BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF036M14

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        258   2e-78   Sesamum indicum [beniseed]
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                255   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        253   2e-76   Solanum tuberosum [potatoes]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             251   6e-76   Solanum lycopersicum
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             250   2e-75   Vitis vinifera
emb|CBI22461.3|  unnamed protein product                                250   2e-75   Vitis vinifera
emb|CAN79862.1|  hypothetical protein VITISV_021998                     249   2e-75   Vitis vinifera
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        248   8e-75   Nicotiana sylvestris
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        248   1e-74   Nicotiana tomentosiformis
ref|XP_002527509.1|  zinc finger protein, putative                      248   2e-74   Ricinus communis
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             246   1e-73   Populus euphratica
gb|KJB79450.1|  hypothetical protein B456_013G050300                    245   2e-73   Gossypium raimondii
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        245   2e-73   Cicer arietinum [garbanzo]
emb|CDO97275.1|  unnamed protein product                                244   3e-73   Coffea canephora [robusta coffee]
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               244   3e-73   Gossypium arboreum [tree cotton]
gb|KEH44022.1|  vacuolar-sorting receptor-like protein                  241   4e-73   Medicago truncatula
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             244   5e-73   Populus trichocarpa [western balsam poplar]
ref|XP_007042634.1|  Vaculolar sorting receptor 3 isoform 2             240   7e-73   
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        243   8e-73   Morus notabilis
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        243   1e-72   Nelumbo nucifera [Indian lotus]
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  243   2e-72   Medicago truncatula
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        242   2e-72   Cucumis melo [Oriental melon]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        242   2e-72   Sesamum indicum [beniseed]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        242   2e-72   
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        242   3e-72   Pyrus x bretschneideri [bai li]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        242   3e-72   Populus euphratica
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        241   3e-72   
gb|KDP44487.1|  hypothetical protein JCGZ_16320                         241   3e-72   Jatropha curcas
ref|XP_003592523.1|  Vacuolar-sorting receptor                          241   4e-72   
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            241   4e-72   Populus trichocarpa [western balsam poplar]
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        241   4e-72   Cucumis sativus [cucumbers]
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             241   5e-72   Theobroma cacao [chocolate]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        241   7e-72   
gb|KJB12290.1|  hypothetical protein B456_002G010300                    237   3e-71   Gossypium raimondii
ref|XP_004159916.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    239   3e-71   
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        239   4e-71   Nelumbo nucifera [Indian lotus]
gb|KJB12295.1|  hypothetical protein B456_002G010300                    235   4e-71   Gossypium raimondii
gb|KCW63607.1|  hypothetical protein EUGRSUZ_G01233                     237   7e-71   Eucalyptus grandis [rose gum]
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             238   8e-71   Prunus mume [ume]
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        238   1e-70   Eucalyptus grandis [rose gum]
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             237   2e-70   Glycine soja [wild soybean]
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    237   2e-70   Glycine max [soybeans]
gb|KDO57883.1|  hypothetical protein CISIN_1g006786mg                   231   4e-70   Citrus sinensis [apfelsine]
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             236   4e-70   Prunus persica
gb|KJB12294.1|  hypothetical protein B456_002G010300                    235   6e-70   Gossypium raimondii
gb|KJB32253.1|  hypothetical protein B456_005G231800                    234   1e-69   Gossypium raimondii
gb|KJB12291.1|  hypothetical protein B456_002G010300                    235   1e-69   Gossypium raimondii
gb|KJB12292.1|  hypothetical protein B456_002G010300                    235   1e-69   Gossypium raimondii
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        235   1e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006849341.1|  hypothetical protein AMTR_s00164p00059220          233   3e-69   
gb|KJB32254.1|  hypothetical protein B456_005G231800                    232   7e-69   Gossypium raimondii
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             233   7e-69   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    233   7e-69   Glycine max [soybeans]
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             233   8e-69   Phaseolus vulgaris [French bean]
gb|KJB32252.1|  hypothetical protein B456_005G231800                    233   1e-68   Gossypium raimondii
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        232   1e-68   Glycine max [soybeans]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             232   1e-68   Glycine soja [wild soybean]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             232   2e-68   Glycine soja [wild soybean]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    232   2e-68   Glycine max [soybeans]
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             231   4e-68   Phaseolus vulgaris [French bean]
gb|KDO57886.1|  hypothetical protein CISIN_1g006786mg                   229   5e-68   Citrus sinensis [apfelsine]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             231   5e-68   Fragaria vesca subsp. vesca
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   229   1e-67   Citrus sinensis [apfelsine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   229   1e-67   Citrus sinensis [apfelsine]
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             229   1e-67   Citrus clementina [clementine]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             229   1e-67   Eutrema salsugineum [saltwater cress]
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             229   2e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        229   3e-67   Camelina sativa [gold-of-pleasure]
gb|EPS57970.1|  hypothetical protein M569_16845                         228   3e-67   Genlisea aurea
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        228   3e-67   Citrus sinensis [apfelsine]
ref|XP_004173121.1|  PREDICTED: vacuolar-sorting receptor 3-like        226   4e-67   
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             228   4e-67   Brassica rapa
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             228   5e-67   Capsella rubella
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             228   5e-67   Camelina sativa [gold-of-pleasure]
emb|CDY37219.1|  BnaA09g08400D                                          228   6e-67   Brassica napus [oilseed rape]
ref|XP_002885935.1|  VSR-2                                              228   6e-67   
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        228   7e-67   Camelina sativa [gold-of-pleasure]
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    228   7e-67   Arabis alpina [alpine rockcress]
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        228   8e-67   Tarenaya hassleriana [spider flower]
gb|AIY30334.1|  vacuolar-sorting receptor 3 protein                     214   8e-67   Ziziphus jujuba [Chinese jujube]
ref|NP_179081.1|  vacuolar-sorting receptor 3                           227   8e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    227   8e-67   Arabis alpina [alpine rockcress]
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             227   8e-67   
ref|NP_179079.1|  vacuolar-sorting receptor 4                           227   9e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             227   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             226   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 3-like        226   2e-66   Cucumis sativus [cucumbers]
emb|CDY65441.1|  BnaCnng47180D                                          226   2e-66   Brassica napus [oilseed rape]
gb|ABR17683.1|  unknown                                                 226   2e-66   Picea sitchensis
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    226   2e-66   Cicer arietinum [garbanzo]
emb|CDX81459.1|  BnaC09g08700D                                          226   3e-66   
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    226   5e-66   
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    225   5e-66   Camelina sativa [gold-of-pleasure]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    225   6e-66   Cucumis melo [Oriental melon]
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    225   7e-66   Cucumis melo [Oriental melon]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        224   8e-66   Brassica rapa
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             225   1e-65   
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        224   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_002309184.1|  vacuolar sorting receptor family protein           224   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    222   7e-65   Camelina sativa [gold-of-pleasure]
gb|AAB72112.1|  vacuolar sorting receptor homolog                       221   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54776.1|  vacuolar-sorting receptor                               220   4e-64   Phaseolus vulgaris [French bean]
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             220   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             219   1e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        218   2e-63   
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    218   3e-63   
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    218   3e-63   
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             218   3e-63   Tarenaya hassleriana [spider flower]
gb|EEC68730.1|  hypothetical protein OsI_37233                          218   3e-63   Oryza sativa Indica Group [Indian rice]
gb|EEE52644.1|  hypothetical protein OsJ_35003                          217   3e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        218   4e-63   Camelina sativa [gold-of-pleasure]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           217   5e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        217   5e-63   Camelina sativa [gold-of-pleasure]
gb|EEE51529.1|  hypothetical protein OsJ_32728                          217   6e-63   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                          217   6e-63   Oryza sativa Indica Group [Indian rice]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        217   7e-63   Arabidopsis thaliana [mouse-ear cress]
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             217   7e-63   
ref|NP_001169650.1|  hypothetical protein precursor                     214   1e-62   
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             216   1e-62   Selaginella moellendorffii
ref|NP_001065992.1|  Os12g0116000                                       218   1e-62   
gb|KDO64109.1|  hypothetical protein CISIN_1g0100101mg                  210   1e-62   Citrus sinensis [apfelsine]
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             216   1e-62   
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        216   2e-62   Phoenix dactylifera
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        216   2e-62   Populus euphratica
gb|KGN58683.1|  hypothetical protein Csa_3G728010                       214   2e-62   Cucumis sativus [cucumbers]
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    216   2e-62   Pisum sativum [garden pea]
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             216   2e-62   
ref|XP_003610620.1|  Vacuolar-sorting receptor                          215   3e-62   
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          215   4e-62   Sorghum bicolor [broomcorn]
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             214   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1-like        214   5e-62   Cucumis sativus [cucumbers]
gb|KJB71518.1|  hypothetical protein B456_011G126800                    213   6e-62   Gossypium raimondii
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    214   6e-62
gb|KDO64107.1|  hypothetical protein CISIN_1g0100101mg                  209   6e-62   Citrus sinensis [apfelsine]
gb|EEC66779.1|  hypothetical protein OsI_33169                          204   6e-62   Oryza sativa Indica Group [Indian rice]
gb|KDO64106.1|  hypothetical protein CISIN_1g0100101mg                  209   7e-62   Citrus sinensis [apfelsine]
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              214   8e-62   
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        214   8e-62   Zea mays [maize]
dbj|BAK00302.1|  predicted protein                                      214   9e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        214   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             213   1e-61   Capsella rubella
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               213   1e-61   Gossypium arboreum [tree cotton]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    213   1e-61   Tarenaya hassleriana [spider flower]
gb|KJB71519.1|  hypothetical protein B456_011G126800                    213   1e-61   Gossypium raimondii
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        213   1e-61   Populus euphratica
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    213   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    213   1e-61   Nicotiana sylvestris
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             213   1e-61   Cucumis melo [Oriental melon]
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    213   2e-61   Nicotiana sylvestris
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    213   2e-61   Ricinus communis
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        213   2e-61   
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             213   2e-61   Brachypodium distachyon [annual false brome]
dbj|BAK03786.1|  predicted protein                                      213   4e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             212   4e-61   
