-23    Cricetulus griseus [Chinese hamsters]
ref|XP_007056164.1|  PREDICTED: V-type proton ATPase subunit C 1        105   2e-23    Chelonia mydas [green seaturtle]
ref|NP_989172.1|  V-type proton ATPase subunit C 1                      105   2e-23    Xenopus tropicalis [western clawed frog]
ref|XP_007634426.1|  PREDICTED: V-type proton ATPase subunit C 1        105   2e-23    
gb|AAC83084.1|  vacuolar adenosine triphosphatase subunit C             105   2e-23    Mus musculus [mouse]
ref|XP_010280691.1|  PREDICTED: V-type proton ATPase subunit C 2        105   3e-23    Phaethon lepturus
ref|NP_079770.2|  V-type proton ATPase subunit C 1                      105   3e-23    Mus musculus [mouse]
ref|XP_008430009.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    105   3e-23    Poecilia reticulata
ref|NP_001011992.1|  V-type proton ATPase subunit C 1                   105   3e-23    Rattus norvegicus [brown rat]
ref|XP_003760346.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    105   3e-23    Sarcophilus harrisii
ref|XP_009824064.1|  hypothetical protein H257_02220                    105   3e-23    Aphanomyces astaci
ref|XP_010148071.1|  PREDICTED: V-type proton ATPase subunit C 1        105   3e-23    Eurypyga helias
ref|XP_008420198.1|  PREDICTED: V-type proton ATPase subunit C 1-A      105   3e-23    Poecilia reticulata
ref|XP_006830685.1|  PREDICTED: V-type proton ATPase subunit C 1        105   3e-23    Chrysochloris asiatica
gb|KFM68542.1|  V-type proton ATPase subunit C                          105   4e-23    Stegodyphus mimosarum
gb|KFQ65953.1|  V-type proton ATPase subunit C 2                        105   4e-23    Phaethon lepturus
gb|KFQ53504.1|  V-type proton ATPase subunit C 1                        105   4e-23    Nestor notabilis
ref|XP_010017126.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    105   4e-23    Nestor notabilis
ref|XP_003940719.1|  PREDICTED: V-type proton ATPase subunit C 1        105   4e-23    Saimiri boliviensis boliviensis
ref|XP_009275405.1|  PREDICTED: V-type proton ATPase subunit C 1        105   4e-23    Aptenodytes forsteri
ref|XP_010302959.1|  PREDICTED: V-type proton ATPase subunit C 1        105   4e-23    Balearica regulorum gibbericeps
ref|XP_418370.1|  PREDICTED: V-type proton ATPase subunit C 1 iso...    105   4e-23    Gallus gallus [bantam]
ref|XP_009321363.1|  PREDICTED: V-type proton ATPase subunit C 1        105   4e-23    Pygoscelis adeliae
ref|XP_009809784.1|  PREDICTED: V-type proton ATPase subunit C 2        104   4e-23    Gavia stellata
ref|XP_009556284.1|  PREDICTED: V-type proton ATPase subunit C 1        105   4e-23    Cuculus canorus
ref|XP_008430008.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    104   4e-23    Poecilia reticulata
ref|XP_001506621.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    105   5e-23    
dbj|BAE98945.1|  vacuolar ATP sythase subunit C                         103   5e-23    Arabidopsis thaliana [mouse-ear cress]
gb|KJB40644.1|  hypothetical protein B456_007G072500                    103   5e-23    Gossypium raimondii
ref|XP_008849773.1|  PREDICTED: V-type proton ATPase subunit C 1        105   5e-23    Nannospalax galili
ref|XP_007463323.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    105   5e-23    Lipotes vexillifer [baiji]
ref|XP_007550566.1|  PREDICTED: V-type proton ATPase subunit C 1-...    105   5e-23    Poecilia formosa
ref|XP_005803508.1|  PREDICTED: V-type proton ATPase subunit C 1-...    105   5e-23    Xiphophorus maculatus
ref|NP_001040138.1|  vacuolar ATPase subunit C                          105   5e-23    Bombyx mori [silk moth]
gb|ETE73899.1|  V-type proton ATPase subunit C 1                        104   6e-23    Ophiophagus hannah
ref|XP_003375717.1|  vacuolar proton pump subunit C                     104   6e-23    Trichinella spiralis
ref|XP_006636047.1|  PREDICTED: V-type proton ATPase subunit C 1-...    104   7e-23    Lepisosteus oculatus
ref|XP_007550565.1|  PREDICTED: V-type proton ATPase subunit C 1-A      104   7e-23    Poecilia formosa
ref|XP_010883497.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    104   7e-23    Esox lucius
ref|XP_009888075.1|  PREDICTED: V-type proton ATPase subunit C 2        104   8e-23    Charadrius vociferus
ref|XP_010017127.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    104   8e-23    Nestor notabilis
ref|NP_958479.1|  V-type proton ATPase subunit C 1-A                    104   8e-23    Danio rerio [leopard danio]
ref|XP_005014174.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    104   8e-23    
ref|XP_010391623.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    103   8e-23    
gb|EOB05348.1|  Vacuolar proton pump subunit C 2                        104   9e-23    Anas platyrhynchos [duck]
ref|XP_010391621.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    103   9e-23    Corvus cornix cornix
dbj|BAM20425.1|  vacuolar H[+] ATPase 44kD C subunit                    104   9e-23    Papilio polytes
ref|XP_005917491.1|  PREDICTED: V-type proton ATPase subunit C 1-...    104   1e-22    Haplochromis burtoni
ref|XP_003444114.1|  PREDICTED: V-type proton ATPase subunit C 1-...    104   1e-22    Oreochromis niloticus
ref|XP_005728447.1|  PREDICTED: V-type proton ATPase subunit C 1-...    104   1e-22    Pundamilia nyererei
ref|XP_003965909.1|  PREDICTED: V-type proton ATPase subunit C 1-...    103   1e-22    Takifugu rubripes [tiger puffer]
emb|CEF66863.1|  V-type proton ATPase subunit C 2                       103   1e-22    Strongyloides ratti
ref|XP_004074259.1|  PREDICTED: V-type proton ATPase subunit C 1-...    103   1e-22    Oryzias latipes [Japanese rice fish]
ref|XP_010206381.1|  PREDICTED: V-type proton ATPase subunit C 2        103   1e-22    Colius striatus
ref|XP_008290531.1|  PREDICTED: V-type proton ATPase subunit C 1        103   1e-22    Stegastes partitus
ref|XP_009273855.1|  PREDICTED: V-type proton ATPase subunit C 2        103   1e-22    Aptenodytes forsteri
ref|XP_008195426.1|  PREDICTED: V-type proton ATPase subunit C is...    103   1e-22    Tribolium castaneum [rust-red flour beetle]
ref|XP_007547766.1|  PREDICTED: V-type proton ATPase subunit C 1-...    103   1e-22    Poecilia formosa
ref|XP_009898136.1|  PREDICTED: V-type proton ATPase subunit C 2        103   1e-22    Picoides pubescens
ref|XP_009961798.1|  PREDICTED: V-type proton ATPase subunit C 2        103   1e-22    Tyto alba [Schleiereule]
ref|XP_004077677.1|  PREDICTED: V-type proton ATPase subunit C 1        103   1e-22    Oryzias latipes [Japanese rice fish]
ref|XP_009076362.1|  PREDICTED: V-type proton ATPase subunit C 1        103   2e-22    Acanthisitta chloris
ref|XP_008639998.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    Corvus brachyrhynchos
gb|KDD72700.1|  hypothetical protein H632_c3002p0                       101   2e-22    Helicosporidium sp. ATCC 50920
ref|XP_005042435.1|  PREDICTED: V-type proton ATPase subunit C 1        103   2e-22    Ficedula albicollis
ref|XP_008922269.1|  PREDICTED: V-type proton ATPase subunit C 1        103   2e-22    
ref|XP_008115724.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_010304194.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_006138599.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_009946938.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_011305233.1|  PREDICTED: V-type proton ATPase subunit C          103   2e-22    
ref|XP_010114737.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_005044330.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    103   2e-22    
ref|XP_008493333.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_005420348.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_001814187.1|  PREDICTED: V-type proton ATPase subunit C is...    103   2e-22    
ref|XP_011067212.1|  PREDICTED: V-type proton ATPase subunit C          103   2e-22    
gb|KFO20049.1|  V-type proton ATPase subunit C 1                        103   2e-22    
gb|ADK26726.1|  ATPase, H+ transporting, lysosomal 42kDa, V1 subu...    103   2e-22    
gb|KFO95890.1|  V-type proton ATPase subunit C 2                        103   2e-22    
ref|XP_005487252.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_010610418.1|  PREDICTED: V-type proton ATPase subunit C 1        103   2e-22    
ref|XP_009330763.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_010166958.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_005521918.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
gb|KFQ83262.1|  V-type proton ATPase subunit C 2                        103   2e-22    
ref|XP_010004766.1|  PREDICTED: V-type proton ATPase subunit C 1        103   2e-22    
ref|XP_007513767.1|  V-type proton ATPase subunit C 1                   103   2e-22    
ref|XP_001960901.1|  GF11269                                            103   2e-22    
ref|XP_005506895.1|  PREDICTED: V-type proton ATPase subunit C 2        103   2e-22    
ref|XP_010222647.1|  PREDICTED: V-type proton ATPase subunit C 2        103   3e-22    
gb|KHN24290.1|  V-type proton ATPase subunit C                          100   3e-22    
ref|XP_009680642.1|  PREDICTED: V-type proton ATPase subunit C 1        103   3e-22    
gb|ELT96241.1|  hypothetical protein CAPTEDRAFT_179819                  103   3e-22    
ref|XP_005150964.1|  PREDICTED: V-type proton ATPase subunit C 1        103   3e-22    
ref|XP_008865718.1|  hypothetical protein H310_03575                    103   3e-22    
ref|XP_007427660.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    102   3e-22    
ref|XP_008935556.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
ref|XP_002196413.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
ref|XP_003219499.1|  PREDICTED: V-type proton ATPase subunit C 1        102   3e-22    
ref|XP_009940357.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
dbj|BAB24526.1|  unnamed protein product                                102   3e-22    
ref|XP_003055517.1|  H+-or Na+-translocating f-type, v-type and A...    102   3e-22    
ref|XP_009463723.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
ref|XP_009513285.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
ref|XP_010706218.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
ref|XP_010018610.1|  PREDICTED: V-type proton ATPase subunit C 2        102   3e-22    
ref|XP_009557935.1|  PREDICTED: V-type proton ATPase subunit C 2        102   4e-22    
ref|XP_010189303.1|  PREDICTED: V-type proton ATPase subunit C 2        102   4e-22    
ref|XP_008559568.1|  PREDICTED: V-type proton ATPase subunit C          102   4e-22    
ref|XP_008930944.1|  PREDICTED: V-type proton ATPase subunit C 2        102   4e-22    
gb|KFW86282.1|  V-type proton ATPase subunit C 2                        102   4e-22    
ref|XP_010073164.1|  PREDICTED: V-type proton ATPase subunit C 2        102   4e-22    
ref|XP_006626108.1|  PREDICTED: V-type proton ATPase subunit C 1-...    102   4e-22    
ref|XP_007488240.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    102   4e-22    
ref|XP_010751636.1|  PREDICTED: V-type proton ATPase subunit C 1-A      102   5e-22    
ref|XP_001369362.2|  PREDICTED: V-type proton ATPase subunit C 1 ...    102   5e-22    
ref|XP_009997448.1|  PREDICTED: V-type proton ATPase subunit C 2        102   5e-22    
gb|KFO75224.1|  V-type proton ATPase subunit C 2                        102   6e-22    
ref|XP_007488239.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    102   6e-22    
ref|XP_009913271.1|  PREDICTED: V-type proton ATPase subunit C 2        102   6e-22    
ref|XP_007249407.1|  PREDICTED: V-type proton ATPase subunit C 1-...    102   6e-22    
ref|XP_009666472.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    101   6e-22    
ref|XP_009093493.1|  PREDICTED: V-type proton ATPase subunit C 2        102   6e-22    
ref|XP_009981654.1|  PREDICTED: V-type proton ATPase subunit C 2        102   7e-22    
gb|KFU90777.1|  V-type proton ATPase subunit C 2                        102   7e-22    
gb|KFQ17703.1|  V-type proton ATPase subunit C 1                        102   7e-22    
ref|XP_010130330.1|  PREDICTED: V-type proton ATPase subunit C 2        102   7e-22    
ref|XP_419951.1|  PREDICTED: V-type proton ATPase subunit C 2 iso...    102   7e-22    
ref|XP_011144745.1|  PREDICTED: V-type proton ATPase subunit C          101   7e-22    
ref|XP_011268884.1|  PREDICTED: V-type proton ATPase subunit C          101   8e-22    
ref|XP_001639878.1|  predicted protein                                  101   8e-22    
ref|XP_005146159.1|  PREDICTED: V-type proton ATPase subunit C 2        101   9e-22    
gb|KFV15258.1|  V-type proton ATPase subunit C 2                        101   1e-21    
ref|XP_009666385.1|  PREDICTED: V-type proton ATPase subunit C 2 ...    101   1e-21    
ref|XP_008211658.1|  PREDICTED: V-type proton ATPase subunit C is...    101   1e-21    
ref|XP_009702306.1|  PREDICTED: V-type proton ATPase subunit C 2        101   1e-21    
ref|NP_477266.1|  vacuolar H[+] ATPase 44kD subunit, isoform A          101   1e-21    
gb|AAB62571.1|  V-ATPase C subunit                                      101   1e-21    
ref|XP_002015982.1|  GL11349                                            101   1e-21    
ref|XP_006562159.1|  PREDICTED: V-type proton ATPase subunit C is...    101   1e-21    
gb|EGI57447.1|  V-type proton ATPase subunit C                          100   1e-21    
ref|XP_011504285.1|  PREDICTED: V-type proton ATPase subunit C is...    100   1e-21    
ref|XP_001946227.1|  PREDICTED: V-type proton ATPase subunit C          100   2e-21    
ref|XP_003968986.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   2e-21    
ref|XP_009638104.1|  PREDICTED: V-type proton ATPase subunit C 2        100   2e-21    
gb|KFB48532.1|  AGAP005845-PA-like protein                              100   2e-21    
ref|XP_002408654.1|  C subunit of V-ATPase, putative                    100   2e-21    
ref|XP_011332474.1|  PREDICTED: V-type proton ATPase subunit C is...    100   2e-21    
ref|XP_006611433.1|  PREDICTED: V-type proton ATPase subunit C-li...    100   2e-21    
ref|XP_003760347.1|  PREDICTED: V-type proton ATPase subunit C 1 ...    100   2e-21    
ref|NP_001005772.2|  V-type proton ATPase subunit C 1-B                 100   2e-21    
ref|XP_315870.4|  AGAP005845-PA                                         100   3e-21    
ref|XP_008500896.1|  PREDICTED: V-type proton ATPase subunit C 1        100   3e-21    
ref|XP_008329974.1|  PREDICTED: V-type proton ATPase subunit C 1-...    100   3e-21    
ref|XP_002585525.1|  hypothetical protein BRAFLDRAFT_60009              100   3e-21    
gb|KDO34219.1|  hypothetical protein SPRG_01434                         100   3e-21    
gb|KFP35023.1|  V-type proton ATPase subunit C 1                        100   3e-21    
ref|XP_003741777.1|  PREDICTED: V-type proton ATPase subunit C 1-...  99.8    3e-21    
ref|XP_005867290.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  99.8    4e-21    
ref|XP_009291607.1|  PREDICTED: V-type proton ATPase subunit C 1-...  99.8    4e-21    
ref|XP_008611986.1|  hypothetical protein SDRG_07905                  99.8    4e-21    
ref|XP_001201267.2|  PREDICTED: V-type proton ATPase subunit C-like   99.8    4e-21    
ref|XP_006012217.1|  PREDICTED: V-type proton ATPase subunit C 1-...  99.4    5e-21    
gb|EFX90034.1|  hypothetical protein DAPPUDRAFT_205240                99.4    5e-21    
ref|XP_010771260.1|  PREDICTED: V-type proton ATPase subunit C 1      99.4    5e-21    
ref|XP_009585692.1|  PREDICTED: V-type proton ATPase subunit C 2      99.4    5e-21    
ref|XP_007895280.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  99.0    5e-21    
ref|XP_005867289.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  99.8    5e-21    
ref|XP_007476197.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  99.4    6e-21    
gb|ERG84842.1|  v-type proton atpase subunit c                        99.4    6e-21    
gb|AIJ50380.1|  V-ATPase subunit C                                    99.0    6e-21    
gb|KFV98778.1|  V-type proton ATPase subunit C 2                      99.4    7e-21    
ref|XP_008178102.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  99.0    8e-21    
ref|XP_005293177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  98.6    8e-21    
ref|XP_007476196.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  99.0    8e-21    
ref|XP_008304955.1|  PREDICTED: V-type proton ATPase subunit C 1-A    98.6    9e-21    
ref|XP_009068581.1|  PREDICTED: V-type proton ATPase subunit C 2      98.6    1e-20    
ref|XP_001503588.2|  PREDICTED: V-type proton ATPase subunit C 2 ...  98.6    1e-20    
ref|NP_001279559.1|  ATPase, H+ transporting, lysosomal 42kDa, V1...  98.2    1e-20    
emb|CCA27664.1|  H or Na translocating Ftype putative                 98.6    1e-20    
ref|XP_009051892.1|  hypothetical protein LOTGIDRAFT_206255           98.2    1e-20    
ref|XP_001899274.1|  V-ATPase subunit C family protein                98.2    1e-20    
ref|XP_005600280.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  98.6    1e-20    
ref|XP_001503590.2|  PREDICTED: V-type proton ATPase subunit C 2 ...  98.6    1e-20    
emb|CCI43247.1|  unnamed protein product                              98.2    2e-20    
ref|XP_002107808.1|  hypothetical protein TRIADDRAFT_19844            97.8    2e-20    
sp|Q9NDR5.1|VATC_ASCSS  RecName: Full=V-type proton ATPase subuni...  97.8    2e-20    
gb|ABO61291.1|  vacuolar ATPase subunit C                             97.8    2e-20    
ref|XP_010145781.1|  PREDICTED: V-type proton ATPase subunit C 1-...  94.4    2e-20    
emb|CDQ00984.1|  Protein Bm13998, isoform h                           98.2    2e-20    
ref|XP_006765238.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.4    3e-20    
ref|XP_006191924.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.1    3e-20    
ref|XP_010774232.1|  PREDICTED: V-type proton ATPase subunit C 1-...  94.0    3e-20    
gb|ELK29162.1|  V-type proton ATPase subunit C 2                      97.1    3e-20    
ref|XP_004401844.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.1    3e-20    
gb|EFB24562.1|  hypothetical protein PANDA_010456                     97.8    3e-20    
ref|XP_006765239.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.4    3e-20    
ref|XP_006197175.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.4    4e-20    
ref|XP_004401843.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.4    4e-20    
ref|XP_006191923.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  97.4    4e-20    
ref|XP_004745856.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  96.7    4e-20    
ref|XP_006257984.1|  PREDICTED: V-type proton ATPase subunit C 2      96.3    6e-20    
gb|AFW81322.1|  hypothetical protein ZEAMMB73_736936                  95.5    6e-20    
ref|XP_006021843.1|  PREDICTED: V-type proton ATPase subunit C 2      96.3    6e-20    
ref|XP_005174884.1|  PREDICTED: V-type proton ATPase subunit C        96.3    6e-20    
ref|XP_532875.2|  PREDICTED: V-type proton ATPase subunit C 2 iso...  96.3    6e-20    
ref|XP_004745855.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  96.7    6e-20    
ref|XP_004356034.1|  H(+)-transporting ATPase                         96.3    7e-20    
ref|XP_008160638.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  96.3    7e-20    
ref|XP_005630177.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  96.3    7e-20    
gb|EDM03150.1|  ATPase, H+ transporting, V1 subunit C, isoform 2,...  94.7    8e-20    
gb|EMS52578.1|  V-type proton ATPase subunit C                        92.4    8e-20    
ref|XP_006010910.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  95.9    9e-20    
ref|XP_008528126.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.9    9e-20    
ref|XP_856922.1|  PREDICTED: V-type proton ATPase subunit C 2 iso...  96.3    9e-20    
ref|XP_009012372.1|  hypothetical protein HELRODRAFT_156435           95.9    9e-20    
ref|XP_008160637.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  96.3    9e-20    
ref|XP_001505940.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.9    1e-19    
ref|XP_004686496.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.5    1e-19    
ref|XP_002900761.1|  H - or Na -translocating F-type, V-type and ...  95.1    1e-19    
ref|XP_006515262.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.5    1e-19    
ref|XP_001505973.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.9    1e-19    
ref|XP_007053234.1|  PREDICTED: V-type proton ATPase subunit C 2      95.5    1e-19    
ref|XP_008687451.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  95.1    1e-19    
emb|CEF60497.1|  V-type proton ATPase subunit C 2                     95.5    1e-19    
ref|XP_008528124.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.9    1e-19    
ref|XP_011227437.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  94.7    2e-19    
ref|XP_004533485.1|  PREDICTED: V-type proton ATPase subunit C-li...  95.1    2e-19    
ref|XP_004686495.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.5    2e-19    
ref|XP_011181512.1|  PREDICTED: V-type proton ATPase subunit C        95.1    2e-19    
ref|XP_005044329.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  95.1    2e-19    
ref|NP_598460.1|  V-type proton ATPase subunit C 2 isoform 2          95.5    2e-19    
ref|XP_011205545.1|  PREDICTED: V-type proton ATPase subunit C        95.1    2e-19    
ref|XP_003501279.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.7    2e-19    
ref|XP_008895950.1|  hypothetical protein PPTG_03917                  95.1    2e-19    
ref|XP_005366579.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.7    2e-19    
gb|EDK98490.1|  ATPase, H+ transporting, lysosomal V1 subunit C2,...  95.5    3e-19    
ref|XP_005576619.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    3e-19    
ref|XP_005967907.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    3e-19    
ref|XP_005327420.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    3e-19    
gb|EMT09639.1|  V-type proton ATPase subunit C                        90.9    3e-19    
ref|XP_008480724.1|  PREDICTED: V-type proton ATPase subunit C        94.4    3e-19    
ref|XP_007969683.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    3e-19    
gb|EPY75601.1|  V-type proton ATPase subunit C 2 isoform 1            94.0    4e-19    
ref|XP_004373118.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    4e-19    
gb|EFA81774.1|  H+-transporting ATPase                                94.0    4e-19    
ref|XP_009170324.1|  hypothetical protein T265_06723                  94.4    4e-19    
gb|ETN76972.1|  v-ATPase subunit C                                    93.6    4e-19    
ref|NP_001014221.1|  V-type proton ATPase subunit C 2                 94.4    4e-19    
gb|EGT48628.1|  CBN-VHA-11 protein                                    94.0    4e-19    
ref|XP_004436528.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    4e-19    
ref|XP_003501278.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    5e-19    
ref|XP_003462750.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.6    5e-19    
ref|XP_001095057.1|  PREDICTED: v-type proton ATPase subunit C 2-...  94.0    5e-19    
ref|XP_005327419.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    5e-19    
ref|XP_005576617.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    5e-19    
ref|XP_005366577.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    5e-19    
emb|CAF93730.1|  unnamed protein product                              93.6    5e-19    
ref|XP_006241664.1|  PREDICTED: V-type proton ATPase subunit C 1 ...  93.6    5e-19    
ref|XP_008686356.1|  PREDICTED: V-type proton ATPase subunit C 2      95.1    5e-19    
ref|XP_008248062.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...  94.4    5e-19    
gb|AAA36803.1|  H+ -ATPase C subunit                                  93.2    5e-19    
ref|XP_005687060.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    5e-19    
ref|XP_003787440.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.6    5e-19    
ref|XP_004373117.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    5e-19    
gb|AAT44904.1|  V-type ATPase C2 subunit a isoform                    94.0    5e-19    
ref|XP_007969681.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    6e-19    
ref|XP_005967906.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    6e-19    
dbj|GAM28923.1|  hypothetical protein SAMD00019534_120990             93.6    6e-19    
ref|XP_005687059.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.4    6e-19    
ref|XP_002758079.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    7e-19    
ref|XP_004665751.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    7e-19    
ref|XP_003139516.1|  V-ATPase subunit C family protein                93.2    7e-19    
ref|XP_007456981.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    7e-19    
ref|XP_004642383.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    8e-19    
ref|XP_004436527.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.6    8e-19    
ref|XP_007969679.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  94.0    8e-19    
dbj|GAA48137.1|  V-type proton ATPase subunit C 1-A                   94.7    8e-19    
ref|XP_003787441.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.6    9e-19    
ref|XP_010336242.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    9e-19    
ref|XP_007529903.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    9e-19    
ref|XP_009521709.1|  hypothetical protein PHYSODRAFT_359667           93.6    9e-19    
ref|XP_010377972.1|  PREDICTED: V-type proton ATPase subunit C 2      93.6    9e-19    
ref|XP_004696091.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  92.8    9e-19    
ref|XP_010336241.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  93.2    1e-18    
ref|XP_006869522.1|  PREDICTED: V-type proton ATPase subunit C 2 ...  92.8    1e-18    