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    211   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    212   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_007033523.1|  Vacuolar sorting receptor isoform 3                210   4e-61   
emb|CDX91478.1|  BnaC04g06720D                                          211   6e-61   
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        211   6e-61   Brassica rapa
ref|XP_006842496.1|  hypothetical protein AMTR_s00077p00095230          211   7e-61   Amborella trichopoda
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             211   7e-61   
emb|CAN66483.1|  hypothetical protein VITISV_015390                     211   8e-61   Vitis vinifera
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like        209   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        211   1e-60   Elaeis guineensis
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                211   1e-60   
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             210   2e-60   Vitis vinifera
emb|CDY60753.1|  BnaA05g34780D                                          210   2e-60   Brassica napus [oilseed rape]
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             210   3e-60   Citrus clementina [clementine]
emb|CDY04821.1|  BnaAnng00030D                                          209   5e-60   
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    209   5e-60   Nelumbo nucifera [Indian lotus]
gb|KJB29887.1|  hypothetical protein B456_005G122400                    209   5e-60   Gossypium raimondii
gb|KJB29888.1|  hypothetical protein B456_005G122400                    209   5e-60   Gossypium raimondii
gb|KJB29886.1|  hypothetical protein B456_005G122400                    209   6e-60   Gossypium raimondii
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    209   7e-60   Nicotiana tomentosiformis
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    209   7e-60   Nicotiana tomentosiformis
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        208   8e-60   Phoenix dactylifera
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               208   1e-59   Gossypium arboreum [tree cotton]
ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        208   1e-59   Solanum tuberosum [potatoes]
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        209   2e-59   Oryza brachyantha
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    207   2e-59   Solanum lycopersicum
emb|CDY38157.1|  BnaA07g02260D                                          202   2e-59   Brassica napus [oilseed rape]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    207   2e-59   Solanum lycopersicum
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        207   3e-59   Fragaria vesca subsp. vesca
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        207   3e-59   Oryza brachyantha
ref|XP_010039169.1|  PREDICTED: vacuolar-sorting receptor 1-like        196   4e-59   
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    206   5e-59   Arabis alpina [alpine rockcress]
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        206   7e-59   Setaria italica
emb|CDP06387.1|  unnamed protein product                                206   1e-58   Coffea canephora [robusta coffee]
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             205   1e-58   Prunus persica
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    205   1e-58   
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        205   2e-58   Morus notabilis
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    205   2e-58   
gb|ACN30885.1|  unknown                                                 205   2e-58   Zea mays [maize]
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     205   2e-58   Zea mays [maize]
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        205   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              205   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064400.1|  Os10g0346600                                       204   3e-58   
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        204   3e-58   Prunus mume [ume]
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        204   4e-58   Nicotiana tomentosiformis
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        204   5e-58   Nicotiana sylvestris
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   202   6e-58   Zea mays [maize]
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        202   6e-58   
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    204   7e-58   Brassica rapa
gb|AFW68896.1|  hypothetical protein ZEAMMB73_054159                    202   8e-58   
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             206   9e-58   Triticum urartu
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        202   1e-57   Cicer arietinum [garbanzo]
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        202   1e-57   Oryza brachyantha
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    202   1e-57   
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        202   2e-57   Eucalyptus grandis [rose gum]
gb|AAN60346.1|  unknown                                                 192   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    202   2e-57   
ref|XP_003623631.1|  Vacuolar sorting receptor                          202   3e-57   Medicago truncatula
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             201   3e-57   Eutrema salsugineum [saltwater cress]
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        201   4e-57   Sesamum indicum [beniseed]
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                201   7e-57   Erythranthe guttata [common monkey flower]
pdb|4TJV|A  Chain A, Crystal Structure Of Protease-associated Dom...    189   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        200   1e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21863.1|  hypothetical protein JCGZ_00650                         199   2e-56   Jatropha curcas
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    199   2e-56   Solanum tuberosum [potatoes]
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                199   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             199   3e-56   Phaseolus vulgaris [French bean]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        199   3e-56   Sesamum indicum [beniseed]
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        199   4e-56   Elaeis guineensis
ref|XP_003626680.1|  Vacuolar sorting receptor                          198   7e-56   Medicago truncatula
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        198   9e-56   Glycine max [soybeans]
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        197   9e-56   Brachypodium distachyon [annual false brome]
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        198   9e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC82690.1|  hypothetical protein OsI_27347                          197   1e-55   Oryza sativa Indica Group [Indian rice]
ref|NP_001060643.1|  Os07g0680000                                       197   1e-55   
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        197   2e-55   Elaeis guineensis
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    196   3e-55   Solanum tuberosum [potatoes]
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             196   3e-55   Selaginella moellendorffii
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             196   3e-55   
emb|CDX73599.1|  BnaC08g24040D                                          196   3e-55   
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        196   3e-55   Oryza brachyantha
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             196   4e-55   Triticum urartu
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    196   4e-55   Pyrus x bretschneideri [bai li]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    196   4e-55   Pyrus x bretschneideri [bai li]
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             195   7e-55   Brassica rapa
emb|CDX78128.1|  BnaA09g33230D                                          195   9e-55   
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        195   1e-54   Phoenix dactylifera
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        195   1e-54   
gb|AAK82551.1|  AT3g52850/F8J2_20                                       194   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             194   2e-54   Glycine soja [wild soybean]
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        194   2e-54   Glycine max [soybeans]
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    194   2e-54   Arabis alpina [alpine rockcress]
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          194   2e-54   Sorghum bicolor [broomcorn]
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        194   2e-54   Oryza brachyantha
gb|ABR17707.1|  unknown                                                 194   2e-54   Picea sitchensis
gb|EPS72005.1|  hypothetical protein M569_02753                         192   4e-54   Genlisea aurea
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        193   4e-54   Cicer arietinum [garbanzo]
dbj|BAB64531.1|  vacuolar sorting receptor                              193   5e-54   Vigna mungo [urad dal]
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             193   5e-54   
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    192   7e-54   Glycine max [soybeans]
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        192   1e-53   Solanum lycopersicum
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             192   1e-53   Glycine soja [wild soybean]
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        192   1e-53   Glycine max [soybeans]
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             192   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             192   1e-53   Phaseolus vulgaris [French bean]
ref|NP_190853.1|  vacuolar-sorting receptor 1                           191   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       191   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008660179.1|  PREDICTED: vacuolar-sorting receptor 1             191   2e-53   
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        190   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    190   7e-53   Setaria italica
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             190   7e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    190   8e-53   
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          189   1e-52   Sorghum bicolor [broomcorn]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             189   1e-52   Eutrema salsugineum [saltwater cress]
emb|CDY13344.1|  BnaC06g14130D                                          189   2e-52   Brassica napus [oilseed rape]
ref|NP_001169232.1|  hypothetical protein precursor                     189   2e-52   Zea mays [maize]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   2e-52   
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   3e-52   
ref|XP_001751750.1|  predicted protein                                  188   3e-52   
dbj|BAK05589.1|  predicted protein                                      189   4e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        188   4e-52   Brassica rapa
emb|CDX67539.1|  BnaA07g15790D                                          187   4e-52   
emb|CDX93144.1|  BnaA03g38660D                                          187   6e-52   
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    187   8e-52   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    186   1e-51   
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    187   1e-51   
ref|XP_008655380.1|  PREDICTED: vacuolar-sorting receptor 1-like        183   2e-51   
gb|EPS73119.1|  hypothetical protein M569_01632                         186   2e-51   
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             185   4e-51   
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        184   9e-51   
tpg|DAA45229.1|  TPA: hypothetical protein ZEAMMB73_518849              184   9e-51   
ref|XP_001785165.1|  predicted protein                                  183   1e-50   
ref|NP_001050034.1|  Os03g0335300                                       183   2e-50   
ref|XP_006853456.1|  hypothetical protein AMTR_s00032p00189440          182   3e-50   
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        182   3e-50   
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             182   5e-50   
ref|XP_002304606.1|  vacuolar sorting receptor family protein           182   7e-50   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        181   8e-50   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             181   9e-50   
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        181   1e-49   
ref|XP_001765481.1|  predicted protein                                  181   1e-49   
ref|XP_001776090.1|  predicted protein                                  180   2e-49   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    178   2e-48   
gb|KJB38063.1|  hypothetical protein B456_006G235500                    176   2e-48   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             177   2e-48   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             177   2e-48   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        177   3e-48   
emb|CBI27239.3|  unnamed protein product                                179   8e-48   
gb|KDP43132.1|  hypothetical protein JCGZ_26665                         176   9e-48   
ref|XP_009387954.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    174   1e-47   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                        175   2e-47   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        174   3e-47   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        174   4e-47   
ref|XP_001759820.1|  predicted protein                                  174   4e-47   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6             173   9e-47   
ref|XP_001759928.1|  predicted protein                                  172   1e-46   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        172   2e-46   
ref|NP_001058298.1|  Os06g0664300                                       172   2e-46   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        171   4e-46   
ref|XP_008372129.1|  PREDICTED: vacuolar-sorting receptor 7-like        163   5e-46   
ref|XP_010941716.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    170   8e-46   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    170   1e-45   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    169   1e-45   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    169   2e-45   
gb|KDO77204.1|  hypothetical protein CISIN_1g0067882mg                  166   2e-45   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like        169   2e-45   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          169   3e-45   
gb|EEC81131.1|  hypothetical protein OsI_24020                          168   4e-45   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg                168   4e-45   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like        168   5e-45   
gb|KDO77203.1|  hypothetical protein CISIN_1g0067882mg                  166   5e-45   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        168   6e-45   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg             167   1e-44   
emb|CDP18160.1|  unnamed protein product                                167   1e-44   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              167   1e-44   
gb|AFW87686.1|  vacuolar sorting receptor 7                             167   1e-44   
gb|ACN28195.1|  unknown                                                 167   2e-44   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like        167   2e-44   
gb|KDO77202.1|  hypothetical protein CISIN_1g0067882mg                  165   2e-44   
ref|XP_001777810.1|  predicted protein                                  166   2e-44   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             166   3e-44   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg             165   5e-44   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                  165   5e-44   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like        165   6e-44   
gb|EYU23258.1|  hypothetical protein MIMGU_mgv1a0227552mg               158   7e-44   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg             165   7e-44   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg             165   7e-44   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             164   1e-43   
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like        164   1e-43   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7             164   2e-43   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             164   2e-43   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        164   2e-43   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             164   2e-43   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like        162   4e-43   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    162   4e-43   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                        162   6e-43   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like        162   6e-43   
dbj|BAJ88964.1|  predicted protein                                      162   1e-42   
dbj|BAK00261.1|  predicted protein                                      161   1e-42   
gb|EMT30552.1|  hypothetical protein F775_21497                         161   1e-42   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6             161   2e-42   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like        160   2e-42   
dbj|BAJ97179.1|  predicted protein                                      160   3e-42   
dbj|BAJ91572.1|  predicted protein                                      160   5e-42   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6             160   5e-42   
gb|KJB48042.1|  hypothetical protein B456_008G051500                    158   6e-42   
gb|AFK35926.1|  unknown                                                 151   1e-41   
gb|KJB48040.1|  hypothetical protein B456_008G051500                    158   1e-41   
gb|KJB48041.1|  hypothetical protein B456_008G051500                    158   2e-41   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g             158   2e-41   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like        158   2e-41   
gb|KCW75576.1|  hypothetical protein EUGRSUZ_E04321                     157   2e-41   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               158   2e-41   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6-like        157   3e-41   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    157   4e-41   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like        157   5e-41   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                     157   6e-41   
emb|CDY43178.1|  BnaCnng11060D                                          155   2e-40   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                    155   3e-40   
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             156   3e-40   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                    154   3e-40   
emb|CDY02347.1|  BnaA09g25550D                                          154   4e-40   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6             154   5e-40   
emb|CDY50060.1|  BnaCnng18670D                                          154   6e-40   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    153   6e-40   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7             154   7e-40   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg             153   1e-39   
emb|CDX78975.1|  BnaA01g10420D                                          152   2e-39   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                        152   3e-39   
emb|CAA16619.1|  vacuolar sorting receptor-like protein                 152   3e-39   
ref|NP_193744.1|  vacuolar-sorting receptor 7                           152   3e-39   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733             151   4e-39   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857             151   4e-39   
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg             150   9e-39   
gb|KEH37345.1|  vacuolar-sorting receptor                               150   9e-39   
gb|ACS91931.1|  vacuolar sorting receptor protein                       150   1e-38   
gb|EMT02959.1|  Vacuolar-sorting receptor 4                             150   1e-38   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg             150   1e-38   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like        150   1e-38   
ref|NP_174375.1|  vacuolar sorting receptor 6                           150   2e-38   
gb|AAF98196.1|AC000107_19  F17F8.23                                     150   2e-38   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like        149   2e-38   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7             149   2e-38   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like        149   2e-38   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                  149   4e-38   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like        148   5e-38   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6             148   6e-38   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like        148   6e-38   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    145   4e-37   
ref|XP_003064631.1|  predicted protein                                  146   8e-37   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg             142   1e-35   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7             140   3e-35   
emb|CAE03573.2|  OSJNBa0085I10.18                                       140   9e-35   
ref|NP_001053838.1|  Os04g0611400                                       139   1e-34   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180          137   6e-34   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5             136   1e-33   
ref|NP_181040.1|  vacuolar-sorting receptor 5                           134   7e-33   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210             133   1e-32   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5             133   1e-32   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335              133   2e-32   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    132   2e-31   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like        130   3e-31   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    129   6e-31   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    129   6e-31   
emb|CDY64650.1|  BnaAnng19540D                                          129   7e-31   
emb|CBI32834.3|  unnamed protein product                                122   7e-31   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like        128   1e-30   
emb|CDY43647.1|  BnaA04g20440D                                          127   2e-30   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg             127   3e-30   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg             127   3e-30   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100             125   1e-29   
ref|XP_002501193.1|  predicted protein                                  123   3e-29   
ref|XP_007513418.1|  predicted protein                                  121   2e-28   
gb|EEE61664.1|  hypothetical protein OsJ_16123                          121   4e-28   
tpg|DAA39320.1|  TPA: hypothetical protein ZEAMMB73_030788              114   5e-28   
ref|XP_011401748.1|  Vacuolar-sorting receptor 1                        117   6e-27   
emb|CDP17487.1|  unnamed protein product                                116   9e-27   
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g             115   2e-26   
ref|XP_001419041.1|  predicted protein                                  111   8e-25   
ref|XP_002501531.1|  predicted protein                                  110   3e-24   
gb|KHN42446.1|  Vacuolar-sorting receptor 4                             102   5e-24   
ref|XP_002489190.1|  hypothetical protein SORBIDRAFT_0013s004040        103   1e-23   
tpg|DAA45230.1|  TPA: hypothetical protein ZEAMMB73_518849              106   2e-23   
tpg|DAA45231.1|  TPA: hypothetical protein ZEAMMB73_518849              102   2e-23   
gb|EPS72755.1|  hypothetical protein M569_02000                         106   3e-23   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)          107   6e-23   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site       106   1e-22   
ref|NP_001176319.1|  Os11g0116550                                       100   6e-22   
gb|EMT28756.1|  hypothetical protein F775_27608                       97.8    8e-22   
gb|KDD75638.1|  hypothetical protein H632_c577p0                        102   1e-21   
ref|XP_003057973.1|  predicted protein                                  100   2e-20   
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like      97.8    5e-20   
gb|KJB14245.1|  hypothetical protein B456_002G116200                  95.5    6e-20   
gb|KJB14246.1|  hypothetical protein B456_002G116200                  96.3    6e-20   
gb|EMT28757.1|  hypothetical protein F775_13214                       94.7    2e-19   
gb|EAZ37923.1|  hypothetical protein OsJ_22274                        85.5    1e-17   
gb|EMS45035.1|  hypothetical protein TRIUR3_18121                     84.0    8e-17   
ref|XP_003603017.1|  Vacuolar sorting receptor                        82.0    1e-16   
gb|EMS68622.1|  hypothetical protein TRIUR3_18779                     88.2    1e-16   
emb|CAC38995.1|  putative EGF receptor-like protein                   85.5    2e-16   
gb|EEE67817.1|  hypothetical protein OsJ_25571                        87.4    2e-16   
ref|XP_005643046.1|  hypothetical protein COCSUDRAFT_49231            87.8    2e-16   
gb|EMT00254.1|  hypothetical protein F775_19349                       81.6    4e-16   
ref|XP_002536854.1|  hypothetical protein RCOM_1789310                80.9    5e-16   
gb|EMS67136.1|  hypothetical protein TRIUR3_12943                     86.3    6e-16   
gb|KHN26599.1|  Vacuolar-sorting receptor 6                           84.7    2e-15   
ref|XP_005848848.1|  hypothetical protein CHLNCDRAFT_144184           84.3    2e-15   
gb|AES73268.2|  vacuolar sorting receptor protein, putative           77.0    7e-15   
gb|EJY73103.1|  Vacuolar sorting receptor                             79.0    1e-13   
gb|KIZ02215.1|  Vacuolar-sorting receptor 2                           73.6    1e-12   
gb|EJY76506.1|  Vacuolar sorting receptor 3                           75.1    2e-12   
emb|CDW90025.1|  UNKNOWN                                              71.6    3e-11   
ref|XP_001701186.1|  vacuolar sorting receptor                        71.6    5e-11   
ref|XP_002489189.1|  hypothetical protein SORBIDRAFT_0013s004030      69.7    8e-11   
gb|AEW09228.1|  hypothetical protein UMN_755_01                       63.5    3e-10   
gb|EJY86065.1|  Vacuolar-sorting receptor 1                           67.4    8e-10   
gb|EJY73798.1|  Vacuolar sorting receptor 3                           67.4    8e-10   
gb|AFG69854.1|  hypothetical protein UMN_755_01                       61.6    1e-09   
emb|CDW89394.1|  vacuolar sorting receptor 3                          64.7    7e-09   
gb|EAS05189.2|  vacuolar sorting receptor                             63.9    1e-08   
emb|CCA16097.1|  vacuolarsorting receptor putative                    63.5    1e-08   
ref|XP_002956789.1|  hypothetical protein VOLCADRAFT_119519           62.8    3e-08   
emb|CCI44781.1|  unnamed protein product                              62.8    3e-08   
ref|WP_040574385.1|  arginyl aminopeptidase                           62.4    6e-08   
gb|EJF09027.1|  metalloprotease                                       62.4    6e-08   
gb|AIG55531.1|  secreted protein                                      61.6    6e-08   
ref|WP_043097279.1|  hypothetical protein                             62.0    7e-08   
ref|XP_002908795.1|  vacuolar-sorting receptor, putative              61.2    1e-07   
gb|EMT00255.1|  hypothetical protein F775_19350                       60.5    1e-07   
gb|KDO23286.1|  hypothetical protein SPRG_11600                       60.5    2e-07   
gb|EJY82359.1|  hypothetical protein OXYTRI_20119                     60.1    2e-07   
ref|XP_008610541.1|  hypothetical protein SDRG_06538                  60.1    2e-07   
gb|EJK43726.1|  hypothetical protein THAOC_37793                      60.1    2e-07   
ref|XP_001025434.1|  hypothetical protein TTHERM_01091280             59.3    4e-07   
ref|XP_002294134.1|  predicted protein                                58.9    5e-07   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like      58.5    6e-07   
ref|XP_008861496.1|  hypothetical protein H310_00471                  58.5    7e-07   
ref|WP_033422732.1|  hypothetical protein                             58.9    7e-07   
ref|WP_018478560.1|  hypothetical protein                             58.5    8e-07   
ref|XP_002107666.1|  hypothetical protein TRIADDRAFT_63462            57.8    9e-07   
ref|XP_008910397.1|  hypothetical protein PPTG_15123                  58.2    1e-06   
gb|ETL86586.1|  hypothetical protein L917_14009                       58.2    1e-06   
dbj|GAA55949.1|  E3 ubiquitin-protein ligase RNF167                   58.2    1e-06   
ref|WP_022970991.1|  serine protease                                  57.8    1e-06   
ref|XP_004031067.1|  pa domain protein                                57.8    1e-06   
ref|WP_011497474.1|  serine protease                                  57.8    1e-06   