>dbj|BAO57286.1| V-type proton ATPase subunit [Ipomoea nil]
Length=376

 Score =   325 bits (834),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 173/173 (100%), Positives = 173/173 (100%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTLDLLLALSDD
Sbjct  1    MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTLDLLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  61   LVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_006363973.1| PREDICTED: V-type proton ATPase subunit C-like [Solanum tuberosum]
Length=376

 Score =   304 bits (778),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+FIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LVKSNSFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EYSNVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_004235295.1| PREDICTED: V-type proton ATPase subunit C [Solanum lycopersicum]
Length=376

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+FIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LIKSNSFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+NVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNVRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_009786911.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana sylvestris]
Length=376

 Score =   301 bits (772),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSNNFIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LVKSNNFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+H+QVAKIEDDLKVRV+EY+NVRSQLNAINRKQ GSLAVRDLSNLVK
Sbjct  121  KEIVDGIHTQVAKIEDDLKVRVSEYNNVRSQLNAINRKQAGSLAVRDLSNLVK  173



>ref|XP_009618992.1| PREDICTED: V-type proton ATPase subunit C [Nicotiana tomentosiformis]
Length=376

 Score =   300 bits (767),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 165/173 (95%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQQ+SS TSLWSRLQ+SIS++SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQQNSSTTSLWSRLQESISRHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+FIEGVCSK RRQIEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  61   LVKSNSFIEGVCSKTRRQIEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+H+QVAKIEDDLKVRV+EY+NVRSQLNAINRKQ GSLAVRDLSNLVK
Sbjct  121  KEIVDGIHTQVAKIEDDLKVRVSEYNNVRSQLNAINRKQAGSLAVRDLSNLVK  173



>emb|CDP15722.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M +RYW+VSLP+Q +SS +SLWSRLQ+SISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MTTRYWIVSLPIQNNSSPSSLWSRLQESISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+K+N+FIEGV  KIRRQIEELE+ SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  61   LLKNNSFIEGVSHKIRRQIEELEKVSGVVSSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  REIVDGIHTQIAKIEDDLKVRVAEYNNVRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_002512862.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
 gb|EEF49365.1| vacuolar ATP synthase subunit C, putative [Ricinus communis]
Length=376

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 164/173 (95%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+RLQD ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNRLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+FIEGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPT+SPL
Sbjct  59   LVKSNSFIEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTISPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +ETVD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  RETVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KCW64319.1| hypothetical protein EUGRSUZ_G01949 [Eucalyptus grandis]
Length=218

 Score =   279 bits (714),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MASRYWVVSLPVQQ S+SA SLW+RLQ+ IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLQEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTRFVWDDAKYPAMAP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  174



>gb|EYU24479.1| hypothetical protein MIMGU_mgv1a006812mg [Erythranthe guttata]
Length=430

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 159/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWV SLPV Q +SA+SLWSRLQ+SISK SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  55   MATRYWVASLPVGQGTSASSLWSRLQESISKQSFDTPLYRFNIPNLRVGTLDSLLSLSDD  114

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L K+N+FIEGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  115  LSKANSFIEGVSHKIRRQIEELERVSGVVSSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  174

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KETVDG+H Q+A+IEDDLKVRVAEY NVRSQLN I+RKQ GSLAVRDLSN+VK
Sbjct  175  KETVDGIHVQIARIEDDLKVRVAEYGNVRSQLNTISRKQAGSLAVRDLSNMVK  227



>ref|XP_007215551.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
 gb|EMJ16750.1| hypothetical protein PRUPE_ppa007256mg [Prunus persica]
Length=376

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_008231040.1| PREDICTED: V-type proton ATPase subunit C [Prunus mume]
Length=376

 Score =   284 bits (727),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/173 (87%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_011083360.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   283 bits (725),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M +RYWV SLPV Q SSA++LWSRLQ+SISK +FDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MTTRYWVASLPVGQGSSASTLWSRLQESISKQAFDTPLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+K+N+FIEGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LLKANSFIEGVSHKIRRQIEELERVSGVVSSSLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNLVK
Sbjct  121  REIVDGIHVQIAKIEDDLKVRVAEYNNVRSQLNAINRKQAGSLAVRDLSNLVK  173



>ref|XP_011073132.1| PREDICTED: V-type proton ATPase subunit C-like [Sesamum indicum]
Length=376

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWV SLPV Q SSA+SLWSRLQ+SISK +FDT LYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MATRYWVASLPVSQGSSASSLWSRLQESISKQAFDTSLYRFNIPNLRVGTLDSLLALSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+K+N+FIEGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRF+WDEAKYPTMSPL
Sbjct  61   LLKANSFIEGVSHKIRRQIEELERVSGVVSSSLTVDGVPVDSYLTRFMWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNLVK
Sbjct  121  REIVDGIHVQIAKIEDDLKVRVAEYNNVRSQLNAINRKQAGSLAVRDLSNLVK  173



>ref|XP_011468207.1| PREDICTED: V-type proton ATPase subunit C [Fragaria vesca subsp. 
vesca]
Length=375

 Score =   283 bits (723),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA+SLW+RLQD ISK+SFDTPLYRF+IPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQDQISKHSFDTPLYRFHIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KIRRQIEELE+ SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELEKISGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE +D +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEIIDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KDO47366.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=257

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+F+E V  KIRRQIEELER SG+ SSSL+VDGVPVD+YLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_003518129.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN00618.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ  +SA++LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPVQ--NSASTLWNKLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
             VKSN+F+EGV  KIRRQIEELER SGV SS LTVDGVPVDSYLTRFVWDEA+YPTMSPL
Sbjct  59   TVKSNSFVEGVSHKIRRQIEELERVSGVVSSGLTVDGVPVDSYLTRFVWDEARYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE +DG+H QVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  119  KEIIDGIHGQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  171



>gb|KDO47363.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47364.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47365.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=303

 Score =   278 bits (711),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+F+E V  KIRRQIEELER SG+ SSSL+VDGVPVD+YLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_010096044.1| V-type proton ATPase subunit C [Morus notabilis]
 gb|EXB62850.1| V-type proton ATPase subunit C [Morus notabilis]
Length=384

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWV+SL VQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPN+RVGTLD LL+LSDD
Sbjct  1    MASRYWVISLTVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNIRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+HSQVAKIEDDLKVR+AEY+NVRSQLNAINRKQ GSLAVRDLSNLVK
Sbjct  119  REIVDGIHSQVAKIEDDLKVRIAEYNNVRSQLNAINRKQAGSLAVRDLSNLVK  171



>gb|KDP41839.1| hypothetical protein JCGZ_26857 [Jatropha curcas]
Length=376

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW+VSLPVQ  +SA++LW+RLQD ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWMVSLPVQ--NSASTLWNRLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SGV SS+LTVDG+PVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGVESSALTVDGIPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD +HSQVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  REIVDNIHSQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVK  171



>ref|XP_010663792.1| PREDICTED: V-type proton ATPase subunit C isoform X2 [Vitis vinifera]
Length=319

 Score =   278 bits (712),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPV   +SA+SLWSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPV--PTSASSLWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVTHKIRRQIEELERGSGGESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  119  REIVDGIHVQVAKIEDDLKVRVAEYNNVRSQLNAINRKQTGSLAVRDLSNLVK  171



>ref|XP_003553974.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=377

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 159/173 (92%), Gaps = 1/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPV  S+S + LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVHNSAS-SQLWNQLQERISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  59

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSNNF+EGV  KIRRQIEELER SG+ S +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  60   LAKSNNFVEGVTHKIRRQIEELERVSGIDSGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  119

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  120  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  172



>gb|KCW64313.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=228

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MASRYWVVSLPVQQ S+SA SLW+RL + IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLLEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLT+FVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTKFVWDDAKYPAMAP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  174



>ref|XP_010068642.1| PREDICTED: V-type proton ATPase subunit C-like [Eucalyptus grandis]
Length=329

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MASRYWVVSLPVQQ S+SA SLW+RLQ+ IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLQEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLTRFVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTRFVWDDAKYPAMAP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  174



>ref|XP_008341246.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C-like [Malus domestica]
Length=299

 Score =   277 bits (708),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLP Q  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPAQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KIR QIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRXQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLN INRKQ+GSLAVRDLS LVK
Sbjct  119  KEIVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNXINRKQSGSLAVRDLSGLVK  171



>ref|XP_009378027.1| PREDICTED: V-type proton ATPase subunit C [Pyrus x bretschneideri]
Length=376

 Score =   279 bits (714),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLP Q  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPAQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS LVK
Sbjct  119  KEIVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSGLVK  171



>emb|CDY19421.1| BnaC05g09300D [Brassica napus]
Length=377

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV++ SS+T+LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKEDSSSTTLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  61   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  121  KEVVDSIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  173



>ref|XP_006599411.1| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
 gb|KHN13381.1| V-type proton ATPase subunit C [Glycine soja]
Length=375

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ  +SA++LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPVQ--NSASTLWNKLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+F+EGV  KIRRQIEELER SGV SS LTVDGVPVDSYLTRFVWDEA+YPTMSPL
Sbjct  59   LVKSNSFVEGVSHKIRRQIEELERVSGVMSSGLTVDGVPVDSYLTRFVWDEARYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE +DG+H QVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLS+LVK
Sbjct  119  KEIIDGIHGQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSDLVK  171