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  107  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  286
            MG SE+PK  ILLGLLLLTL E   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGCSERPKGAILLGLLLLTLAEIVVGRFVVEKNSLRVLSPDSIKGTHDSAIGNFGIPQYG  60

Query  287  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  466
            G M GTVVYP+DNRKGCK FD  GISF +KAG+LP FV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GRMGGTVVYPRDNRKGCKSFDDSGISFKAKAGALPNFVLVDRGDCFFALKVWNAQNAGAA  120

Query  467  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAV  616
            A+LVADD++E LITMDSPEEDG+S+ Y+ NITIPSALI+KSFGEKLKKA+
Sbjct  121  AVLVADDLDEPLITMDSPEEDGASARYIANITIPSALIDKSFGEKLKKAI  170



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  107  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  286
            MG SE+ KA +LLG  LL L E AAGRFVVEKN+L+V SP+SIKG +DSA+GNFGIPQYG
Sbjct  1    MGCSERSKAAVLLGFSLLILAELAAGRFVVEKNSLRVISPESIKGNHDSAIGNFGIPQYG  60

Query  287  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  466
            GSM+GTV+YPKDN+KGCK FD FGISF +KAG+LP FV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSMSGTVLYPKDNKKGCKNFDDFGISFKAKAGALPNFVLVDRGDCFFALKVWNAQNAGAA  120

Query  467  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAV  616
            A+LVAD+++E LITMD+PEE G+S+ Y+ NITIPSALI+KSFGEKLKKAV
Sbjct  121  AVLVADNLDEALITMDTPEESGASAKYIANITIPSALIDKSFGEKLKKAV  170



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  107  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  286
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  287  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  466
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAA  120

Query  467  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAV  616
            A+LVADDV+ERLITMDSPE DGSS+ Y+ENITIPSALIEKSF EKLKKAV
Sbjct  121  AVLVADDVDERLITMDSPEADGSSAKYIENITIPSALIEKSFAEKLKKAV  170



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  107  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  286
            MG S+  KA I LG L L L +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYG
Sbjct  1    MGVSKTSKATIFLGFLWLNLFQSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYG  60

Query  287  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  466
            GS+ GTVVYPK+NRKGC+ F+  G SF SK+G++PTFV+VDRGDC FALK WNAQNAGA+
Sbjct  61   GSIPGTVVYPKENRKGCRNFEDSGTSFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAA  120

Query  467  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAV  616
            A+LVADDV+ERLITMDSPE DGSS+ Y+ENITIPSALIEK+F EKLKKAV
Sbjct  121  AVLVADDVDERLITMDSPEADGSSAKYIENITIPSALIEKNFAEKLKKAV  170



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  33   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  92

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  93   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  152

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSFGEKLKKA+
Sbjct  153  YIENITIPSALIEKSFGEKLKKAI  176