>ref|XP_007031994.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
 gb|EOY02920.1| Vacuolar ATP synthase subunit C (VATC) / V-ATPase C subunit / 
vacuolar proton pump C subunit (DET3) [Theobroma cacao]
Length=375

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFIEGVSHKIRRQIEELERVSGMESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KHN28568.1| V-type proton ATPase subunit C [Glycine soja]
Length=383

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 1/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPV  S+S + LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVHNSAS-SQLWNQLQERISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  59

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSNNF+EGV  KIRRQIEELER SG+ + +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  60   LAKSNNFVEGVTHKIRRQIEELERVSGIDTGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  119

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  120  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  172



>gb|ABH07428.1| vacuolar H+-ATPase subunit C [Gossypium hirsutum]
Length=377

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  SSA++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--SSASTLWNNLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SG+ +++LTVDGVPVDSYLTRFVWDEAKYP MSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLETNALTVDGVPVDSYLTRFVWDEAKYPIMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_002284444.1| PREDICTED: V-type proton ATPase subunit C isoform X1 [Vitis vinifera]
 emb|CBI15738.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPV   +SA+SLWSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPV--PTSASSLWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVTHKIRRQIEELERGSGGESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  119  REIVDGIHVQVAKIEDDLKVRVAEYNNVRSQLNAINRKQTGSLAVRDLSNLVK  171



>ref|XP_007161646.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
 gb|ESW33640.1| hypothetical protein PHAVU_001G086700g [Phaseolus vulgaris]
Length=376

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPV   +SA+ LW+++Q+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVH--NSASQLWNQVQERISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSNNF+EGV  KIRRQIEELER SGV    LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNNFVEGVTQKIRRQIEELERVSGVDGGGLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  119  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  171



>gb|KJB40647.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=323

 Score =   275 bits (704),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVK  171



>ref|XP_006373109.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50906.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=366

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPVQ  +SA+S+W+ LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVQ--NSASSVWNNLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LV+SN+FIEGV  KIRRQIEEL+R SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVRSNSFIEGVAQKIRRQIEELQRVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEIVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KJB40646.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=336

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVK  171



>ref|XP_011001967.1| PREDICTED: V-type proton ATPase subunit C [Populus euphratica]
Length=376

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPVQ  +SA+S+W+ LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVQ--NSASSVWNNLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LV+SN+FIEGV  KIRRQIEEL+R SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVRSNSFIEGVAQKIRRQIEELQRVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEIVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_003624472.1| V-type proton ATPase subunit C [Medicago truncatula]
 gb|AES80690.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=378

 Score =   276 bits (707),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN F+EGV SKIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSSKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_006373110.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
 gb|ERP50907.1| hypothetical protein POPTR_0017s08810g [Populus trichocarpa]
Length=376

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPVQ  +SA+S+W+ LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWAVSLPVQ--NSASSVWNNLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LV+SN+FIEGV  KIRRQIEEL+R SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVRSNSFIEGVAQKIRRQIEELQRVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H+QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEIVDSIHTQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_006446960.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446961.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006446962.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 ref|XP_006468875.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468876.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Citrus 
sinensis]
 ref|XP_006468877.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Citrus 
sinensis]
 gb|ESR60200.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60201.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|ESR60202.1| hypothetical protein CICLE_v10015638mg [Citrus clementina]
 gb|KDO47360.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47361.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
 gb|KDO47362.1| hypothetical protein CISIN_1g017251mg [Citrus sinensis]
Length=375

 Score =   276 bits (706),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSAASVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+F+E V  KIRRQIEELER SG+ SSSL+VDGVPVD+YLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVESVSHKIRRQIEELERVSGIESSSLSVDGVPVDTYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KEH23490.1| vacuolar H+-ATPase subunit C [Medicago truncatula]
Length=386

 Score =   276 bits (707),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN F+EGV SKIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSSKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_003548919.2| PREDICTED: V-type proton ATPase subunit C-like [Glycine max]
Length=384

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPV   +SA+ LW++ Q+ ISK+SFDTPLYRFNIPNLR+GTLD LL+LSDD
Sbjct  9    MASRYWAVSLPV--PNSASQLWNQFQERISKHSFDTPLYRFNIPNLRIGTLDSLLSLSDD  66

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSNNF+EGV  KIRRQIEELER SG+ + +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  67   LAKSNNFVEGVTHKIRRQIEELERVSGIDTGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  126

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  127  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  179



>gb|ABD32569.1| V-ATPase subunit C [Medicago truncatula]
Length=382

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN F+EGV SKIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSSKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  121  KEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  173



>ref|XP_007151733.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
 gb|ESW23727.1| hypothetical protein PHAVU_004G070900g [Phaseolus vulgaris]
Length=376

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPV   +SA++LW++LQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWVVSLPV--PNSASTLWNKLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+F+EGV  KIRRQIE+LER SGV SSSLTVDGVPVDSYLTRFVWDEAKYPTMS L
Sbjct  59   LVKSNSFVEGVSLKIRRQIEDLERVSGVLSSSLTVDGVPVDSYLTRFVWDEAKYPTMSSL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KETVDG+H QVAKIEDDLKVRV+EY+N+RSQLN INRKQTGSLAVRDLSNLVK
Sbjct  119  KETVDGIHGQVAKIEDDLKVRVSEYNNIRSQLNTINRKQTGSLAVRDLSNLVK  171



>gb|KJB40648.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=375

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVK  171



>ref|XP_008379060.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C [Malus domestica]
Length=376

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA+SLW+RLQ+ ISK+SFDTPL  FNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPVQ--NSASSLWNRLQEKISKHSFDTPLLXFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KIRRQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNNFVEGVSHKIRRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE +D +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVIDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSSLVK  171



>gb|KJB40645.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=387

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ+S  A++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MANRYWVVSLPVQKS--ASTLWNSLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIEELER SG+ S++LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LFKSNTFIEGVSQKIRRQIEELERVSGLESNALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VK
Sbjct  119  REIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVK  171



>ref|XP_004150739.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus]
 ref|XP_004166274.1| PREDICTED: V-type proton ATPase subunit C-like [Cucumis sativus]
Length=376

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW+VSLPVQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWMVSLPVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN F+EGV  KIRRQIEELE+ SGV S+ LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFVEGVSQKIRRQIEELEKVSGVESNVLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            ++ VD +HSQVAKIEDDLK+RVAEY+NVRSQLNAINRKQ+GSLAVRD+SNLVK
Sbjct  119  RDIVDSIHSQVAKIEDDLKIRVAEYNNVRSQLNAINRKQSGSLAVRDISNLVK  171



>ref|XP_008463120.1| PREDICTED: V-type proton ATPase subunit C [Cucumis melo]
Length=376

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW+VSLPVQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWMVSLPVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN F+EGV  KIRRQIEELE+ SGV S+ LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFVEGVSQKIRRQIEELEKVSGVESNVLTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            ++ VD +HSQVAKIEDDLK+RVAEY+NVRSQLNAINRKQ+GSLAVRD+SNLVK
Sbjct  119  RDIVDSIHSQVAKIEDDLKIRVAEYNNVRSQLNAINRKQSGSLAVRDISNLVK  171



>ref|XP_006369829.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
 gb|ERP66398.1| Vacuolar ATP synthase subunit C family protein [Populus trichocarpa]
Length=376

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+  +SA+S+W+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLDLLLALSDD
Sbjct  1    MTSRYWVVSLPVE--NSASSVWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDLLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKS+NFIEGV  K RRQIEE ER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSSNFIEGVSHKTRRQIEEFERVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +HSQVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEIVDSIHSQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVK  171



>gb|EPS62747.1| hypothetical protein M569_12043, partial [Genlisea aurea]
Length=310

 Score =   273 bits (697),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWV SL V   SS++SLW RLQ+ IS+ +FDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  20   MATRYWVSSLAVGHGSSSSSLWIRLQELISRQAFDTPLYRFNIPNLRVGTLDSLLALSDD  79

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+FIEGV  KIRRQIEELE+ SGV SSSLTVDGVPVDSYLTRF WDEAKYPTMSPL
Sbjct  80   LLKSNSFIEGVSHKIRRQIEELEKISGVFSSSLTVDGVPVDSYLTRFSWDEAKYPTMSPL  139

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H Q+AKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNLVK
Sbjct  140  REIVDGIHGQIAKIEDDLKVRVAEYNNVRSQLNAINRKQAGSLAVRDLSNLVK  192



>gb|KCW64312.1| hypothetical protein EUGRSUZ_G019431, partial [Eucalyptus grandis]
Length=345

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MASRYWVVSLPVQQ S+SA SLW+RL + IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLLEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLT+FVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTKFVWDDAKYPAMAP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  174



>ref|XP_008775428.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Phoenix 
dactylifera]
Length=335

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  +SA+S WSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL LSDD
Sbjct  1    MAARYWIVSLPVQ--ASASSHWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLFLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIEE+ERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNTFIEGVSHKIRRQIEEMERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +ETVD +H QVAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNL+K
Sbjct  119  RETVDSIHVQVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLIK  171



>ref|XP_010494723.1| PREDICTED: V-type proton ATPase subunit C [Camelina sativa]
Length=375

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA+SLW RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWQRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KJB76317.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=323

 Score =   272 bits (696),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_010458722.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   274 bits (700),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA+SLW RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWQRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_010693540.1| PREDICTED: V-type proton ATPase subunit C [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   273 bits (699),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  SSA++LWS+LQ+S+SK SFDTPLYRFN+PNLRVGTLD LLAL+D+
Sbjct  1    MATRYWMVSLPVQ--SSASNLWSQLQESVSKQSFDTPLYRFNVPNLRVGTLDSLLALADE  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+++N F+EGV  KIRRQI+ELER+SGV   +LTVDGVP+DSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLRANAFVEGVTHKIRRQIDELERSSGVDGGALTVDGVPIDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+HS VAK+EDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDGIHSFVAKVEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_002275510.1| PREDICTED: V-type proton ATPase subunit C [Vitis vinifera]
 emb|CBI21291.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   273 bits (698),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 162/173 (94%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW VSLPV+  +SA+SLW+RLQD+ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MATRYWSVSLPVR--TSASSLWNRLQDAISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN+F+EGV  KIRRQIE+LE+ASGV +S+LTVDGVPVDSYLTRFVWDEAK+PTMSPL
Sbjct  59   LQKSNSFVEGVTHKIRRQIEDLEKASGVETSALTVDGVPVDSYLTRFVWDEAKFPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD +H QV+KIEDDLKVR+AEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDSIHHQVSKIEDDLKVRIAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KJB76320.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=345

 Score =   272 bits (696),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KJB76319.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=349

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_008775427.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Phoenix 
dactylifera]
Length=374

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  +SA+S WSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LL LSDD
Sbjct  1    MAARYWIVSLPVQ--ASASSHWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLFLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIEE+ERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNTFIEGVSHKIRRQIEEMERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +ETVD +H QVAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNL+K
Sbjct  119  RETVDSIHVQVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLIK  171



>ref|XP_010066422.1| PREDICTED: V-type proton ATPase subunit C [Eucalyptus grandis]
Length=378

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 159/174 (91%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MASRYWVVSLPVQQ S+SA SLW+RL + IS++SFDTPLYRFNIPNLRVGTLD LLALSD
Sbjct  1    MASRYWVVSLPVQQGSASAASLWNRLLEQISRHSFDTPLYRFNIPNLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DL KSN F+EGV  KIRRQIEELER SGV SSSLTVDGVPVDSYLT+FVWD+AKYP M+P
Sbjct  61   DLQKSNTFVEGVSHKIRRQIEELERVSGVESSSLTVDGVPVDSYLTKFVWDDAKYPAMAP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            L+ETVD +  QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  121  LRETVDTIQGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  174



>ref|NP_563916.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
 sp|Q9SDS7.1|VATC_ARATH RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar H(+)-ATPase subunit C; AltName: 
Full=Vacuolar proton pump subunit C [Arabidopsis thaliana]
 gb|AAF20146.1|AF208261_1 vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAF78489.1|AC012187_9 Identical to vacuolar ATP sythase subunit C (DET3) from Arabidopsis 
thaliana gb|AF208261. ESTs gb|AA067533, gb|Z37481, gb|AA721838, 
gb|Z37180, gb|T21206 come from this gene [Arabidopsis 
thaliana]
 gb|AAG50103.1|AF334725_1 putative vacuolar ATP synthase subunit C [Arabidopsis thaliana]
 gb|AAL24354.1| Identical to vacuolar ATP sythase subunit C (DET3) [Arabidopsis 
thaliana]
 gb|AAM13333.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
 dbj|BAH30291.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28936.1| V-type proton ATPase subunit C [Arabidopsis thaliana]
Length=375

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KJB76315.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76318.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
 gb|KJB76321.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=375

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYRFN+ NLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYRFNMSNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_009148561.1| PREDICTED: V-type proton ATPase subunit C [Brassica rapa]
 emb|CDX98037.1| BnaA06g07880D [Brassica napus]
Length=375

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_010528136.1| PREDICTED: V-type proton ATPase subunit C-like [Tarenaya hassleriana]
Length=376

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 160/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPV+ S  A+SLW+RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVKDS--ASSLWNRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERVSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD V +QVAKIEDDLKVR AEY+N+RSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEIVDSVQTQVAKIEDDLKVRAAEYNNIRSQLNAINRKQSGSLAVRDLSSLVK  171



>gb|AIY85415.1| V-ATPase subunit C1 [Eriobotrya japonica]
Length=376

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLP Q  +SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MASRYWVVSLPAQ--NSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSNNF+EGV  KI RQIEELER SGV SS+LTVDGVPVDSYLTRFVWDEA YPT+SPL
Sbjct  59   LLKSNNFVEGVSHKIGRQIEELERVSGVESSALTVDGVPVDSYLTRFVWDEAMYPTISPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS LVK
Sbjct  119  KEIVDSIHGQVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSGLVK  171



>emb|CDY21070.1| BnaA08g24550D [Brassica napus]
Length=376

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--SLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_010249179.1| PREDICTED: V-type proton ATPase subunit C-like [Nelumbo nucifera]
Length=375

 Score =   272 bits (695),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 159/171 (93%), Gaps = 2/171 (1%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            +RYWVVSLPVQ  +SA+SLW RLQ++ISKNSFDTPLYRFN P+LRVGTLD LL+LSDD++
Sbjct  5    ARYWVVSLPVQ--TSASSLWGRLQEAISKNSFDTPLYRFNTPDLRVGTLDSLLSLSDDIL  62

Query  332  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  511
            KSN+FIEGV  KIRRQIE+LER SGV SS+LTVDGVPVDSYLTRFVWDEAKYPTMSPL+E
Sbjct  63   KSNSFIEGVSQKIRRQIEDLERTSGVESSALTVDGVPVDSYLTRFVWDEAKYPTMSPLRE  122

Query  512  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
             VD +H QV+KIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSNLVK
Sbjct  123  IVDSIHVQVSKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNLVK  173



>emb|CDY66539.1| BnaCnng51300D [Brassica napus]
Length=376

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--SLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_002889973.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66232.1| de-etiolated 3 [Arabidopsis lyrata subsp. lyrata]
Length=378

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA++LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASTLWNRLQEQISKHSFDTPIYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_011045799.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Populus 
euphratica]
 ref|XP_011045800.1| PREDICTED: V-type proton ATPase subunit C-like isoform X3 [Populus 
euphratica]
Length=375

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+  +SA+S+W+RLQ+ ISK+SFDTPLYRFNIP+LRVGTLD LLALSDD
Sbjct  1    MTSRYWVVSLPVE--NSASSVWNRLQEQISKHSFDTPLYRFNIPSLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSNNFIEGV  K RRQIEE ER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNNFIEGVSHKTRRQIEEFERLSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +HSQV KIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEIVDSIHSQVVKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVK  171



>gb|KFK43549.1| hypothetical protein AALP_AA1G141200 [Arabis alpina]
Length=376

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA++LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASTLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>gb|KHM99227.1| V-type proton ATPase subunit C [Glycine soja]
Length=376

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 158/174 (91%), Gaps = 3/174 (2%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYW VSLPV   +SA+ LW++ Q+ ISK+SFDTPLYRFNIPNLR+GTLD LL+LSDD
Sbjct  1    MASRYWAVSLPV--PNSASQLWNQFQERISKHSFDTPLYRFNIPNLRIGTLDSLLSLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTR-FVWDEAKYPTMSP  502
            L KSNNF+EGV  KIRRQIEELER SG+ + +LTVDGVPVDSYLTR FVWDEAKYPTMSP
Sbjct  59   LAKSNNFVEGVTHKIRRQIEELERVSGIDTGALTVDGVPVDSYLTRLFVWDEAKYPTMSP  118

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE VDG+HSQVAKIEDDLKVRV+EY+N+RSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  119  LKEIVDGIHSQVAKIEDDLKVRVSEYNNIRSQLNAINRKQTGSLAVRDLSNLVK  172



>ref|XP_011045798.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 145/173 (84%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+  +SA+S+W+RLQ+ ISK+SFDTPLYRFNIP+LRVGTLD LLALSDD
Sbjct  1    MTSRYWVVSLPVE--NSASSVWNRLQEQISKHSFDTPLYRFNIPSLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSNNFIEGV  K RRQIEE ER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LVKSNNFIEGVSHKTRRQIEEFERLSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD +HSQV KIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEIVDSIHSQVVKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSDLVK  171



>ref|XP_006417188.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
 gb|ESQ35541.1| hypothetical protein EUTSA_v10007948mg [Eutrema salsugineum]
Length=375

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV++S  A+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKES--ASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSSLVK  171



>ref|XP_008808181.1| PREDICTED: V-type proton ATPase subunit C-like [Phoenix dactylifera]
Length=374

 Score =   271 bits (693),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  SSA+SLWSRLQ+SISK+SFDTPLYRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSLWSRLQESISKHSFDTPLYRFNTPDLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIE+LERASGV   +LTVDGVPVDSYLTRFVWDE+KYPTMSPL
Sbjct  59   LAKSNAFIEGVSHKIRRQIEDLERASGVEGGALTVDGVPVDSYLTRFVWDESKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD +H QVAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDTIHVQVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_006305100.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
 gb|EOA37998.1| hypothetical protein CARUB_v10009467mg [Capsella rubella]
Length=375

 Score =   271 bits (693),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LL L DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLGLGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNTFVEGVSQKIRRQIEELERTSGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSDLVK  171



>tpg|DAA59221.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=212

 Score =   264 bits (675),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   ++ATSLWSRLQD IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATATSLWSRLQDGISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMS 
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVDSGALTVDGVPVDTYLTRFVWDEGKYPTMSS  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLTAINRKQSGSLAVRDLSNLVK  174



>gb|AAO72561.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
Length=408

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +2

Query  143  EMASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllals  319
            EMA+RYW+VSLPVQ   S+A SLW+RLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALS
Sbjct  40   EMATRYWIVSLPVQTPGSTANSLWARLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALS  99

Query  320  ddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMS  499
            DDLVKSN FIEGV  KIRRQIEELERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMS
Sbjct  100  DDLVKSNVFIEGVSHKIRRQIEELERAGGVESGALTVDGVPVDTYLTRFVWDEGKYPTMS  159

Query  500  PLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            PLKE    + SQV+KIEDD+KVR AEY+NVRSQLNAINRKQTGSLAVRDLSNLVK
Sbjct  160  PLKEIAGSIQSQVSKIEDDMKVRGAEYNNVRSQLNAINRKQTGSLAVRDLSNLVK  214



>ref|XP_010476263.1| PREDICTED: V-type proton ATPase subunit C-like [Camelina sativa]
Length=375

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+   SA+SLW RLQD ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVK--DSASSLWQRLQDQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER S V S++LTVDGVPVDSYLTRF+WDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISEVESNALTVDGVPVDSYLTRFMWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>emb|CDX71966.1| BnaC08g29080D [Brassica napus]
Length=378

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVK  171



>ref|XP_009110617.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=376

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SR WVVSLPV+ SSS  SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRCWVVSLPVKDSSS--SLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|NP_001056500.1| Os05g0593100 [Oryza sativa Japonica Group]
 gb|AAT44305.1| putative vacuolar ATP synthase subunit C [Oryza sativa Japonica 
Group]
 dbj|BAF18414.1| Os05g0593100 [Oryza sativa Japonica Group]
 dbj|BAG88149.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94456.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79794.1| hypothetical protein OsI_21221 [Oryza sativa Indica Group]
 gb|EEE64903.1| hypothetical protein OsJ_19763 [Oryza sativa Japonica Group]
Length=377

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   S+A SLW+RLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQTPGSTANSLWARLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN FIEGV  KIRRQIEELERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFIEGVSHKIRRQIEELERAGGVESGALTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQV+KIEDD+KVR AEY+NVRSQL+AINRKQTGSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVSKIEDDMKVRGAEYNNVRSQLSAINRKQTGSLAVRDLSNLVK  174



>ref|XP_009118052.1| PREDICTED: V-type proton ATPase subunit C-like [Brassica rapa]
Length=378

 Score =   268 bits (686),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVK  171



>ref|XP_002441624.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
 gb|EES20054.1| hypothetical protein SORBIDRAFT_09g030620 [Sorghum bicolor]
Length=377

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   ++A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVESGTLTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVK  174



>ref|XP_006655657.1| PREDICTED: V-type proton ATPase subunit C-like [Oryza brachyantha]
Length=377

 Score =   268 bits (685),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ  +++A SLW+RLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQTPAATANSLWARLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIEELERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEELERAGGVESGALTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE +  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIIGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVK  174



>ref|NP_001147632.1| LOC100281241 [Zea mays]
 gb|ACF83479.1| unknown [Zea mays]
 gb|ACG28176.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW79360.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSS-ATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   + A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGAIASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVESGTLTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVK  174



>ref|XP_010939292.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Elaeis 
guineensis]
Length=347

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  SSA+S WSRLQ+SISK SFDTP+YRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSRWSRLQESISKRSFDTPVYRFNTPDLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN F+EGV  KIRRQIEELERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNAFLEGVSHKIRRQIEELERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD +H  VAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDSIHVLVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>ref|XP_004493016.1| PREDICTED: V-type proton ATPase subunit C-like [Cicer arietinum]
Length=378

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWVVSLPVQ ++S++S+W++LQ +ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDD
Sbjct  1    MANRYWVVSLPVQNNNSSSSIWNQLQQNISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDD  60

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN F+EGV  KIRRQIEELER SGV ++ LTVDGVPVDSYLTRFVWD+AKYPTMSPL
Sbjct  61   LTKSNAFMEGVSLKIRRQIEELERVSGVNTAGLTVDGVPVDSYLTRFVWDDAKYPTMSPL  120

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VDG+H  VAKIEDDLKVRV+EY+N+RSQLN+INRKQTGSLAVRD+SNLVK
Sbjct  121  KEIVDGIHGLVAKIEDDLKVRVSEYNNIRSQLNSINRKQTGSLAVRDISNLVK  173



>ref|XP_010939209.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Elaeis 
guineensis]
Length=374

 Score =   266 bits (680),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  SSA+S WSRLQ+SISK SFDTP+YRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSRWSRLQESISKRSFDTPVYRFNTPDLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN F+EGV  KIRRQIEELERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNAFLEGVSHKIRRQIEELERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD +H  VAKIEDD+KVR AEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDSIHVLVAKIEDDMKVRAAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  171



>emb|CDY16036.1| BnaC08g40870D [Brassica napus]
Length=474

 Score =   269 bits (687),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVK  171



>ref|XP_010556324.1| PREDICTED: V-type proton ATPase subunit C [Tarenaya hassleriana]
Length=377

 Score =   265 bits (678),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPV+ S  A+SLW+ LQ  ISK+SFDTP+YRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVKDS--ASSLWNGLQGQISKHSFDTPVYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELERASGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERASGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD + +QVAKIEDDLKVR AEY+N+R QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEIVDSIQTQVAKIEDDLKVRGAEYNNIRGQLNAINRKQSGSLAVRDLSSLVK  171



>ref|XP_002441755.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
 gb|EES15593.1| hypothetical protein SORBIDRAFT_08g001880 [Sorghum bicolor]
Length=377

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   ++ATSLW RLQD+IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATATSLWPRLQDAISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVDSGALTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + +QVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQTQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVK  174



>ref|XP_004977299.1| PREDICTED: V-type proton ATPase subunit C-like [Setaria italica]
Length=377

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   ++A+S+WSRLQD+IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATASSIWSRLQDNISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE +YPTMSP
Sbjct  61   DLVKSNIFVEGVSHKIRRQIEDLERAGGVESGALTVDGVPVDTYLTRFVWDEGRYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL+AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLSAINRKQSGSLAVRDLSNLVK  174



>ref|XP_010925033.1| PREDICTED: V-type proton ATPase subunit C-like [Elaeis guineensis]
Length=374

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+VSLPVQ  SSA+SLWSRLQ+SISK SFDT LYRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIVSLPVQ--SSASSLWSRLQESISKRSFDTLLYRFNTPDLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L KSN FIEGV  KIRRQIE+LERASGV   +LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LAKSNAFIEGVSHKIRRQIEDLERASGVEGGALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD +H  VAKIEDD+KVR AEY+N+RSQLN INRKQ+GSLAVRDLSNLVK
Sbjct  119  REIVDSIHVLVAKIEDDMKVRAAEYNNIRSQLNIINRKQSGSLAVRDLSNLVK  171



>ref|NP_001142247.1| uncharacterized protein LOC100274416 [Zea mays]
 gb|ACF87983.1| unknown [Zea mays]
 tpg|DAA59220.1| TPA: hypothetical protein ZEAMMB73_061434 [Zea mays]
Length=377

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 155/174 (89%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RYW+VSLPVQ   ++ATSLWSRLQD IS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYWIVSLPVQSPGATATSLWSRLQDGISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV S +LTVDGVPVD+YLTRFVWDE KYPTMS 
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVDSGALTVDGVPVDTYLTRFVWDEGKYPTMSS  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQVAKIEDD+KVR AEY+NVRSQL AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRAAEYNNVRSQLTAINRKQSGSLAVRDLSNLVK  174



>ref|XP_010554131.1| PREDICTED: V-type proton ATPase subunit C-like isoform X2 [Tarenaya 
hassleriana]
Length=377

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWV SLPV+ S  A+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LL LSDD
Sbjct  1    MASRYWVASLPVKDS--ASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLTLSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSHKIRRQIEELERVSGAESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD V +QV KIEDDLKVR AEY+N+RSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEIVDSVQTQVMKIEDDLKVRSAEYNNIRSQLNAINRKQSGSLAVRDLSSLVK  171



>ref|XP_010554130.1| PREDICTED: V-type proton ATPase subunit C-like isoform X1 [Tarenaya 
hassleriana]
Length=426

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 156/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWV SLPV+ S  A+SLW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LL LSDD
Sbjct  50   MASRYWVASLPVKDS--ASSLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLTLSDD  107

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SG  S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  108  LLKSNSFVEGVSHKIRRQIEELERVSGAESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  167

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE VD V +QV KIEDDLKVR AEY+N+RSQLNAINRKQ+GSLAVRDLS+LVK
Sbjct  168  KEIVDSVQTQVMKIEDDLKVRSAEYNNIRSQLNAINRKQSGSLAVRDLSSLVK  220



>ref|XP_009386009.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +2

Query  155  RYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVK  334
            RYW+VSLPV  S+SAT  W+RL+ SISKNSFDTPLYRF +P+LRVGTLD LLALSDDLVK
Sbjct  6    RYWIVSLPVHTSASAT--WNRLRQSISKNSFDTPLYRFTMPDLRVGTLDSLLALSDDLVK  63

Query  335  SNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKET  514
            SN FIEGV  KIRRQIEELE+ASGV   +LTVDGVP+DSYLTRFVWDE KYPTMSPL+E 
Sbjct  64   SNAFIEGVTHKIRRQIEELEKASGVEVGALTVDGVPIDSYLTRFVWDEGKYPTMSPLREL  123

Query  515  VDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
            VD +H QVAKIEDD+KVRVAEYSN+RSQLNAINRKQ+GSLAVRD+SNLV
Sbjct  124  VDSIHVQVAKIEDDMKVRVAEYSNIRSQLNAINRKQSGSLAVRDISNLV  172



>emb|CDY26596.1| BnaA09g46810D [Brassica napus]
Length=614

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M SRYWVVSLPV+ SSS  +LW+RLQ+ ISK+SFDTP+YRFNIPNLRVGTLD LLAL DD
Sbjct  1    MTSRYWVVSLPVKDSSS--TLWNRLQEQISKHSFDTPVYRFNIPNLRVGTLDSLLALGDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN+F+EGV  KIRRQIEELER SGV S++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  59   LLKSNSFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KE V+ + SQVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLS+LVK
Sbjct  119  KEVVENIQSQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSSLVK  171



>gb|KGN50885.1| hypothetical protein Csa_5G312840 [Cucumis sativus]
Length=370

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 154/167 (92%), Gaps = 2/167 (1%)
 Frame = +2

Query  164  VVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKSNN  343
            +VSLPVQ   SA+SLW+RLQ+ ISK+SFDTPLYRFNIPNLRVGTLD LL+LSDDL+KSN 
Sbjct  1    MVSLPVQ--GSASSLWNRLQEQISKHSFDTPLYRFNIPNLRVGTLDSLLSLSDDLLKSNT  58

Query  344  FIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETVDG  523
            F+EGV  KIRRQIEELE+ SGV S+ LTVDGVPVDSYLTRFVWDEAKYPTMSPL++ VD 
Sbjct  59   FVEGVSQKIRRQIEELEKVSGVESNVLTVDGVPVDSYLTRFVWDEAKYPTMSPLRDIVDS  118

Query  524  VHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +HSQVAKIEDDLK+RVAEY+NVRSQLNAINRKQ+GSLAVRD+SNLVK
Sbjct  119  IHSQVAKIEDDLKIRVAEYNNVRSQLNAINRKQSGSLAVRDISNLVK  165



>ref|XP_008654564.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF85084.1| unknown [Zea mays]
 gb|ACG35170.1| vacuolar ATP synthase subunit C [Zea mays]
 gb|AFW81320.1| Vacuolar ATP synthase subunit C [Zea mays]
Length=377

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 157/174 (90%), Gaps = 1/174 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RY +VSLPVQ   ++A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYLIVSLPVQSPGATASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            DLVKSN F+EGV  KIRRQIE+LERA GV + +LTVDGVPVD+YLTRFVWDE KYPTMSP
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVETGTLTVDGVPVDTYLTRFVWDEGKYPTMSP  120

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            LKE V  + SQVAKIEDD+KVR +EY+NVRSQL+AINRKQ+GSLAVRDLSNLVK
Sbjct  121  LKEIVGSIQSQVAKIEDDMKVRASEYNNVRSQLSAINRKQSGSLAVRDLSNLVK  174



>ref|XP_006844509.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
 gb|ERN06184.1| hypothetical protein AMTR_s00016p00139220 [Amborella trichopoda]
Length=374

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 161/173 (93%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYWV+SLPV+  +SA+SLWSRL++SIS+++FDTPLYRFNIP+LRVGTLD LLALSDD
Sbjct  1    MATRYWVISLPVE--NSASSLWSRLRESISRHAFDTPLYRFNIPDLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN+F+EGV  K+RRQIEELER+SGV + +LTVDGVPVDSY+TRFVWDEAKYPTMSPL
Sbjct  59   LVKSNSFVEGVSHKLRRQIEELERSSGVETGTLTVDGVPVDSYITRFVWDEAKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VD + + V++IEDDLKVRVAE++NVRSQLNAI RKQ+GSLAVRDLS++VK
Sbjct  119  REIVDNILAHVSRIEDDLKVRVAEFNNVRSQLNAIKRKQSGSLAVRDLSDIVK  171



>ref|XP_009395792.1| PREDICTED: V-type proton ATPase subunit C-like [Musa acuminata 
subsp. malaccensis]
Length=374

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MA+RYW+ SLPV  S+SA   W+RL++SISKNSFDT LYRFN P+LRVGTLD LLALSDD
Sbjct  1    MATRYWIASLPVHTSASAH--WNRLRESISKNSFDTLLYRFNTPDLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVKSN FIEGV  KIRRQIEELE+ASGV   +LTVDGVPVDSYLTRF WDE KYPTMSPL
Sbjct  59   LVKSNAFIEGVTHKIRRQIEELEKASGVEVGALTVDGVPVDSYLTRFDWDEGKYPTMSPL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
            +E VD +H QVAKIEDD+KVR AEYSN+RSQLNAINRKQ+GSLAVRDLSNLV
Sbjct  119  REIVDSIHVQVAKIEDDMKVRAAEYSNIRSQLNAINRKQSGSLAVRDLSNLV  170



>ref|XP_003567787.1| PREDICTED: V-type proton ATPase subunit C [Brachypodium distachyon]
 gb|ACU01766.1| vacuolar ATP synthetase subunit C [Brachypodium distachyon]
Length=382

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  146  MASRYWVVSLPVQ-----QSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  310
            MA+RYW+ SLPVQ      SS+ ++LW+RLQDSIS++SFDTPLYRFN+P+LR GTLD LL
Sbjct  1    MATRYWIASLPVQSAGGGDSSAKSALWARLQDSISRHSFDTPLYRFNVPDLRPGTLDSLL  60

Query  311  alsddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYP  490
            ALSDDLVKSN FIEGV  KIRRQ+E+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP
Sbjct  61   ALSDDLVKSNIFIEGVSHKIRRQVEDLERAGGVEGGALTVDGVPVDSYLTRFVWDEGKYP  120

Query  491  TMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               PLKETV  + SQVAKIEDD+KVRVAEY+NV+SQL+AINRKQTGSLAVRDLSNL+K
Sbjct  121  PHGPLKETVASIQSQVAKIEDDMKVRVAEYTNVKSQLSAINRKQTGSLAVRDLSNLIK  178



>ref|XP_010250562.1| PREDICTED: V-type proton ATPase subunit C [Nelumbo nucifera]
Length=376