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  147

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSFGEKLKKA+
Sbjct  148  YIENITIPSALIEKSFGEKLKKAI  171



>emb|CAN79862.1| hypothetical protein VITISV_021998 [Vitis vinifera]
Length=599

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            +FVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N KGCKGFD +GIS
Sbjct  28   KFVVEKNSLTVVSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENTKGCKGFDEYGIS  87

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD++EE LITMDSPEEDGSSS 
Sbjct  88   FKSKIGALPTFVVVDRGDCFFALKVWNAQNAGASAVLVADNIEEPLITMDSPEEDGSSSK  147

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSFGEKLKKA+
Sbjct  148  YIENITIPSALIEKSFGEKLKKAI  171



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   248 bits (634),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
              GISF SK+G++PTFV+VDRGDC FALK WNAQNAGA+A+LVADDV+ERLITMD+PE D
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAAAVLVADDVDERLITMDTPEAD  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
            GSS+ Y+ENITIPSALIEKSF EKLKKAV
Sbjct  143  GSSAKYIENITIPSALIEKSFAEKLKKAV  171



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            +S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGS+ GTVVYPK N+KGC+ FD
Sbjct  23   QSVVGRFVVEKNSLRVVSPDDIKGTYDSAIGNFGIPQYGGSLPGTVVYPKGNQKGCRNFD  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
              GISF SK+G++PTFV+VDRGDC FALK WNAQNAGA+A+LVADDV+ERLITMD+PE D
Sbjct  83   DSGISFKSKSGAMPTFVLVDRGDCFFALKVWNAQNAGAAAVLVADDVDERLITMDTPEAD  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
            GSS+ Y+ENITIPSALIEKSF EKLKKAV
Sbjct  143  GSSAKYIENITIPSALIEKSFAEKLKKAV  171



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDN+KGCK FD 
Sbjct  26   SCVGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNKKGCKEFDD  85

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FG+SF S+ G+LPTFV++DRGDC FALK WNAQ AGASA+LV+DD+EE LITMD+PEEDG
Sbjct  86   FGVSFKSRPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVSDDIEEPLITMDTPEEDG  145

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+NY+ENITIPSALIEKSFGE LKKA+
Sbjct  146  SSANYIENITIPSALIEKSFGEILKKAL  173



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+  RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDG
Sbjct  23   SSIARFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDG  82

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF SK G+LPTFV+VDRGDC FALK WNAQ  GASA+LVADD+EE LITMD+PEED 
Sbjct  83   FGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKVGASAVLVADDMEEALITMDTPEEDV  142

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEKSFGE LKK++
Sbjct  143  SSAKYIENITIPSALIEKSFGETLKKSL  170



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+KGCK FD F I
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKGCKAFDEFSI  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED SSS
Sbjct  84   SFPSKPGSLPTFVLVDRGDCFFALKVWNVQKAGASAVLVADDIEEALITMDTPEEDSSSS  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSALI+KSFGE LKKA+
Sbjct  144  KYIENITIPSALIQKSFGEALKKAI  168



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G V+YPKDNRKGCK FD 
Sbjct  22   SSIAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVLYPKDNRKGCKEFDD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK G+LPTFV++DRG+C FALK WNAQ AGASA+LVADD+EE+LITMD+PEEDG
Sbjct  82   SGISFKSKPGALPTFVLLDRGNCFFALKVWNAQKAGASAVLVADDIEEKLITMDTPEEDG  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK FGEKLK A+
Sbjct  142  SSAKYIENITIPSALIEKKFGEKLKSAI  169



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  107  MGASEKPKAPIllglllltllESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYG  286
            MG  E+ K+ ILLG L+L L +   GRFVVEKN+L+V SPDSIKGT+DSA+GNFGIPQYG
Sbjct  1    MGRYERSKSAILLGFLVLNLTQLVMGRFVVEKNSLRVTSPDSIKGTHDSAIGNFGIPQYG  60

Query  287  GSMTGTVVYPKDNRKGCKGFDGFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGAS  466
            GSM+GTVV+PK+N+KGCK F  FG SF  K+G++P F++VDRGDC FALK WNAQNAGAS
Sbjct  61   GSMSGTVVFPKENQKGCKTFSDFGSSFKPKSGAMPNFLLVDRGDCLFALKVWNAQNAGAS  120

Query  467  AILVADDVEERLITMDSPEEDGSSSNYVENITIPSALIEKSFGEKLKKAV  616
            A+LVADDV+E LITMDSPEE+ SS+ Y+ENITIPSALIEKSFGEKLKKA+
Sbjct  121  AVLVADDVDEALITMDSPEEERSSAKYIENITIPSALIEKSFGEKLKKAI  170



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L V SP+ IKGTYDSA+GNFGIPQYGGSM GTVVYPKDN+K CK FD F I
Sbjct  24   GRFVVEKNSLTVTSPEKIKGTYDSAIGNFGIPQYGGSMAGTVVYPKDNQKACKAFDEFSI  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED SSS
Sbjct  84   SFQSKPGSLPTFVLVDRGDCFFALKVWNVQKAGASAVLVADDIEEALITMDTPEEDSSSS  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSALI+KSFGE LKKA+
Sbjct  144  KYIENITIPSALIQKSFGEALKKAI  168



>gb|KEH44022.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=529

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDG
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDG  142

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGEKLKKA+
Sbjct  143  SSAKYIENITIPSALIEKNFGEKLKKAI  170



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFGIS
Sbjct  27   RFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGIS  86

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+P ED SS+ 
Sbjct  87   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEPLITMDTPAEDASSAQ  146

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSF E LKKA+
Sbjct  147  YIENITIPSALIEKSFSETLKKAL  170



>ref|XP_007042634.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
 gb|EOX98465.1| Vaculolar sorting receptor 3 isoform 2, partial [Theobroma cacao]
Length=501

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FGIS
Sbjct  23   RFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGIS  82

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED SS+ 
Sbjct  83   FQSKPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDTSSAK  142

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEK+FGE LKKA+
Sbjct  143  YLENITIPSALIEKTFGETLKKAI  166



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S   RFVVEKN+L+V SPD I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F  
Sbjct  25   SLHARFVVEKNSLRVTSPDRIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFSD  84

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            +GISF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDG
Sbjct  85   YGISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEALITMDSPEEDG  144

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            S++ Y+ENITIPSALIEKSFGE LKKA+
Sbjct  145  STAKYIENITIPSALIEKSFGETLKKAI  172



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N KGCK FD F
Sbjct  29   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENMKGCKDFDDF  88

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF +K+G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSP+EDG 
Sbjct  89   GISFKTKSGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPQEDGG  148

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALI+K FG+KLKKA+
Sbjct  149  SAKYIENITIPSALIDKKFGDKLKKAL  175



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+  +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD 
Sbjct  23   SSMAKFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDE  82

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDG
Sbjct  83   SGISFKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDG  142

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGEKLKKA+
Sbjct  143  SSAKYIENITIPSALIEKNFGEKLKKAI  170



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 132/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   
Sbjct  25   SVARFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDA  84

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS
Sbjct  85   GISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEERLITMDSPEEDGS  144

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFGEKLKK +
Sbjct  145  TAKYIENITIPSALIEKSFGEKLKKEI  171



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            ++  GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM G VVYPKDNRKGCK FD
Sbjct  22   QAVVGRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGIVVYPKDNRKGCKNFD  81

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +KAG++P FV+VDRGDC FALK WNAQNAGA+A+LVADD++E LITMDSPEED
Sbjct  82   DFGISFKAKAGAMPNFVLVDRGDCFFALKVWNAQNAGAAAVLVADDLDEPLITMDSPEED  141

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             +S+ Y+ NITIPSAL++K+FGEKLK+A+
Sbjct  142  AASAKYIVNITIPSALVDKNFGEKLKQAI  170



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFSEF  81

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GI+F S  G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  82   GITFKSSPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEALITMDSPEEDGS  141

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            +S Y+ENITIPSALIEK FGE LKKA+
Sbjct  142  TSKYIENITIPSALIEKRFGEXLKKAI  168



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GI F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFG+ LKKA+
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAI  168



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L++ SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FDGFGIS
Sbjct  27   RFVVEKNSLRITSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFDGFGIS  86

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+P ED SS+ 
Sbjct  87   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEPLITMDTPAEDVSSAQ  146