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            YWVVSLPVQ  +SA+SLW+RL++ ISK+SFDT +YRFN P+LRVGTLD LL+LSDDL+KS
Sbjct  7    YWVVSLPVQ--ASASSLWTRLREEISKHSFDTLVYRFNTPDLRVGTLDSLLSLSDDLLKS  64

Query  338  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  517
            N+F+EGV  KIRRQIEELER SGV   +L VDGVP+DSYLTRFVWDE KYPTMSPL+E V
Sbjct  65   NSFVEGVSHKIRRQIEELERTSGVEGGALRVDGVPIDSYLTRFVWDETKYPTMSPLQEIV  124

Query  518  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            D +H QVAKIEDDLKVRVAEY+NVRSQLNAINRKQ GSLAVRDLSNL K
Sbjct  125  DSIHVQVAKIEDDLKVRVAEYNNVRSQLNAINRKQGGSLAVRDLSNLAK  173



>gb|ABG23314.1| vacuolar proton-ATPase C subunit [Triticum aestivum]
Length=380

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSA---TSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllal  316
            MA+RYW+ +LPV   + A   T+LW+RLQD+IS++SFDTPLYRF +P+LR GTLD LLAL
Sbjct  1    MATRYWIAALPVADDNVAAGKTALWARLQDAISRHSFDTPLYRFTVPDLRPGTLDSLLAL  60

Query  317  sddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  496
            SDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP  
Sbjct  61   SDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVN  120

Query  497  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAVRDLSNL+K
Sbjct  121  APLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIK  176



>gb|ACT34062.1| vacuolar ATP synthetase subunit C [Aegilops tauschii]
Length=380

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSA---TSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllal  316
            MA+RYW+ +LPV   + A   T+LW+RLQD+IS++SFDTPLYRF +P+LR GTLD LLAL
Sbjct  1    MATRYWIAALPVADDNVAAGKTALWARLQDAISRHSFDTPLYRFTVPDLRPGTLDSLLAL  60

Query  317  sddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  496
            SDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP  
Sbjct  61   SDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVN  120

Query  497  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAVRDLSNL+K
Sbjct  121  APLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIK  176



>sp|Q9SCB9.1|VATC_HORVU RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Hordeum 
vulgare]
 emb|CAB65127.1| vacuolar H+-ATPase subunit C [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSA---TSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllal  316
            MA+RYW+ +LPV   + A   T+LW+RLQ++IS++SFDTPLYRF +P+LR GTLD LLAL
Sbjct  1    MATRYWIAALPVADDNVAAGKTALWARLQEAISRHSFDTPLYRFTVPDLRPGTLDSLLAL  60

Query  317  sddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTM  496
            SDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPVDSYLTRFVWDE KYP  
Sbjct  61   SDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPVDSYLTRFVWDEGKYPVN  120

Query  497  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAVRDLSNL+K
Sbjct  121  APLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIK  176



>gb|KJB76316.1| hypothetical protein B456_012G082900 [Gossypium raimondii]
Length=352

 Score =   244 bits (624),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 138/173 (80%), Gaps = 25/173 (14%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  +SA++LW+ LQD ISK+SFDTPLYR                    
Sbjct  1    MASRYWVVSLPVQ--NSASTLWNNLQDQISKHSFDTPLYR--------------------  38

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
               SN FIEGV  KIRRQIEELER SG+  ++LTVDGVPVDSYLTRFVWDEAKYPTMSPL
Sbjct  39   ---SNTFIEGVSHKIRRQIEELERVSGLEINALTVDGVPVDSYLTRFVWDEAKYPTMSPL  95

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            +E VDG+H+QVAKIEDDLKVRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  96   REIVDGIHTQVAKIEDDLKVRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  148



>gb|ADE77882.1| unknown [Picea sitchensis]
Length=379

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            SRY +VSLPVQ  +SATS W  LQD I K++FDT  YR NIP+LRVGTLD LLALSDDL 
Sbjct  6    SRYCLVSLPVQ--NSATSTWHLLQDGIFKSAFDTSTYRLNIPDLRVGTLDSLLALSDDLN  63

Query  332  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  511
            K+N+F+E V  KIRRQIEELE+ASGV S  LTV GVPVDSY+TRF WDEAKYP MSPL+E
Sbjct  64   KANSFVEAVTHKIRRQIEELEKASGVESGVLTVHGVPVDSYITRFTWDEAKYPVMSPLRE  123

Query  512  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
             VD +H  V K+ED LKVRVAEY+NV+SQLNAINRKQ+GS+AVRDLSNLV+
Sbjct  124  LVDAIHDGVGKLEDALKVRVAEYNNVKSQLNAINRKQSGSMAVRDLSNLVR  174



>ref|XP_002980160.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
 ref|XP_002992900.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ05989.1| hypothetical protein SELMODRAFT_187073 [Selaginella moellendorffii]
 gb|EFJ19030.1| hypothetical protein SELMODRAFT_111716 [Selaginella moellendorffii]
Length=380

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            +RY +VSLPV +S++AT  W+ LQ  IS+ +FDTP Y+FNIP LR+GTLD L+ LSDDLV
Sbjct  6    TRYCLVSLPVLESAAAT--WAALQQGISRVAFDTPTYKFNIPELRIGTLDALMVLSDDLV  63

Query  332  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  511
            K N  +EGV  KIRRQIE+L+  +GV +S+LTVDGVPVD+Y+T+F WDEAKYP M+PL+E
Sbjct  64   KINGVVEGVTHKIRRQIEDLDHHAGVEASALTVDGVPVDTYITKFTWDEAKYPLMNPLRE  123

Query  512  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            T D +   V+K EDDLK+RVAEY+NV++QL+AINR+QTGS+A RD+SNLVK
Sbjct  124  TADMIQDNVSKHEDDLKIRVAEYTNVKTQLSAINRRQTGSMAARDISNLVK  174



>ref|XP_001773067.1| predicted protein [Physcomitrella patens]
 gb|EDQ62107.1| predicted protein [Physcomitrella patens]
Length=379

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 3/171 (2%)
 Frame = +2

Query  155  RYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVK  334
            +Y +VSLP+Q SS+ T  W  LQ  +S+ +FDTP Y+F+IP LRVGTLD LL LSDDL K
Sbjct  5    KYLLVSLPLQGSSNQT--WESLQSGVSRAAFDTPTYKFHIPELRVGTLDSLLTLSDDLTK  62

Query  335  SNNFIEGVCSKIRRQIEELERASGVA-SSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  511
            +N  +E V  K+RRQI++LERAS    SS+L+VDGVP+DSY+TRF WDEAKYPTM+PL+E
Sbjct  63   ANQVVETVTQKVRRQIDDLERASNSDNSSALSVDGVPIDSYITRFSWDEAKYPTMTPLRE  122

Query  512  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
             VD +   V+K+EDDLKVRV+EYSNV++QL  + RKQ GS+AVRDLSN+VK
Sbjct  123  IVDTIQESVSKLEDDLKVRVSEYSNVKTQLTTMLRKQGGSMAVRDLSNVVK  173



>gb|EMS67397.1| V-type proton ATPase subunit C [Triticum urartu]
Length=374

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 115/154 (75%), Gaps = 21/154 (14%)
 Frame = +2

Query  266  FNIPNLRVGTldlllalsddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPV  445
            F +P+LR GTLD LLALSDDLVKSN FIEGV  KIRRQIE+LERA GV   +LTVDGVPV
Sbjct  17   FTVPDLRPGTLDSLLALSDDLVKSNIFIEGVSHKIRRQIEDLERAGGVEPGTLTVDGVPV  76

Query  446  DSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDLK---------------------  562
            DSYLTRFVWDE KYP  +PLKETV  + SQVAKIEDD+K                     
Sbjct  77   DSYLTRFVWDEGKYPVNAPLKETVASIQSQVAKIEDDMKMQISVLVGCYIYRRTEYALFQ  136

Query  563  VRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            VRVAEY NV+SQL AINRKQTGSLAVRDLSNL+K
Sbjct  137  VRVAEYGNVKSQLGAINRKQTGSLAVRDLSNLIK  170



>gb|KHG11234.1| V-type proton ATPase subunit C -like protein [Gossypium arboreum]
Length=328

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 122/173 (71%), Gaps = 42/173 (24%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            MASRYWVVSLPVQ  SSA++LW+ LQD ISK+SFDTPLYRFNIPNLRVGTLD LLALSDD
Sbjct  1    MASRYWVVSLPVQ--SSASTLWNNLQDQISKHSFDTPLYRFNIPNLRVGTLDSLLALSDD  58

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            L+KSN FIEGV  KIRRQIEELER SG+ +++LTVDGVP                     
Sbjct  59   LLKSNTFIEGVSHKIRRQIEELERVSGLETNALTVDGVP---------------------  97

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
                               VRVAEY+NVR QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  98   -------------------VRVAEYNNVRGQLNAINRKQSGSLAVRDLSNLVK  131



>gb|EMT09400.1| V-type proton ATPase subunit C [Aegilops tauschii]
Length=377

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 7/180 (4%)
 Frame = +2

Query  146  MASRYWVVSLPVQQS-----SSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  310
            M ++Y + +LPVQ +     ++  SLW  L+DS+S+++ DTPLYRF +P L+ GTLD LL
Sbjct  1    MPTKYLIAALPVQSAGGDPAAAENSLWRSLEDSLSQHAIDTPLYRFTVPALKGGTLDSLL  60

Query  311  alsddlVKSNNFIEGVCSKIRRQIEELERASGVAS--SSLTVDGVPVDSYLTRFVWDEAK  484
            ALSDDL++SN FIEG   +IRRQIE+LERA G     S +TVDGVPVDSYL+RFVWDE K
Sbjct  61   ALSDDLIRSNLFIEGASHRIRRQIEDLERAGGAGEGGSLITVDGVPVDSYLSRFVWDERK  120

Query  485  YPTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            YPT SPLK+ +  + S++ KIED++KV+ A+Y++ ++ L  + RKQ+ SL VRDLSNLVK
Sbjct  121  YPTKSPLKDIIASILSRITKIEDEIKVQAAKYNSCKNHLRTVYRKQSVSLVVRDLSNLVK  180



>gb|AGJ98217.1| DET3, partial [Petunia x hybrida]
Length=268

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  380  IEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDL  559
            IEELER SGV SSSLTVDGVPVDSYLTRF WDEAKYP MSPLKE VDG+H+QVAKIEDDL
Sbjct  10   IEELERVSGVLSSSLTVDGVPVDSYLTRFAWDEAKYPKMSPLKEIVDGIHTQVAKIEDDL  69

Query  560  KVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            KVRV+EY+NVRSQLNAI RKQTGSLAVRDLSNL K
Sbjct  70   KVRVSEYNNVRSQLNAIIRKQTGSLAVRDLSNLGK  104



>ref|XP_001756840.1| predicted protein [Physcomitrella patens]
 gb|EDQ78437.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            +R  +VSLP+  + +AT  W+ LQ  IS+ SFDTP YRF IPNLRVGTL+ LL L D+L 
Sbjct  2    TRLILVSLPLCGTVAAT--WASLQQRISEVSFDTPTYRFQIPNLRVGTLNSLLTLGDELA  59

Query  332  KSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  511
            K  +F+E V  K+RRQIE+LE+ +   S+SL+V GVPV+ ++TRF W+ AKYPT +PLK+
Sbjct  60   KFGSFVESVAMKVRRQIEDLEKTTSSVSTSLSVHGVPVEIFVTRFGWNLAKYPTETPLKD  119

Query  512  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            T   +   V+K+++DLKVR +EYS V+SQL    RKQ GSL+ RDL+ LV+
Sbjct  120  TTAIIQGAVSKLDEDLKVRASEYSAVKSQLGTTLRKQMGSLSGRDLTTLVR  170



>gb|AFW81321.1| hypothetical protein ZEAMMB73_736936 [Zea mays]
Length=164

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 1/107 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQ-SSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsd  322
            MA+RY +VSLPVQ   ++A+SLWSRLQDSIS++SFDTPLYRFN+P+LRVGTLD LLALSD
Sbjct  1    MATRYLIVSLPVQSPGATASSLWSRLQDSISRHSFDTPLYRFNVPDLRVGTLDSLLALSD  60

Query  323  dlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTR  463
            DLVKSN F+EGV  KIRRQIE+LERA GV + +LTVDGVPVD+YLTR
Sbjct  61   DLVKSNVFVEGVSHKIRRQIEDLERAGGVETGTLTVDGVPVDTYLTR  107



>ref|XP_001696429.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
 gb|EDP08406.1| vacuolar H+ ATPase V1 sector, subunit C [Chlamydomonas reinhardtii]
Length=373

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 116/169 (69%), Gaps = 4/169 (2%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            YW+VSL +  +    + W  LQ+  S  +  +  Y+  IP+LRVGTLD L+ALSD+L K+
Sbjct  3    YWLVSLQLP-NKRKDACWELLQEKTSAAALGSN-YKLEIPDLRVGTLDSLMALSDELSKT  60

Query  338  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  517
            +  +E V +K++RQ+ +   A G+    L V+G+  +SY+ RF WDEAK+P   PLKETV
Sbjct  61   STMMEAVVNKVKRQVNDAAGAKGLVG--LKVEGMSTESYVQRFKWDEAKFPARRPLKETV  118

Query  518  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            D +   V++IEDDLKV+ +EY+N++SQLN I RK  GSLAVRD+S LVK
Sbjct  119  DRMQELVSRIEDDLKVKASEYNNLKSQLNQITRKAQGSLAVRDVSTLVK  167



>ref|XP_005651974.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27430.1| vacuolar H+ ATPase V1 sector, subunit C [Coccomyxa subellipsoidea 
C-169]
Length=372

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            YW+VSLP+ +S   +  W+ +Q+  +  +  +  ++F IP+LRVGTLD L+ LSDDLVK 
Sbjct  2    YWLVSLPLLESEDRS--WTLVQNKTTYENDYSINFKFAIPDLRVGTLDSLMVLSDDLVKV  59

Query  338  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  517
            N  +E V +KIRRQ+ ++          ++V+GV  D YL RF W+EAKYP   PL ETV
Sbjct  60   NALVESVVNKIRRQLFDMGSGRAEDFQEVSVEGVSPDQYLERFSWNEAKYPPRRPLSETV  119

Query  518  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
              +   + ++EDDLKVR++EY+ ++  + A  RKQTGSLAVRDL+ LVK
Sbjct  120  SAITETIQRLEDDLKVRMSEYNQLKGLVTAAARKQTGSLAVRDLTGLVK  168



>gb|ADI46924.1| ATPvC1m [Volvox carteri f. nagariensis]
Length=376

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 117/170 (69%), Gaps = 6/170 (4%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            YW+VSL + +     ++W  LQ+  S +   T  ++ ++P LR+GTLD LLALSD+L KS
Sbjct  3    YWLVSLKLHEKRK-DAVWELLQERTSASMLCTT-HKLDVPELRIGTLDSLLALSDELSKS  60

Query  338  NNFIEGVCSKIRRQIEELERASGV-ASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKET  514
            +N IE V +K+RRQI E   + GV A + LTV+G+  D Y+ RF WDEA++PT   LKE 
Sbjct  61   SNTIEAVLAKVRRQINE---SGGVKALAGLTVEGMSTDVYVQRFRWDEARFPTRRVLKEM  117

Query  515  VDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            VD +   V ++EDDLKV+ +EY+N++SQL+   RK  GSLAVRD+S +VK
Sbjct  118  VDKMTDLVIRVEDDLKVKASEYNNIKSQLSQATRKAQGSLAVRDISTVVK  167



>ref|XP_002503957.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO65215.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=375

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 113/175 (65%), Gaps = 8/175 (5%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M + +W+V+LP++   SA + W+ LQ   S+     P   FN+P LRVGTLD LLALSDD
Sbjct  1    MDTTFWLVALPLE-GGSAENTWNTLQQKTSRGR--VP---FNLPELRVGTLDSLLALSDD  54

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGV--ASSSLTVDGVPVDSYLTRFVWDEAKYPTMS  499
            LVK ++ + G   KIRR I E   A G    ++ L VDG+  + +LT F WDEAK+P   
Sbjct  55   LVKVSSLVAGTTQKIRRHIMESASAEGENEVNAELVVDGISAERFLTAFTWDEAKHPARR  114

Query  500  PLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            PL+ET++ +   VAKIEDD +V+  + ++ ++QL A++RK  GSLA RDL  +V+
Sbjct  115  PLRETMERLQESVAKIEDDFRVKTGDLASAKTQLGALSRKAAGSLATRDLGEIVQ  169



>ref|XP_002954527.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
 gb|ADI46857.1| ATPvC1f [Volvox carteri f. nagariensis]
 gb|EFJ44420.1| vacuolar ATP synthase, subunit C [Volvox carteri f. nagariensis]
Length=376

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 117/169 (69%), Gaps = 4/169 (2%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            YW+VSL +  +    ++W  LQ+  S +   T  ++ +IP LRVGTLD L+ALSD+L KS
Sbjct  3    YWLVSLQLH-NKRKDAVWELLQERTSASMLCTN-FKLDIPGLRVGTLDSLMALSDELSKS  60