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSF E LKKA+
Sbjct  147  YIENITIPSALIEKSFSETLKKAL  170



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GI F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFG+ LKKA+
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAI  168



>gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V YPKDNRKGCK F+ F
Sbjct  24   SVARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVTYPKDNRKGCKDFNDF  83

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            G+SF S+ G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  84   GLSFKSQPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPEEDGS  143

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENIT+PSALIEKSFGE LKKA 
Sbjct  144  ATKYIENITVPSALIEKSFGEMLKKAT  170



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   241 bits (614),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            +FVVEKN+L+V SPDSIKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK FD  GIS
Sbjct  3    KFVVEKNSLRVTSPDSIKGTYDSAIGNFGIPQYGGSMAGNVVYPKDNQKGCKEFDESGIS  62

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPT V++DRG C FALK WNAQ AGAS++LVADD+EE+LITMD+PEEDGSS+ 
Sbjct  63   FKSKPGALPTIVLLDRGSCFFALKVWNAQKAGASSVLVADDIEEKLITMDTPEEDGSSAK  122

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEK+FGEKLKKA+
Sbjct  123  YIENITIPSALIEKNFGEKLKKAI  146



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+  RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  23   SSIARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKDNKKGCKEFEE  82

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED 
Sbjct  83   FRISFQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDMEEALITMDTPEEDV  142

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEKSFGE LKKA+
Sbjct  143  SSAKYIENITIPSALIEKSFGETLKKAL  170



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   GIS
Sbjct  29   RFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGIS  88

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS++ 
Sbjct  89   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNLEERLITMDSPEEDGSTAK  148

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSFGEKLKK +
Sbjct  149  YIENITIPSALIEKSFGEKLKKEI  172



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G V+YPK+NRKGCKGFD FGIS
Sbjct  23   RFVVEKNSLMVTSPEKIKGTHDSAIGNFGIPQYGGSMAGAVIYPKENRKGCKGFDEFGIS  82

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV++DRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED SS+ 
Sbjct  83   FQSKPGALPTFVLLDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDTSSAK  142

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEK+FGE LKKA+
Sbjct  143  YLENITIPSALIEKTFGETLKKAI  166



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   241 bits (614),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKN+L+V SPD IKGTYD+A+GNFGIPQYGGSM G V+YPK N+KGCK F  F
Sbjct  22   ANGRFVVEKNSLRVTSPDKIKGTYDTAIGNFGIPQYGGSMAGAVLYPKQNQKGCKEFSEF  81

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GI F S+ G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS
Sbjct  82   GIKFESRPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDSPEEDGS  141

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFG+ LKKA+
Sbjct  142  TAKYIENITIPSALIEKSFGQILKKAI  168



>gb|KJB12290.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=532

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAI  169



>ref|XP_004159916.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 3-like 
[Cucumis sativus]
Length=631

 Score =   239 bits (610),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L+V SPD +KGTYDSA+GNFGIPQYGGSM+GTVV+PK+N+KGC+ F   GIS
Sbjct  29   RFVVEKNSLRVTSPDGLKGTYDSAIGNFGIPQYGGSMSGTVVFPKENQKGCREFSDAGIS  88

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EERLITMDSPEEDGS++ 
Sbjct  89   FQSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNLEERLITMDSPEEDGSTAK  148

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALI KSFGEKLKK +
Sbjct  149  YIENITIPSALIXKSFGEKLKKEI  172



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A  RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F+ F
Sbjct  28   ATARFVVEKNSLTVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENMKACKDFNEF  87

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            G SF +K G+LPTFV+VDRGDC FALK WNAQNAGASA+LVAD+VEE LITMDSP+EDG 
Sbjct  88   GTSFKAKPGALPTFVLVDRGDCFFALKVWNAQNAGASAVLVADNVEEPLITMDSPQEDGG  147

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALI+K+FGEKLKKA+
Sbjct  148  STKYIENITIPSALIDKNFGEKLKKAL  174



>gb|KJB12295.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=477

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAI  169



>gb|KCW63607.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=578

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EERLITMDSPEEDGS
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEERLITMDSPEEDGS  155

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFGE LKKA+
Sbjct  156  TAKYIENITIPSALIEKSFGETLKKAI  182



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   238 bits (607),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF S  G+LPTFV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  83   GISFKSTPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEALITMDSPEEDGS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFG+ LKK++
Sbjct  143  TAKYIENITIPSALIEKSFGQTLKKSI  169



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +A RFVVEKN+L V SPD IKG YDSA+GNFGIPQYGGSM G V YP+ NRKGCK F  F
Sbjct  36   SAARFVVEKNSLAVTSPDKIKGNYDSAIGNFGIPQYGGSMAGAVTYPEKNRKGCKEFSEF  95

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EERLITMDSPEEDGS
Sbjct  96   DISFKSKPGMLPKFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEERLITMDSPEEDGS  155

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFGE LKKA+
Sbjct  156  TAKYIENITIPSALIEKSFGETLKKAI  182



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LV+DD+EE+LITMD+PEEDGS
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVSDDIEEKLITMDTPEEDGS  143

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALIEKSFGEKLK A+
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKVAI  170



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  +FVVEKN+L V SPD IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDDIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LV+DD+EE+LITMD+PEEDGS
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVSDDIEEKLITMDTPEEDGS  143

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALIEKSFGEKLK A+
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKVAI  170



>gb|KDO57883.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=410

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSALI+KSFGE LKKA+
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKAL  171



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            ++ RFVVEKN+L+V SPD IKGTYDSA+GNFGIPQYGGSM G V+YPK+N+KGCK F  F
Sbjct  23   SSARFVVEKNSLRVTSPDKIKGTYDSAIGNFGIPQYGGSMAGAVLYPKENQKGCKEFSEF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF S  G+LP FV+VDRGDC FALK WNAQ AGASA+LVAD++EE LITMDSPEEDGS
Sbjct  83   GISFKSTPGALPKFVLVDRGDCFFALKVWNAQKAGASAVLVADNIEEPLITMDSPEEDGS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            +S Y+ENITIPSALIEKSFG+ LKK++
Sbjct  143  TSKYIENITIPSALIEKSFGQTLKKSI  169



>gb|KJB12294.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=604

 Score =   235 bits (600),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAI  169



>gb|KJB32253.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=559

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGI
Sbjct  26   ARFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGI  85

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++
Sbjct  86   SFKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAA  145

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSALIEK FGE LKKA+
Sbjct  146  KYIENITIPSALIEKKFGETLKKAI  170



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAI  169



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +   RFVVEKN+L V SP+ IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+K CK F  
Sbjct  22   NCCARFVVEKNSLTVTSPEKIKGTHDSAIGNFGIPQYGGSMAGVVVYPKENQKACKSFGD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF SK GSLPTFV+VDRGDC FALK WN Q AGASA+LVADD+EE LITMD+PEED 
Sbjct  82   FGISFKSKPGSLPTFVLVDRGDCFFALKVWNVQQAGASAVLVADDIEEALITMDNPEEDS  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSALIEK+FGE LKKA+
Sbjct  142  SSAKYIENITIPSALIEKTFGETLKKAI  169



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S   RFVVEKN+L+V SPD +KGTYD+A+GNFGIPQYGGSM GTV+YPKDN+KGCK F  
Sbjct  28   SIESRFVVEKNSLRVTSPDDVKGTYDTAIGNFGIPQYGGSMAGTVIYPKDNKKGCKDFSD  87

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF  K G LPTFV++DRGDC FALK WNAQ AGA+A+LVADDV+E LITMD+PEED 
Sbjct  88   FSISFKKKPGQLPTFVLLDRGDCFFALKVWNAQEAGAAAVLVADDVDEALITMDTPEEDT  147

Query  533  SSSNYVENITIPSALIEKSFGEKLKKA  613
             SS Y+ENITIPSALIEKSFGE LKKA
Sbjct  148  VSSKYIENITIPSALIEKSFGESLKKA  174



>ref|XP_006849341.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
 gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L V SPDSI+G +DSA+GNFG+PQYGGSM G VVYPKDN+KGCKGFD FG+
Sbjct  7    GRFVVEKNSLTVTSPDSIRGMHDSAIGNFGVPQYGGSMAGAVVYPKDNKKGCKGFDEFGL  66