Query  338  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKETV  517
            +  IE V +K++RQ+ E   A  +A+  LTV+GV  D Y+ RF WD+AK+PT   LK+ V
Sbjct  61   STMIEAVLAKVKRQVNESGGAKAMAA--LTVEGVSTDLYVQRFHWDDAKFPTRRLLKDMV  118

Query  518  DGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            D +   V++I+DDLKV+V+E +N++SQ++ + RK  GSLAVRD++ +VK
Sbjct  119  DKITELVSRIDDDLKVKVSELNNLKSQMSQVTRKAQGSLAVRDVATVVK  167



>ref|XP_005847214.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
 gb|EFN55112.1| hypothetical protein CHLNCDRAFT_35880 [Chlorella variabilis]
Length=367

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIP-NLRVGTldlllalsddlVK  334
            YW+VSLP      A   W+RLQ++ +  +  +  ++F +P + RVGTLD LLALSDDL K
Sbjct  2    YWLVSLP--HDGGADQAWTRLQEATTYTNDYSSNFKFALPESFRVGTLDSLLALSDDLAK  59

Query  335  SNNFIEGVCSKIRRQIEELERASGVAS-SSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKE  511
             N  +EG  +K+RRQ+ EL+ +      + + V+    + YL RF W+EAKYP+  PLKE
Sbjct  60   VNQAVEGTVNKVRRQLMELQASVAPEDRADVWVETQTPEGYLQRFAWNEAKYPSRRPLKE  119

Query  512  TVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
             V  +   V K++DDLKV+V E+  +RS L A  RKQ GSLAVRD+S+LV
Sbjct  120  IVASIMDNVQKLDDDLKVKVTEFGQLRSTLQAAARKQGGSLAVRDVSSLV  169



>gb|ABE96876.1| putative vacuolar ATP synthase subunit C [Triticum monococcum]
Length=131

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  461  RFVWDEAKYPTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAV  640
            RFVWDE KYP  +PLKETV  + SQVAKIEDD+KVRVAEY NV+SQL AINRKQTGSLAV
Sbjct  1    RFVWDEGKYPVNAPLKETVASIQSQVAKIEDDMKVRVAEYGNVKSQLGAINRKQTGSLAV  60

Query  641  RDLSNLVK  664
            RDLSNL+K
Sbjct  61   RDLSNLIK  68



>ref|XP_011399399.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
 gb|KFM26467.1| V-type proton ATPase subunit C [Auxenochlorella protothecoides]
Length=374

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 107/175 (61%), Gaps = 9/175 (5%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            YW+V+LP   S+     W+ LQ+  + +S  +  ++F +P  +VGTLD LL LSDDLVK 
Sbjct  3    YWLVALPAP-STGMEGAWASLQEDTTYSSDLSVNFKFAVPEFKVGTLDSLLGLSDDLVKV  61

Query  338  NNFIEGVCSKIRRQIEELERASGVASSSLTVDGV-------PVDSYLTRFVWDEAKYPTM  496
            N  +EG  +K+RRQ+ EL+ A+    S     G        P D YL  F W EAKYP+ 
Sbjct  62   NGAVEGSVNKVRRQLFELQSAAPTDRSEEEEGGEVRVEGTSPPD-YLQHFEWQEAKYPSK  120

Query  497  SPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
             PLK+TV  +     K++DDLK+R  EY+  R+ L A  RK+TGSLAVRDLS+LV
Sbjct  121  RPLKDTVAAITEVTQKLDDDLKLRTTEYTQQRTLLQAQLRKRTGSLAVRDLSDLV  175



>gb|EMT10509.1| hypothetical protein F775_43622 [Aegilops tauschii]
Length=100

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  263  RFNIPNLRVGTldlllalsddlVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVP  442
            +F +P+L  G LD LLALSDDLVKSN FIEGV  KI  QIE+LERA GV   +LTVDGVP
Sbjct  6    KFTVPDLHPGKLDSLLALSDDLVKSNIFIEGVSHKISWQIEDLERAGGVEPGTLTVDGVP  65

Query  443  VDSYLTRFVWDEAKYPTMSPLKETVDGVHSQ  535
            VDSYLTRFVWDE KYP  +PLK TV  + SQ
Sbjct  66   VDSYLTRFVWDEGKYPVNAPLKATVASIQSQ  96



>ref|XP_007886138.1| PREDICTED: V-type proton ATPase subunit C 1 [Callorhinchus milii]
Length=382

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 109/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++N+  +  ++F IP+L+VGTLD+L+ LSD+L 
Sbjct  2    AEFWLISAPGEKTCQQT--WDKLNSATTRNNHLSTNFKFAIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NICEIIAKQVTQIDNDLKARASAYNNLKGNLQNLERKNVGSLMTRSLADIVK  171



>gb|AAB51350.1| C subunit of V-ATPase, partial [Amblyomma americanum]
Length=382

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 110/172 (64%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S +W++S P +++   T  + +L    SK +  +  Y+F++P+L+VGTLD L+ LSDDL 
Sbjct  1    SEFWLISAPGEKTCQQT--YEKLCSVTSKQNNLSTNYKFHLPDLKVGTLDQLVGLSDDLG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + ++EGV  K+   + + L+      + +L  +G+ +++YLTRF WD AKYP    LK
Sbjct  59   KLDTYVEGVTRKVATYLGDVLDDQRDKLADNLLANGMEMEAYLTRFQWDMAKYPIKQSLK  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +  QV +I+ DLK + A Y+N+++QL +I RK TGSL VR L++LV+
Sbjct  119  NITDIISKQVGQIDADLKSKSAAYNNLKTQLQSIERKSTGSLLVRSLADLVR  170



>gb|EKC32287.1| V-type proton ATPase subunit C 1 [Crassostrea gigas]
Length=419

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = +2

Query  131  SNSIEMASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  310
            ++ I+MA  YW++S+P +++   +  W  L ++  +N   +  Y+F IP+L+VGTLD+L+
Sbjct  32   THLIKMAE-YWLISVPGEKTLQQS--WETLNNATMRNQVLSTNYKFAIPDLKVGTLDVLV  88

Query  311  alsddlVKSNNFIEGVCSKIRRQI-EELERASGVASSSLTVDGVPVDSYLTRFVWDEAKY  487
             LSDD+ K + + E V  KI + + E LE  S     +L V+GV + +YLTRF WD AKY
Sbjct  89   GLSDDMGKLDIYCESVTRKIAQYLGETLEDRSDKLQGNLQVNGVDMVTYLTRFQWDLAKY  148

Query  488  PTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            P    LK   + +  QV++IE DLK +   Y+N++  L  + RK TGSL  R+L+ LVK
Sbjct  149  PIKQSLKNIAEIIGKQVSQIETDLKTKATAYNNLKGNLQNLERKSTGSLFTRNLTELVK  207



>ref|XP_001418773.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO97066.1| F-ATPase family transporter: protons (vacuolar) [Ostreococcus 
lucimarinus CCE9901]
Length=374

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M + YW+VSLP++  SSA + W+ LQ     ++  +  Y+   P+LRVGTLD LLALSDD
Sbjct  1    MTTTYWLVSLPLR-GSSADAAWATLQRHTGGSNDLSLNYKMRCPDLRVGTLDSLLALSDD  59

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPL  505
            LVK N   E V  K+RRQ  EL  A+  +   L VDG  V+ YLT F WDEAK P    L
Sbjct  60   LVKVNALAEQVVEKVRRQFGELGDAT-TSERELRVDGESVERYLTTFEWDEAKNPARRAL  118

Query  506  KETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
            KETV+ +  ++++I+++ K++  + +  ++ LNAI RK    +  +DLS+ V
Sbjct  119  KETVEKLSERLSRIDEEFKLKCGQLATSKNHLNAIVRKVGSGVNAQDLSDKV  170



>ref|XP_009029568.1| hypothetical protein HELRODRAFT_103807 [Helobdella robusta]
 gb|ESN92328.1| hypothetical protein HELRODRAFT_103807 [Helobdella robusta]
Length=392

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++ + T  W  + +  SK +  +  ++F+IP+L+VGTLD+L+ LSDDL 
Sbjct  12   TEFWLISAPGEKTCAQT--WENMNNVTSKQNNLSINFKFHIPDLKVGTLDVLVGLSDDLA  69

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + ++E +  KI   + + +E  +     SL V+G  + SYLT+F WD AKY T  P+K
Sbjct  70   KLDGYVEIIVRKIAHYMGDVMEGETDKLHESLLVNGYSMASYLTKFQWDLAKYSTNQPIK  129

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +  Q+ +IE DLK R A Y+N++  L  + +K TGSL  R+LS+LVK
Sbjct  130  NISDFIAKQMTQIESDLKARSAAYNNLKGNLQILEKKSTGSLLTRNLSDLVK  181



>ref|XP_011414828.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
 ref|XP_011414829.1| PREDICTED: V-type proton ATPase subunit C 1-like [Crassostrea 
gigas]
Length=383

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + YW++S+P +++   +  W  L ++  +N   +  Y+F IP+L+VGTLD+L+ LSDD+ 
Sbjct  2    AEYWLISVPGEKTLQQS--WETLNNATMRNQVLSTNYKFAIPDLKVGTLDVLVGLSDDMG  59

Query  332  KSNNFIEGVCSKIRRQI-EELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + + E V  KI + + E LE  S     +L V+GV + +YLTRF WD AKYP    LK
Sbjct  60   KLDIYCESVTRKIAQYLGETLEDRSDKLQGNLQVNGVDMVTYLTRFQWDLAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV++IE DLK +   Y+N++  L  + RK TGSL  R+L+ LVK
Sbjct  120  NIAEIIGKQVSQIETDLKTKATAYNNLKGNLQNLERKSTGSLFTRNLTELVK  171



>dbj|BAE87614.1| unnamed protein product [Macaca fascicularis]
Length=287

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_010898239.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Esox lucius]
Length=381

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 110/172 (64%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W ++  + + ++  +  ++FNIP+L+VGTLD+L+ LSD++ 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKMMVATTHSNNLSTNHKFNIPDLKVGTLDVLVGLSDEMA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QVA+I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVAQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_006028579.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Alligator 
sinensis]
 ref|XP_006277390.1| PREDICTED: V-type proton ATPase subunit C 1 [Alligator mississippiensis]
Length=382

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_006028578.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Alligator 
sinensis]
Length=400

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  20   TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  77

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  78   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  137

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  138  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  189



>gb|EPY74837.1| V-type proton ATPase subunit C 1 [Camelus ferus]
Length=287

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>emb|CDQ87771.1| unnamed protein product [Oncorhynchus mykiss]
Length=332

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 109/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W ++  + ++N+  +   +FNIP+L+VGTLD+L+ LSDDL 
Sbjct  2    TEFWLISAPGEKTCQQT--WDQMMVATTRNNNLSTNNKFNIPDLKVGTLDVLVGLSDDLA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++FIEGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFIEGVVKKVSQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +   +++I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISDIISKAISQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_004679736.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Condylura 
cristata]
Length=382

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNTLATTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>emb|CAH93171.1| hypothetical protein [Pongo abelii]
Length=382

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_006796085.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Neolamprologus 
brichardi]
Length=358

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P  ++   T  W ++  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGDKTCQQT--WDKMMAATTRTNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_002733333.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Saccoglossus 
kowalevskii]
Length=384

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 110/172 (64%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W R+ ++ +K    +  ++FNIP+L+VGTLD L+ LSDDL 
Sbjct  2    AEFWLISAPGEKTCQQT--WERMNNATAKQQSLSINHKFNIPDLKVGTLDTLVGLSDDLG  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+   + + LE      + +L  +GV + +YLTRF WD AKYP   PL+
Sbjct  60   KLDAFVEVVARKVANYLGDVLEDQRDKLAENLLANGVDLTTYLTRFQWDVAKYPIKQPLR  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV++I+ DLK + A Y++++  L+++ RK TGSL  R++++LV+
Sbjct  120  SIAEIISKQVSQIDSDLKAKSAAYNSLKGNLHSLERKSTGSLITRNVADLVR  171



>gb|AIC48333.1| ATP6V1C1, partial [synthetic construct]
Length=382

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_005627900.1| PREDICTED: V-type proton ATPase subunit C 1 [Canis lupus familiaris]
Length=382

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVASKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>emb|CAH93365.1| hypothetical protein [Pongo abelii]
Length=382

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_009890115.1| PREDICTED: V-type proton ATPase subunit C 1 [Charadrius vociferus]
Length=382

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_006760332.1| PREDICTED: V-type proton ATPase subunit C 1 [Myotis davidii]
Length=355

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R LS +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLSEIVK  171



>ref|XP_008934370.1| PREDICTED: V-type proton ATPase subunit C 1 [Merops nubicus]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_004275371.1| PREDICTED: V-type proton ATPase subunit C 1 [Orcinus orca]
 ref|XP_004316544.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform 1 [Tursiops 
truncatus]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|NP_001686.1| V-type proton ATPase subunit C 1 [Homo sapiens]
 ref|NP_001125006.1| V-type proton ATPase subunit C 1 [Pongo abelii]
 ref|NP_001247698.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Macaca 
mulatta]
 ref|NP_001271984.1| V-type proton ATPase subunit C 1 [Macaca fascicularis]
 ref|XP_001155312.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan troglodytes]
 ref|XP_003256129.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Nomascus 
leucogenys]
 ref|XP_003821776.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan paniscus]
 ref|XP_003903096.1| PREDICTED: V-type proton ATPase subunit C 1 [Papio anubis]
 ref|XP_004047448.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004047449.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_005563904.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Macaca 
fascicularis]
 ref|XP_007999459.1| PREDICTED: V-type proton ATPase subunit C 1 [Chlorocebus sabaeus]
 ref|XP_009211717.1| PREDICTED: V-type proton ATPase subunit C 1 [Papio anubis]
 ref|XP_009454031.1| PREDICTED: V-type proton ATPase subunit C 1 [Pan troglodytes]
 ref|XP_010352829.1| PREDICTED: V-type proton ATPase subunit C 1 [Rhinopithecus roxellana]
 sp|P21283.4|VATC1_HUMAN RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Homo sapiens]
 sp|Q5RDQ7.1|VATC1_PONAB RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Pongo abelii]
 sp|Q4R5H9.1|VATC1_MACFA RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Macaca fascicularis]
 emb|CAA48903.1| vacuolar proton-ATPase [Homo sapiens]
 gb|AAH10960.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Homo 
sapiens]
 gb|AAL50383.1| ATPase H+ transporting lysosomal protein [Homo sapiens]
 emb|CAH90100.1| hypothetical protein [Pongo abelii]
 dbj|BAE01646.1| unnamed protein product [Macaca fascicularis]
 gb|EAW91859.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, isoform 
CRA_a [Homo sapiens]
 gb|EAW91860.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, isoform 
CRA_a [Homo sapiens]
 gb|ACE86916.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 protein 
[synthetic construct]
 gb|ACE87603.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 protein 
[synthetic construct]
 dbj|BAJ17803.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [synthetic 
construct]
 gb|ADQ31698.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [synthetic 
construct]
 gb|EHH28693.1| V-type proton ATPase subunit C 1 [Macaca mulatta]
 gb|EHH64350.1| V-type proton ATPase subunit C 1 [Macaca fascicularis]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_006122461.1| PREDICTED: V-type proton ATPase subunit C 1 [Pelodiscus sinensis]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHTATTKNNNLSTNSKFNIPDLKVGTLDILVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMSDVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_009918407.1| PREDICTED: V-type proton ATPase subunit C 1 [Haliaeetus albicilla]
 ref|XP_010575320.1| PREDICTED: V-type proton ATPase subunit C 1 [Haliaeetus leucocephalus]
 ref|XP_010575321.1| PREDICTED: V-type proton ATPase subunit C 1 [Haliaeetus leucocephalus]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_009864623.1| PREDICTED: V-type proton ATPase subunit C 1 [Apaloderma vittatum]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_005231036.1| PREDICTED: V-type proton ATPase subunit C 1 [Falco peregrinus]
 ref|XP_005431876.1| PREDICTED: V-type proton ATPase subunit C 1 [Falco cherrug]
 ref|XP_009488822.1| PREDICTED: V-type proton ATPase subunit C 1 [Pelecanus crispus]
 ref|XP_009636672.1| PREDICTED: V-type proton ATPase subunit C 1 [Egretta garzetta]
 ref|XP_009947737.1| PREDICTED: V-type proton ATPase subunit C 1 [Leptosomus discolor]
 ref|XP_009988359.1| PREDICTED: V-type proton ATPase subunit C 1 [Tauraco erythrolophus]
 ref|XP_010174217.1| PREDICTED: V-type proton ATPase subunit C 1 [Caprimulgus carolinensis]
 ref|XP_010181473.1| PREDICTED: V-type proton ATPase subunit C 1 [Mesitornis unicolor]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_004663082.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Jaculus 
jaculus]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_003459431.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004560058.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Maylandia 
zebra]
 ref|XP_005464958.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005742954.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pundamilia 
nyererei]
 ref|XP_005930197.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005930198.1| PREDICTED: V-type proton ATPase subunit C 1-A-like isoform X2 
[Haplochromis burtoni]
Length=383

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P  ++   T  W ++  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGDKTCQQT--WDKMMAATTRTNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_003480143.1| PREDICTED: V-type proton ATPase subunit C 1 [Cavia porcellus]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATAKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_004903962.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004903963.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004850298.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004850299.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Heterocephalus 
glaber]
Length=382