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SK G+LPTFV++DRG C F LK WNAQNAGA+A+LVADD +E LITMDSPEED  ++
Sbjct  67   SFKSKLGALPTFVMLDRGGCFFTLKVWNAQNAGAAAVLVADDTDEPLITMDSPEEDDKAA  126

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI+K+FG+KLKKA+
Sbjct  127  RYIQNITIPSALIDKNFGDKLKKAL  151



>gb|KJB32254.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=600

 Score =   232 bits (592),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGIS
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++ 
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAAK  146

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEK FGE LKKA+
Sbjct  147  YIENITIPSALIEKKFGETLKKAI  170



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+ E+LITMD+PEED S
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVADDIVEKLITMDTPEEDVS  143

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALIEKSFGEKLK A+
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKDAI  170



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD +
Sbjct  24   SMAKFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDEY  83

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            GISF SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+ E+LITMD+PEED S
Sbjct  84   GISFKSKPGALPTIVLLDRGNCFFALKVWNAQKAGASAVLVADDIVEKLITMDTPEEDVS  143

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALIEKSFGEKLK A+
Sbjct  144  SAKYIENITIPSALIEKSFGEKLKDAI  170



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            +FVVEKN+L V SPD+IKGT+DSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD  GIS
Sbjct  26   KFVVEKNSLTVTSPDNIKGTHDSAIGNFGIPQYGGSMAGNVVYPKENQKGCKEFDDSGIS  85

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPT V++DRG+C FALK WNAQ AGASA+LVADD+EE+LITMD+PEEDGSS+ 
Sbjct  86   FKSKPGALPTVVLLDRGNCFFALKVWNAQKAGASAVLVADDIEEKLITMDTPEEDGSSAK  145

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEKSFG KLK A+
Sbjct  146  YIENITIPSALIEKSFGGKLKDAI  169



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L++ SP+ IKGTYDSA+GNFGIPQYGGSM G VVYPK+N+KGCK FD FGIS
Sbjct  27   RFVVEKNSLRLTSPEKIKGTYDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKSFDDFGIS  86

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LP FV+VDRGDC FALK WN Q AGASA+LVADD++E LITMD+PEED  ++ 
Sbjct  87   FKSKPGALPAFVLVDRGDCFFALKVWNVQQAGASAVLVADDIQEALITMDTPEEDRLAAK  146

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALIEK FGE LKKA+
Sbjct  147  YIENITIPSALIEKKFGETLKKAI  170



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  140

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ YVENITIPSAL+ KSF +KLK A+
Sbjct  141  SSAKYVENITIPSALVGKSFAQKLKDAI  168



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  21   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVLYPKDNKKGCKEFDD  80

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  81   FGISFKSSPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  140

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ YVENITIPSAL+ KSF +KLK A+
Sbjct  141  SSAKYVENITIPSALVGKSFAQKLKDAI  168



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  155

Query  533  SSSNYVENITIPSALIEKSFGEKLKKA  613
            SS+ YVENITIPSAL+ KSFG KLK A
Sbjct  156  SSAKYVENITIPSALVGKSFGLKLKDA  182



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G V+YPKDN+KGCK FD 
Sbjct  36   STMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVIYPKDNKKGCKEFDE  95

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            FGISF S  G+LPT V++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  96   FGISFKSTPGALPTIVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  155

Query  533  SSSNYVENITIPSALIEKSFGEKLKKA  613
            SS+ YVENITIPSAL+ KSFG KLK A
Sbjct  156  SSAKYVENITIPSALVGKSFGLKLKDA  182



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPKDN+KGCK F+ 
Sbjct  19   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDNKKGCKEFED  78

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF S  G+LPTFV++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  79   SGISFKSTPGALPTFVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  138

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ YV NITIPSAL+ KSFGEKLK A+
Sbjct  139  SSAKYVANITIPSALVGKSFGEKLKDAI  166



>gb|KDO57886.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=560

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSALI+KSFGE LKKA+
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKAL  171



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L+V SPD IKG YDSA+GNFG+PQYGGSM+G V+YPK+N+KGCK F  F
Sbjct  23   STARFVVEKNSLRVTSPDKIKGKYDSAIGNFGLPQYGGSMSGAVIYPKENQKGCKEFSDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            G+S+ S  G+LPTF++VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  83   GLSYKSTPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEEDIS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y+ENITIPSALIEKSFG+ LKK++
Sbjct  143  TAKYIENITIPSALIEKSFGQTLKKSI  169



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSALI+KSFGE LKKA+
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKAL  171



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSALI+KSFGE LKKA+
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKAL  171



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSALI+KSFGE LKKA+
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKAL  171



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SPDSIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  27   ARFVVEKNSLSVTSPDSIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  86

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  87   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  146

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  147  KYIENITIPSALVTKGFGEKLKKAI  171



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S   RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  
Sbjct  19   SCEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSD  78

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED 
Sbjct  79   FSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDV  138

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  139  SSAKYIENITIPSALVTKGFGEKLKKAI  166



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            S+ S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ KSFGEKLKKA+
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAI  166



>gb|EPS57970.1| hypothetical protein M569_16845, partial [Genlisea aurea]
Length=598

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 128/146 (88%), Gaps = 4/146 (3%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKD-NRKGCKGFDGFG  358
            GRFVVEKN+L+V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPKD NRKGCK FD   
Sbjct  1    GRFVVEKNSLRVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVLYPKDDNRKGCKTFDA--  58

Query  359  ISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  538
             SF + AG+LP F++VDRGDC FALK WNAQNAGA+A+LVADDV E LITMD+PEEDGSS
Sbjct  59   -SFKANAGALPNFLLVDRGDCFFALKVWNAQNAGAAAVLVADDVSEALITMDTPEEDGSS  117

Query  539  SNYVENITIPSALIEKSFGEKLKKAV  616
             +Y+ NITIPSAL+ KSFGEKLKKAV
Sbjct  118  LSYIANITIPSALVTKSFGEKLKKAV  143



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
             ++  RFVVEKN+L V SP+ IKG++DSA+GNFGIPQYGGSM G V YPK+NRKGC+ F 
Sbjct  23   HTSVSRFVVEKNSLMVTSPEKIKGSHDSAIGNFGIPQYGGSMAGAVTYPKENRKGCREFG  82

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FGISF +K G+LP FV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMD+PEED
Sbjct  83   DFGISFKAKPGALPNFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEALITMDTPEED  142

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSALI+KSFGE LKK++
Sbjct  143  ISSAKYIENITIPSALIDKSFGETLKKSL  171



>ref|XP_004173121.1| PREDICTED: vacuolar-sorting receptor 3-like, partial [Cucumis 
sativus]
Length=517

 Score =   226 bits (576),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
              GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ YVENITIPSALI K F E+LKK +
Sbjct  143  TATYVENITIPSALIRKGFSEQLKKEI  169



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
             +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  
Sbjct  24   CSEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSD  83

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED 
Sbjct  84   FSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDV  143

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ Y+ENITIPSAL+ K+FGEKLKKA+
Sbjct  144  SSAKYIENITIPSALVTKTFGEKLKKAI  171



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   228 bits (581),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F
Sbjct  23   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED S
Sbjct  83   SISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  143  SAKYIENITIPSALVTKGFGEKLKKAI  169



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAI  166



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSAL+ KSFGEKLKKA+
Sbjct  141  YIENITIPSALVTKSFGEKLKKAI  164



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAI  167



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            S+ S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SYKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ KSFGEKLKKA 
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAT  166



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAI  167



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   228 bits (580),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENQKACKEFSDFSI  90

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF+++DRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  150

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ KSFGEK+KKA+
Sbjct  151  KYIENITIPSALVTKSFGEKMKKAI  175



>gb|AIY30334.1| vacuolar-sorting receptor 3 protein, partial [Ziziphus jujuba]
Length=155

 Score =   214 bits (544),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 113/127 (89%), Gaps = 0/127 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKNNL+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPK+N+KGCK F  FGIS
Sbjct  29   RFVVEKNNLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGAVVYPKENQKGCKEFTDFGIS  88

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G+LPTFV+VDRGDC FALK WNAQ AGASA+LVADD+EE LITMDSPEEDGS++ 
Sbjct  89   FKSKPGALPTFVLVDRGDCFFALKVWNAQKAGASAVLVADDIEEPLITMDSPEEDGSTAK  148