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHTATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>gb|ACO11255.1| Vacuolar proton pump subunit C [Caligus rogercresseyi]
Length=384

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 103/171 (60%), Gaps = 4/171 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S YW++S P   +  AT  W +L  + S  +  T  +RF IP+L+VGTLD L+ LSDDL 
Sbjct  4    SEYWLISAPGSPTCGAT--WDKLYQATSSGNLSTN-WRFPIPDLKVGTLDQLVGLSDDLG  60

Query  332  KSNNFIEGVCSKI-RRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + ++E V  K+    ++ LE        +L  +G+ + +YLT+F WD AKYP    LK
Sbjct  61   KVDAYVESVVRKVAHYMVDVLEDQRDKVVENLLANGMDLPTYLTKFSWDMAKYPIKQSLK  120

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
               D +  QV++IE DLKV+   Y+N+++ +  + +KQ+GSL  R+L NLV
Sbjct  121  NLADMISKQVSQIESDLKVKSQAYNNLKTNIQNVEKKQSGSLMTRNLGNLV  171



>ref|XP_010139291.1| PREDICTED: V-type proton ATPase subunit C 1 [Buceros rhinoceros 
silvestris]
Length=382

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  SISEIIGKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_005306086.1| PREDICTED: V-type proton ATPase subunit C 1 [Chrysemys picta 
bellii]
Length=382

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDILVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_005499457.1| PREDICTED: V-type proton ATPase subunit C 1 [Columba livia]
Length=382

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADVVK  171



>ref|XP_007932994.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Orycteropus 
afer afer]
Length=382

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSITSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_009510884.1| PREDICTED: V-type proton ATPase subunit C 1 [Phalacrocorax carbo]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_005879352.1| PREDICTED: V-type proton ATPase subunit C 1 [Myotis brandtii]
 ref|XP_006093414.1| PREDICTED: V-type proton ATPase subunit C 1 [Myotis lucifugus]
 gb|EPQ15830.1| V-type proton ATPase subunit C 1 [Myotis brandtii]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R LS +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLSEIVK  171



>ref|XP_009700298.1| PREDICTED: V-type proton ATPase subunit C 1 [Cariama cristata]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYVTRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_002759363.1| PREDICTED: V-type proton ATPase subunit C 1 [Callithrix jacchus]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_003408473.1| PREDICTED: V-type proton ATPase subunit C 1 [Loxodonta africana]
 ref|XP_010586740.1| PREDICTED: V-type proton ATPase subunit C 1 [Loxodonta africana]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_008051075.1| PREDICTED: V-type proton ATPase subunit C 1 [Tarsius syrichta]
 ref|XP_008051076.1| PREDICTED: V-type proton ATPase subunit C 1 [Tarsius syrichta]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTCKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_008146706.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Eptesicus 
fuscus]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R LS +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLSEIVK  171



>ref|XP_006145636.1| PREDICTED: V-type proton ATPase subunit C 1 [Tupaia chinensis]
Length=382

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_005316338.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ictidomys 
tridecemlineatus]
Length=382

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SKN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>gb|ERL87116.1| hypothetical protein D910_04516 [Dendroctonus ponderosae]
Length=386

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 103/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + YW+VS P  ++   T  W  + ++ SK +     Y+F+IP+L+VGTLD L+ LSDDL 
Sbjct  2    TEYWLVSAPGDKTCQQT--WETMNNTTSKQNSLCTNYKFHIPDLKVGTLDQLVGLSDDLG  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+   + E LE        +L  +   + SYLTRF WD AKYP    L+
Sbjct  60   KLDAFVEQVTRKVASYLGEVLEDQRDKLQENLMANNTDLPSYLTRFQWDIAKYPIKQSLR  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +  QV +I+ DLK + + Y+N++  L ++ +KQTGSL  R+L++LVK
Sbjct  120  NIADIISKQVGQIDADLKTKSSAYNNLKGSLQSLEKKQTGSLLTRNLADLVK  171



>ref|XP_004768925.1| PREDICTED: V-type proton ATPase subunit C 1 [Mustela putorius 
furo]
 ref|XP_004796128.1| PREDICTED: V-type proton ATPase subunit C 1 [Mustela putorius 
furo]
Length=382

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLALASKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_008574309.1| PREDICTED: V-type proton ATPase subunit C 1 [Galeopterus variegatus]
 ref|XP_008574310.1| PREDICTED: V-type proton ATPase subunit C 1 [Galeopterus variegatus]
Length=382

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_006192890.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Camelus 
ferus]
 ref|XP_007173450.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007173451.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007173452.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=382

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_002710769.1| PREDICTED: V-type proton ATPase subunit C 1 [Oryctolagus cuniculus]
 ref|XP_004580712.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ochotona 
princeps]
 ref|XP_007112273.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Physeter 
catodon]
 ref|XP_007112274.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Physeter 
catodon]
 ref|XP_007112275.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Physeter 
catodon]
 ref|XP_007112276.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X4 [Physeter 
catodon]
Length=382

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_006212223.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Vicugna 
pacos]
Length=382

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_007075876.1| PREDICTED: V-type proton ATPase subunit C 1 [Panthera tigris 
altaica]
 ref|XP_011289721.1| PREDICTED: V-type proton ATPase subunit C 1 [Felis catus]
 ref|XP_011289722.1| PREDICTED: V-type proton ATPase subunit C 1 [Felis catus]
Length=382

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAITSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_004402384.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_006744695.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_008687450.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ursus 
maritimus]
Length=382

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAIASKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_010954093.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 1 [Camelus bactrianus]
Length=381

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_010980173.1| PREDICTED: LOW QUALITY PROTEIN: V-type proton ATPase subunit 
C 1 [Camelus dromedarius]
Length=382

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_002922648.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ailuropoda 
melanoleuca]
 gb|EFB15735.1| hypothetical protein PANDA_011625 [Ailuropoda melanoleuca]
Length=382

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAAATKNNNLAIASKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_004607741.1| PREDICTED: V-type proton ATPase subunit C 1 [Sorex araneus]
Length=382

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDRVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_004697744.1| PREDICTED: V-type proton ATPase subunit C 1 [Echinops telfairi]
Length=288

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EG   K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGAVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>gb|KDR10550.1| V-type proton ATPase subunit C [Zootermopsis nevadensis]
Length=385

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 103/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + YW++S P  ++   T  W  + +  SK +  +  Y+F+IP+L+VGTLD L+ LSDDL 
Sbjct  2    TEYWLISAPGDKTCQQT--WETMNNVTSKQNNLSANYKFHIPDLKVGTLDQLVGLSDDLG  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K +NF+E V  K+   + E LE        +L  +   + +Y+TRF WD AKYP    L+
Sbjct  60   KLDNFVEQVTKKVAVYLGEVLEDQRDKLHENLLANNSDLPAYITRFQWDMAKYPIKQSLR  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +  QVA+I+ DLK +   Y+N++  L  + +KQTGSL  R+L++LVK
Sbjct  120  NIADIISKQVAQIDADLKTKSTAYNNLKGNLQNLEKKQTGSLLTRNLADLVK  171



>gb|ELR53809.1| V-type proton ATPase subunit C 1 [Bos mutus]
Length=428

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_007423656.1| PREDICTED: V-type proton ATPase subunit C 2 isoform X1 [Python 
bivittatus]
 ref|XP_007423657.1| PREDICTED: V-type proton ATPase subunit C 2 isoform X2 [Python 
bivittatus]
 ref|XP_007423658.1| PREDICTED: V-type proton ATPase subunit C 2 isoform X3 [Python 
bivittatus]
Length=382

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 105/176 (60%), Gaps = 14/176 (8%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRL-----QDSISKNSFDTPLYRFNIPNLRVGTldlllal  316
            S +W++S P  +++     W R+     + ++S+NS      +F IP+L+VGTLD L+ L
Sbjct  2    SEFWLISAPGDKANLLA--WDRMNTVTSKANLSRNS------KFTIPDLKVGTLDALVGL  53

Query  317  sddlVKSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPT  493
            SD+L K ++F E V  KI + I E LE +      +L  +GV + SYLTRF WD AKYP 
Sbjct  54   SDELGKLDSFAESVIKKIAQYIGEVLEDSKDKVQENLLANGVDLISYLTRFEWDMAKYPI  113

Query  494  MSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
              PLK   +G+  Q+ +IE D+K R A Y+N++  L  + RK  G+L  R L+++V
Sbjct  114  KQPLKNVSEGLAKQITQIETDMKSRAAAYNNIKGNLQNLERKTVGNLLTRTLTDIV  169



>ref|NP_001177134.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Sus 
scrofa]
Length=382

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLALTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_005238220.1| PREDICTED: V-type proton ATPase subunit C 2 [Falco peregrinus]
 ref|XP_005432298.1| PREDICTED: V-type proton ATPase subunit C 2 [Falco cherrug]
Length=382

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 105/176 (60%), Gaps = 14/176 (8%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSR-----LQDSISKNSFDTPLYRFNIPNLRVGTldlllal  316
            S +W++S P  +++     W R     L+ ++S NS      +F+IP+L+VGTLD L+ L
Sbjct  2    SEFWLISAPGDKTNLQA--WERMNTVTLKSNLSSNS------KFHIPDLKVGTLDALVGL  53

Query  317  sddlVKSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPT  493
            SD+L K ++F E V  KI + I E +E +      +L  +GV + SYLTRF WD AKYP 
Sbjct  54   SDELGKLDSFAESVIKKIAQYIGEVMEDSKDKVQENLLANGVDLISYLTRFEWDMAKYPI  113

Query  494  MSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
              PLK   D +  QV +IE DLK R A Y+N++  L ++ +K  G+L  R L+++V
Sbjct  114  KQPLKNISDALAKQVTQIETDLKTRSAAYNNIKGNLQSLEKKTVGNLLTRTLADIV  169



>ref|XP_009482486.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Pelecanus 
crispus]
Length=190

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 105/171 (61%), Gaps = 4/171 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S +W++S P  +++     W R+ ++++  S  +   +F+IP+L+VGTLD L+ LSD+L 
Sbjct  2    SEFWLISAPGDKTNLQA--WERM-NTVTSKSNLSSNSKFHIPDLKVGTLDALVGLSDELG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F E +  KI + I E +E +      +L  +GV + SYLTRF WD AKYP   PLK
Sbjct  59   KLDSFAESIIKKIAQYIGEVMEDSKDKVQENLLANGVDLISYLTRFEWDMAKYPIKQPLK  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
               + +  QV +IE DLK R A Y+N++  L ++ +K  G+L  R L+++V
Sbjct  119  NISEALAKQVTQIETDLKTRSAAYNNIKGNLQSLEKKTVGNLLTRTLADIV  169



>ref|XP_008321927.1| PREDICTED: V-type proton ATPase subunit C 1 [Cynoglossus semilaevis]
Length=383

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W ++  + ++    +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKMMAATTRTQNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_005797406.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=382

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMVATTRTNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDTFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + V  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIVSKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|NP_788849.1| V-type proton ATPase subunit C 1 [Bos taurus]
 ref|XP_005899431.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Bos mutus]
 ref|XP_005954637.1| PREDICTED: V-type proton ATPase subunit C 1 [Pantholops hodgsonii]
 ref|XP_006041489.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform X1 [Bubalus 
bubalis]
 ref|XP_006041490.1| PREDICTED: V-type proton ATPase subunit C 1-like isoform X2 [Bubalus 
bubalis]
 ref|XP_010861798.1| PREDICTED: V-type proton ATPase subunit C 1 [Bison bison bison]
 sp|P21282.3|VATC1_BOVIN RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Bos taurus]
 gb|AAA30803.1| H+ -ATPase C subunit [Bos taurus]
 gb|AAI19958.1| ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [Bos 
taurus]
 tpg|DAA22615.1| TPA: V-type proton ATPase subunit C 1 [Bos taurus]
Length=382

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>sp|Q9U5N1.1|VATC_MANSE RecName: Full=V-type proton ATPase subunit C; Short=V-ATPase 
subunit C; AltName: Full=Vacuolar proton pump subunit C [Manduca 
sexta]
 emb|CAB55498.1| vacuolar ATPase subunit C [Manduca sexta]
Length=385

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 101/172 (59%), Gaps = 4/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S YW++S P  ++   T  W  L  +   N+     Y+F IP+L+VGTLD L+ LSDDL 
Sbjct  2    SEYWLISAPGDKTCQQT--WEALNQATKANNLSLN-YKFPIPDLKVGTLDQLVGLSDDLG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + E LE        +LT +   +  YLTRF WD AKYP    L+
Sbjct  59   KLDTFVEGVTRKVAQYLGEVLEDQRDKLHENLTANNDDLPHYLTRFQWDMAKYPIKQSLR  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +  QV +I+ DLKV+ + Y+ ++  L  + +KQTGSL  R+L++LVK
Sbjct  119  NIADIISKQVGQIDADLKVKSSAYNALKGNLQNLEKKQTGSLLTRNLADLVK  170



>ref|XP_004011849.1| PREDICTED: V-type proton ATPase subunit C 1 [Ovis aries]
 ref|XP_005689239.1| PREDICTED: V-type proton ATPase subunit C 1 [Capra hircus]
Length=382

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_003080507.1| putative vacuolar ATP synthase subunit C (ISS) [Ostreococcus 
tauri]
 emb|CAL54674.1| ATPase, V1 complex, subunit C [Ostreococcus tauri]
Length=376

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 103/173 (60%), Gaps = 2/173 (1%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M + YW+VSLP+  +S+     +  + +   N   T + R  +P LRVGTLD LLALSDD
Sbjct  1    MTTTYWLVSLPLLGTSAEEQFGTLRRHTSGANELSTNV-RVRVPELRVGTLDSLLALSDD  59

Query  326  lVKSNNFIEGVCSKIRRQIEELERASGVASS-SLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            LVK+    E    K+RRQ  +L   S  ++   LT+DG  V+ +LT F WDE K+P    
Sbjct  60   LVKTCALAESTLDKVRRQHVDLTSTSDRSTGRELTIDGESVEKFLTTFEWDEGKHPCRRA  119

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
            L+ETV+ +  ++ +IED+ K++  + S  R+ LN++ R+  G +  +DLS L+
Sbjct  120  LRETVEKLSERLGRIEDEFKLKCGQLSTSRNHLNSLGRRTGGGVNSKDLSELI  172



>ref|XP_007518917.1| PREDICTED: V-type proton ATPase subunit C 1 [Erinaceus europaeus]
Length=382

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_005382051.1| PREDICTED: V-type proton ATPase subunit C 1 [Chinchilla lanigera]
Length=450

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAATSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_004431292.1| PREDICTED: V-type proton ATPase subunit C 1 [Ceratotherium simum 
simum]
Length=382

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_010744926.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Larimichthys 
crocea]
Length=383

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W ++  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKMMAATTRTNNLSANHKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKTRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_001494151.1| PREDICTED: V-type proton ATPase subunit C 1 [Equus caballus]
 ref|XP_008539280.1| PREDICTED: V-type proton ATPase subunit C 1 [Equus przewalskii]
 ref|XP_008539287.1| PREDICTED: V-type proton ATPase subunit C 1 [Equus przewalskii]
Length=382

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAISSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_006916693.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Pteropus 
alecto]
 ref|XP_006916694.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Pteropus 
alecto]
 ref|XP_011371558.1| PREDICTED: V-type proton ATPase subunit C 1 [Pteropus vampyrus]
 gb|ELK08624.1| V-type proton ATPase subunit C 1 [Pteropus alecto]
Length=382

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAITSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_004340673.1| Vtype proton ATPase subunit C, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR18631.1| Vtype proton ATPase subunit C, putative [Acanthamoeba castellanii 
str. Neff]
Length=394

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 107/178 (60%), Gaps = 13/178 (7%)
 Frame = +2

Query  155  RYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVK  334
            ++W+VS+P   S      + +L+ ++        + +F IP+LRVG+LD LLALS+DL +
Sbjct  13   QFWLVSVP--NSEVGPHGFEQLRSAVGGAGV---VSKFKIPSLRVGSLDSLLALSEDLGR  67

Query  335  SNNFIEGVCSKIRRQIEEL--------ERASGVASSSLTVDGVPVDSYLTRFVWDEAKYP  490
             + F EGV +KI RQ+ +L            G     L V+ + +DSYL+ F WDEAKY 
Sbjct  68   KDQFFEGVVNKIARQLRDLYTDPETGNNEGPGAGERILAVNNIGLDSYLSTFEWDEAKYK  127

Query  491  TMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
              SPLK+ +D V + + KI+++L+ + A + +V   + A  +K TG+L VRDLS+L+K
Sbjct  128  LTSPLKDVIDAVSTTMTKIDEELRTKSASFQSVTQAIAAEKKKATGNLMVRDLSDLIK  185



>ref|XP_009896480.1| PREDICTED: V-type proton ATPase subunit C 1 [Picoides pubescens]
Length=382

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKHNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_003782477.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Otolemur 
garnettii]
Length=382

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_010223600.1| PREDICTED: V-type proton ATPase subunit C 1 [Tinamus guttatus]
Length=382

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKHNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMGDVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|NP_001088261.1| V-type proton ATPase subunit C 1 [Xenopus laevis]
 sp|Q5XH14.1|VATC1_XENLA RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Xenopus laevis]
 gb|AAH84262.1| Atp6v1c1 protein [Xenopus laevis]
Length=382

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EG   K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGAVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVK  171



>dbj|BAE40727.1| unnamed protein product [Mus musculus]
Length=382

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WGKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_006982882.1| PREDICTED: V-type proton ATPase subunit C 1 [Peromyscus maniculatus 
bairdii]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_005367598.1| PREDICTED: V-type proton ATPase subunit C 1 [Microtus ochrogaster]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_003509877.1| PREDICTED: V-type proton ATPase subunit C 1 [Cricetulus griseus]
 gb|EGW12831.1| V-type proton ATPase subunit C 1 [Cricetulus griseus]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_007056164.1| PREDICTED: V-type proton ATPase subunit C 1 [Chelonia mydas]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDILVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+ RF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYIIRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|NP_989172.1| V-type proton ATPase subunit C 1 [Xenopus (Silurana) tropicalis]
 sp|Q6P4Y9.1|VATC1_XENTR RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Xenopus (Silurana) tropicalis]
 gb|AAH63194.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Xenopus (Silurana) 
tropicalis]
 emb|CAJ81546.1| ATPase, H+ transporting, lysosomal, V1 subunit C, isoform 1 [Xenopus 
(Silurana) tropicalis]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLMAATTKNNNLSTNAKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EG   K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGTVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLITRSLAEIVK  171



>ref|XP_007634426.1| PREDICTED: V-type proton ATPase subunit C 1 [Cricetulus griseus]
 gb|ERE52432.1| V-type proton ATPase subunit C 1 [Cricetulus griseus]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>gb|AAC83084.1| vacuolar adenosine triphosphatase subunit C [Mus musculus]
Length=382

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_010280691.1| PREDICTED: V-type proton ATPase subunit C 2 [Phaethon lepturus]
Length=382

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S +W++S P  +++     W R+ ++++  S  +   +F+IP+L+VGTLD L+ LSD+L 
Sbjct  2    SEFWLISAPGDKTNLQA--WERM-NTVTSKSNLSSNSKFHIPDLKVGTLDALVGLSDELG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F E +  KI + IEE +E +      +L  +GV + SYLTRF WD AKYP   PLK
Sbjct  59   KLDSFAESIIKKIAQYIEEVMEDSKDKVQENLLANGVDLISYLTRFEWDMAKYPIKQPLK  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
               + +  QV +IE DLK R A Y+N++  L ++ +K  G+L  R L+++V
Sbjct  119  SISEALAKQVTQIETDLKTRSAAYNNIKGNLQSLEKKTMGNLLTRTLADIV  169



>ref|NP_079770.2| V-type proton ATPase subunit C 1 [Mus musculus]
 sp|Q9Z1G3.4|VATC1_MOUSE RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Mus musculus]
 gb|AAH10217.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Mus musculus]
 dbj|BAC35953.1| unnamed protein product [Mus musculus]
 dbj|BAC57953.1| proton-translocating ATPase C subunit isoform C1 [Mus musculus]
 dbj|BAE30229.1| unnamed protein product [Mus musculus]
 gb|EDL08791.1| \ATPase, H+ transporting, lysosomal V1 subunit C1, isoform CRA_a 
[Mus musculus]
Length=382

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_008430009.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X2 [Poecilia 
reticulata]
Length=279

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++ +  +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMAATTRTNNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKXRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|NP_001011992.1| V-type proton ATPase subunit C 1 [Rattus norvegicus]
 sp|Q5FVI6.1|VATC1_RAT RecName: Full=V-type proton ATPase subunit C 1; Short=V-ATPase 
subunit C 1; AltName: Full=Vacuolar proton pump subunit C 
1 [Rattus norvegicus]
 gb|AAH89961.1| ATPase, H+ transporting, lysosomal V1 subunit C1 [Rattus norvegicus]
Length=382

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_003760346.1| PREDICTED: V-type proton ATPase subunit C 1 isoform 1 [Sarcophilus 
harrisii]
Length=382

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    SEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSINSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGSLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_009824064.1| hypothetical protein H257_02220 [Aphanomyces astaci]
 gb|ETV87265.1| hypothetical protein H257_02220 [Aphanomyces astaci]
Length=413

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 104/171 (61%), Gaps = 8/171 (5%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRL--QDSISKNSFDTPLYRFNIP-NLRVGTldlllalsddl  328
            YWVV++P + + S+ + ++ L  + + SKN F   LYR ++P +L VGTLD L+ L +D+
Sbjct  3    YWVVAVPNEGNKSSDATFNELKAETASSKNDF-ADLYRLDLPSDLLVGTLDSLMTLGEDM  61

Query  329  VKSNNFIEGVCSKIRRQIEELERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
             + +  +EG   KI RQ  +L +       +LTVDGVPV+ YL  F WDEAK+P   PL 
Sbjct  62   HRVDLVVEGAVRKIERQFHDLNKGG----EALTVDGVPVERYLHHFSWDEAKHPHRRPLS  117

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
            E V  + S V KIE++LK     Y+  + QL    +K+ G+L V +L++++
Sbjct  118  EIVSIIQSSVGKIEEELKQLSTRYTEKKQQLALHQKKKGGNLLVTNLADIL  168



>ref|XP_010148071.1| PREDICTED: V-type proton ATPase subunit C 1 [Eurypyga helias]
Length=382

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +K +  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKTNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_008420198.1| PREDICTED: V-type proton ATPase subunit C 1-A [Poecilia reticulata]
Length=382

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 107/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++ +  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMVATTRTNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y++RF WD AKYP    LK
Sbjct  60   KLDTFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYISRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + V  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIVSKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_006830685.1| PREDICTED: V-type proton ATPase subunit C 1 [Chrysochloris asiatica]
Length=382

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>gb|KFM68542.1| V-type proton ATPase subunit C, partial [Stegodyphus mimosarum]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 104/170 (61%), Gaps = 4/170 (2%)
 Frame = +2

Query  158  YWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlVKS  337
            +W++S P  ++   T  W  L ++   N+     Y+F++P+L+VGTLD L+ L+D+L K 
Sbjct  4    FWLISAPGDKTCQQT--WDALNNATRPNNLSMN-YKFHVPDLKVGTLDQLVGLTDELSKL  60

Query  338  NNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLKET  514
            + ++EG+  K+   ++E LE    +   +L V+ V + +YL +F W+ AKYP   PL   
Sbjct  61   DAYVEGIIRKLVSYMQEILEDQKDLLHENLQVNNVDLPTYLQKFTWNMAKYPARQPLPNI  120

Query  515  VDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
             D ++ +V +IE DLK + A Y+ +++ L  + RKQTGSL +R L +LVK
Sbjct  121  ADIINKEVQQIEADLKQKSAAYNQLKTSLQNLERKQTGSLLLRSLGDLVK  170



>gb|KFQ65953.1| V-type proton ATPase subunit C 2, partial [Phaethon lepturus]
Length=425

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 106/171 (62%), Gaps = 4/171 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S +W++S P  +++     W R+ ++++  S  +   +F+IP+L+VGTLD L+ LSD+L 
Sbjct  2    SEFWLISAPGDKTN--LQAWERM-NTVTSKSNLSSNSKFHIPDLKVGTLDALVGLSDELG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F E +  KI + IEE +E +      +L  +GV + SYLTRF WD AKYP   PLK
Sbjct  59   KLDSFAESIIKKIAQYIEEVMEDSKDKVQENLLANGVDLISYLTRFEWDMAKYPIKQPLK  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
               + +  QV +IE DLK R A Y+N++  L ++ +K  G+L  R L+++V
Sbjct  119  SISEALAKQVTQIETDLKTRSAAYNNIKGNLQSLEKKTMGNLLTRTLADIV  169



>gb|KFQ53504.1| V-type proton ATPase subunit C 1, partial [Nestor notabilis]
Length=388

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  8    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  65

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  66   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  125

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  126  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  177



>ref|XP_010017126.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Nestor 
notabilis]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_003940719.1| PREDICTED: V-type proton ATPase subunit C 1 [Saimiri boliviensis 
boliviensis]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + SK++      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATSKSNNLAVSSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_009275405.1| PREDICTED: V-type proton ATPase subunit C 1 [Aptenodytes forsteri]
 ref|XP_009467614.1| PREDICTED: V-type proton ATPase subunit C 1 [Nipponia nippon]
 ref|XP_010128174.1| PREDICTED: V-type proton ATPase subunit C 1 [Chlamydotis macqueenii]
 ref|XP_010281571.1| PREDICTED: V-type proton ATPase subunit C 1 [Phaethon lepturus]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_010302959.1| PREDICTED: V-type proton ATPase subunit C 1 [Balearica regulorum 
gibbericeps]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_418370.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X3 [Gallus 
gallus]
 ref|XP_004940040.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X4 [Gallus 
gallus]
 ref|XP_010707494.1| PREDICTED: V-type proton ATPase subunit C 1 [Meleagris gallopavo]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_009321363.1| PREDICTED: V-type proton ATPase subunit C 1 [Pygoscelis adeliae]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_009809784.1| PREDICTED: V-type proton ATPase subunit C 2, partial [Gavia stellata]
 gb|KFV53179.1| V-type proton ATPase subunit C 2, partial [Gavia stellata]
Length=275

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 105/171 (61%), Gaps = 4/171 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            S +W++S P  +++     W R+ ++++  S  +   +F+IP+L+VGTLD L+ LSD+L 
Sbjct  2    SEFWLISAPGDKTN--LQAWERM-NTVTSKSNLSSNSKFHIPDLKVGTLDALVGLSDELG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F E V  KI + I E +E +      +L  +GV + SYLTRF WD AKYP   PLK
Sbjct  59   KLDSFAESVIKKIAQYIGEVMEDSKDKVQENLLANGVDLISYLTRFEWDMAKYPIKQPLK  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLV  661
               + +  QV +IE DLK R A Y+N++  L ++ +K  G+L  R L+++V
Sbjct  119  NISEALAKQVTQIETDLKTRSAAYNNIKGNLQSLEKKTVGNLLTRTLADIV  169



>ref|XP_009556284.1| PREDICTED: V-type proton ATPase subunit C 1 [Cuculus canorus]
Length=382

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLSTNSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVESVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIIAKGVNQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_008430008.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Poecilia 
reticulata]
Length=308

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++ +  +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMAATTRTNNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKXRASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_001506621.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Ornithorhynchus 
anatinus]
Length=382

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 106/172 (62%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +K++  +   +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLSTNAKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIGKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>dbj|BAE98945.1| vacuolar ATP sythase subunit C [Arabidopsis thaliana]
Length=263

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = +2

Query  491  TMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            TMSPLKE VD + SQVAKIEDDLKVRVAEY+N+R QLNAINRKQ+GSLAVRDLSNLVK
Sbjct  2    TMSPLKEVVDNIQSQVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVK  59



>gb|KJB40644.1| hypothetical protein B456_007G072500 [Gossypium raimondii]
Length=261

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +2

Query  494  MSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            MSPL+E VDG+H+ VAKIEDDLKVRVAEY+NVRSQLNAINRKQ+GSLAVRDLSN+VK
Sbjct  1    MSPLREIVDGIHTLVAKIEDDLKVRVAEYNNVRSQLNAINRKQSGSLAVRDLSNMVK  57



>ref|XP_008849773.1| PREDICTED: V-type proton ATPase subunit C 1 [Nannospalax galili]
Length=382

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +K++      +FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKSNNLAVTSKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_007463323.1| PREDICTED: V-type proton ATPase subunit C 1 isoform X1 [Lipotes 
vexillifer]
Length=382

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 105/172 (61%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + +KN+      +F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WEKLHAATTKNNNLAVTSKFSIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +   V +I++DLK R + Y+N++  L  + RK  GSL  R L+ +VK
Sbjct  120  NISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVK  171



>ref|XP_007550566.1| PREDICTED: V-type proton ATPase subunit C 1-A isoform X1 [Poecilia 
formosa]
Length=383

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++ +  +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMGATTRTNNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|XP_005803508.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Xiphophorus 
maculatus]
Length=383

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 109/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++ +  +  ++F+IP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMAATTRTNNLSTNHKFSIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+E V  K+ + + + LE +      +L  +GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV++I++DLK R + Y+N++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVSQIDNDLKARASAYNNLKGNLQNLERKNAGSLLTRSLADIVK  171



>ref|NP_001040138.1| vacuolar ATPase subunit C [Bombyx mori]
 gb|ABD36144.1| vacuolar ATPase subunit C [Bombyx mori]
Length=386

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 102/172 (59%), Gaps = 4/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + YWV+S P  ++   T  W  L ++    +     Y+F IP+L+VGTLD L+ LSDDL 
Sbjct  2    TEYWVISAPGDKTCQQT--WDTLNNATKSGNLSVN-YKFPIPDLKVGTLDQLVGLSDDLG  58

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K + F+EGV  K+ + + E LE        +L  +   + +YLTRF WD AKYP    L+
Sbjct  59   KLDTFVEGVTRKVAQYLGEVLEDQRDKLHENLMANNSDLPTYLTRFQWDMAKYPIKQSLR  118

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               D +  QV +I+ DLKV+ + Y+ ++  L+ + +KQTGSL  R+L++LVK
Sbjct  119  NIADIISKQVGQIDADLKVKSSAYNALKGNLHNLEKKQTGSLLTRNLADLVK  170



>gb|ETE73899.1| V-type proton ATPase subunit C 1 [Ophiophagus hannah]
Length=362

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 109/179 (61%), Gaps = 4/179 (2%)
 Frame = +2

Query  131  SNSIEMASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlll  310
            SN  +MA  +W++S P +++   T  W +L  +  KN+  +   +FNIP+L+VGTLD+L+
Sbjct  7    SNVTKMA-EFWLISAPGEKTCQQT--WEKLCAATIKNNNLSINAKFNIPDLKVGTLDVLV  63

Query  311  alsddlVKSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKY  487
             LSD+L K + F+EGV  K+ + + + LE +      +L  +GV + +Y+TRF WD AKY
Sbjct  64   GLSDELAKLDTFVEGVVKKVAQYMADVLEDSRDKVQENLLANGVDLITYITRFQWDMAKY  123

Query  488  PTMSPLKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            P    LK   + +   V +I++DLK R + Y++++  L  + RK  GSL  R L+ +VK
Sbjct  124  PIKQSLKNISEIIAKGVTQIDNDLKARASAYNSLKGNLQNLERKNAGSLLTRSLAEIVK  182



>ref|XP_003375717.1| vacuolar proton pump subunit C [Trichinella spiralis]
 gb|EFV54740.1| vacuolar proton pump subunit C [Trichinella spiralis]
Length=389

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 105/174 (60%), Gaps = 6/174 (3%)
 Frame = +2

Query  146  MASRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsdd  325
            M + YW++S P +++   T  W RL  S  + S +   ++F+IP+L+VGTLD L+ LSDD
Sbjct  1    MITEYWLISAPGEKTCQET--WDRLNASTQELSSN---FKFSIPDLKVGTLDQLVGLSDD  55

Query  326  lVKSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSP  502
            L+K + + E +  K+     E LE        +L V G  +  Y+T+F WD AKYP    
Sbjct  56   LIKLDAYTESITKKLVNYFAEILEDQRDKLYENLQVQGKDISHYVTKFQWDTAKYPVKQA  115

Query  503  LKETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
            L+   + +  QV +I+ DLK + A Y+++++ L+A+ RK TGSL  +DL+++VK
Sbjct  116  LRNITEIISKQVTQIDSDLKAKAAAYNHLKNTLSALERKATGSLLTKDLADIVK  169



>ref|XP_006636047.1| PREDICTED: V-type proton ATPase subunit C 1-A-like [Lepisosteus 
oculatus]
Length=382

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 108/172 (63%), Gaps = 3/172 (2%)
 Frame = +2

Query  152  SRYWVVSLPVQQSSSATSLWSRLQDSISKNSFDTPLYRFNIPNLRVGTldlllalsddlV  331
            + +W++S P +++   T  W +L  + ++N+  +  ++FNIP+L+VGTLD+L+ LSD+L 
Sbjct  2    TEFWLISAPGEKTCQQT--WDKLMVATTRNNNLSTNHKFNIPDLKVGTLDVLVGLSDELA  59

Query  332  KSNNFIEGVCSKIRRQIEE-LERASGVASSSLTVDGVPVDSYLTRFVWDEAKYPTMSPLK  508
            K ++F+E V  K+ + + + LE +      +L   GV + +Y+TRF WD AKYP    LK
Sbjct  60   KLDSFVESVVKKVAQYMADVLEDSRDKVQENLLASGVDLVTYITRFQWDMAKYPIKQSLK  119

Query  509  ETVDGVHSQVAKIEDDLKVRVAEYSNVRSQLNAINRKQTGSLAVRDLSNLVK  664
               + +  QV +I++DLK R + Y++++  L  + RK  GSL  R L+++VK
Sbjct  120  NISEIISKQVTQIDNDLKSRASAYNSLKGNLQNLERKNAGSLLTRSLADIVK  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960