Query  545  YVENITI  565
            Y+ENITI
Sbjct  149  YIENITI  155



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  144  KYIENITIPSALVTKGFGEKLKKAI  168



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAI  167



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  23   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  82

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  83   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  142

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  143  KYIENITIPSALVTKGFGEKLKKAI  167



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   227 bits (579),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  24   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  84   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  144  KYIENITIPSALVTKGFGEKLKKAI  168



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFG+PQYGGSM GTVVYPK+N K CK F  F I
Sbjct  31   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGVPQYGGSMAGTVVYPKENHKACKEFSDFSI  90

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF+++DRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  91   SFKSQPGALPTFLLLDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  150

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ KSFGEK+KKA+
Sbjct  151  KYIENITIPSALVTKSFGEKMKKAI  175



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  82   SFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAI  166



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
              GRFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMGRFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFGDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ YVENITIPSALI K F E+LKK +
Sbjct  143  TATYVENITIPSALIRKGFSEQLKKEI  169



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
             +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTV+YPK+N+K CK F  
Sbjct  24   CSEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVIYPKENQKSCKEFSD  83

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED 
Sbjct  84   FSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDI  143

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ YVENITIPSAL+ K FGEKLKK++
Sbjct  144  SSAKYVENITIPSALVTKGFGEKLKKSI  171



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   226 bits (577),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A  +FVVEKN+L+V SP++IKG YDSA+GNFGIPQYGG+M GT VYPK+N+ GCK FD F
Sbjct  29   AMAKFVVEKNSLRVLSPENIKGNYDSAIGNFGIPQYGGTMVGTAVYPKENQNGCKTFDTF  88

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LP  V+V+RGDC FALK WNAQNAGA+A+LV+DD +E LITMDSPEED S
Sbjct  89   EISFKSKPGGLPNVVLVNRGDCYFALKVWNAQNAGAAAVLVSDDRDEPLITMDSPEEDSS  148

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y++NITIPSALIEK+FG+KLK A+
Sbjct  149  AAEYLQNITIPSALIEKAFGDKLKVAI  175



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQ-  78

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
              SF S+ G+LPT +++DRG+C FALK WNAQ AGASA+LVADD+EE LITMD+PEEDGS
Sbjct  79   --SFKSRPGALPTILLLDRGNCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDGS  136

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALIEKSFGEKLK A+
Sbjct  137  SAKYIENITIPSALIEKSFGEKLKDAI  163



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  141  YIENITIPSALVTKGFGEKLKKAI  164



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 125/147 (85%), Gaps = 3/147 (2%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM GTVVYPKDN KGCK FD  
Sbjct  20   SMARFVVEKNSLSVTSPDKIKGRHDSAIGNFGIPQYGGSMAGTVVYPKDNNKGCKDFDQ-  78

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
              SF S+ G+LPT +++DRG+C FALK WNAQ AGASA+LVADD+EE LITMD+PEEDGS
Sbjct  79   --SFKSRPGALPTILLLDRGNCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDGS  136

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALIEKSFGEKLK A+
Sbjct  137  SAKYIENITIPSALIEKSFGEKLKDAI  163



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ KSFGEKLKKA+
Sbjct  142  KYIENITIPSALVTKSFGEKLKKAI  166



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
               RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ YVENITIPSALI K F E+LKK +
Sbjct  143  TATYVENITIPSALIRKGFSEQLKKEI  169



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
               RFVVEKN+L+V SP+ I+GTYDSA+GNFGIPQYGGS+ G VVYPK+N+KGCK F  F
Sbjct  23   CMARFVVEKNSLRVTSPEKIRGTYDSAIGNFGIPQYGGSLAGVVVYPKENQKGCKDFSDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK GSLP FV+VDRGDC FALK WNAQ  GASA+LVAD ++E LITMDSPEEDGS
Sbjct  83   HISFQSKPGSLPIFVMVDRGDCLFALKVWNAQKVGASAVLVADHLDEPLITMDSPEEDGS  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ YVENITIPSALI K F E+LKK +
Sbjct  143  TATYVENITIPSALIRKGFSEQLKKEI  169



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   224 bits (572),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SPDSIKG +D A+GNFGIPQYGGSM GTVVYPK+N+K CK F  F IS
Sbjct  21   RFVVEKNSLSVTSPDSIKGAHDCAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSIS  80

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F S+ G+LPTF++VDRGDC FALK WNAQ  GASA+LVAD+V+E LITMD+PEED +S+ 
Sbjct  81   FKSQPGALPTFLLVDRGDCFFALKVWNAQKTGASAVLVADNVDEPLITMDTPEEDAASAK  140

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  141  YIENITIPSALVTKGFGEKLKKAI  164



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F  F I
Sbjct  94   ARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSI  153

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED SS+
Sbjct  154  SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSA  213

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  214  KYIENITIPSALVTKGFGEKLKKAI  238



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N K CK F  F
Sbjct  23   SEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENHKSCKEFSDF  82

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +
Sbjct  83   SISFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVA  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  143  SAKYIENITIPSALVTKGFGEKLKKAI  169



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKNNLK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTV+YPK N+K CKGFDG  I
Sbjct  21   GRFVVEKNNLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVIYPKANQKACKGFDGVDI  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTFV+VDRGDC F LKAWNAQN GA+AILVADD +E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDKDEPLITMDTPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++NITIPSALI KS G+ +KKA+
Sbjct  141  DYLQNITIPSALISKSLGDSIKKAI  165



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP++IKGT+DSA+GNFGIPQYGGSM GTVVYP++N K CK F  F I
Sbjct  22   ARFVVEKNSLSVTSPETIKGTHDSAIGNFGIPQYGGSMAGTVVYPRENHKSCKEFSDFSI  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G+LP F++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED +S+
Sbjct  82   SFKSQPGALPIFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVASA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSAL+ K FGEKLKKA+
Sbjct  142  KYIENITIPSALVTKGFGEKLKKAI  166



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = +2

Query  176  AAGRFVV--EKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            +  RFVV  EKN+L V SP+SIKGT+DSA+GNFGIPQYGGSM GTVVYPK+N+K CK F 
Sbjct  22   SEARFVVSNEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFS  81

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             F ISF S+ G+LPTF++VDRGDC FALK WNAQ AGASA+LVAD+V+E LITMD+PEED
Sbjct  82   DFSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEED  141

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             SS+ Y+ENITIPSAL+ K FGEKLK+A+
Sbjct  142  VSSAKYIENITIPSALVTKGFGEKLKQAI  170



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+ I+GT+DSA+GNFGIPQYGGSM G VVYPKD++KGCK F+ 
Sbjct  19   SIMGRFVVEKNSLRVTSPEKIRGTHDSAIGNFGIPQYGGSMAGNVVYPKDDKKGCKEFED  78

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF S  G+LPTFV++DRG C FALK WNAQ AGASA+LVADDVEE LITMD+PEEDG
Sbjct  79   SGISFKSTPGALPTFVLLDRGSCFFALKVWNAQKAGASAVLVADDVEEPLITMDTPEEDG  138

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS+ YV NITIPSA + K+ GE LK A+
Sbjct  139  SSAKYVANITIPSAPVGKNLGENLKDAL  166



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   220 bits (560),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  G+FVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPK NRKGC+GFD 
Sbjct  20   SCWGKFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKANRKGCQGFDN  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ SK G  PTF++VDRGDC F  KAWNAQNAGA+A+LVAD+  E LITMD+PEED 
Sbjct  80   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAVLVADNKAEPLITMDTPEEDD  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAVK  619
            + ++Y++NITIPSALI KSFG+ LKKA++
Sbjct  140  NKADYLQNITIPSALISKSFGDSLKKAIE  168



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   219 bits (557),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+KGCK FD 
Sbjct  19   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKANQKGCKNFDD  78

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  79   FEISFRSRLAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  138

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            S ++Y++NITIPSAL+ +S G  +K A+
Sbjct  139  SDADYLQNITIPSALVSRSLGSAIKTAI  166



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   218 bits (555),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            S+ +K G+ PTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G  +
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDKDEPLITMDTPEESG-RA  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y+ENITIPSALI KSFG++LKKA+
Sbjct  144  DYLENITIPSALITKSFGDRLKKAI  168



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   218 bits (555),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  24   GRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDDFDI  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            S+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G ++
Sbjct  84   SYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEE-GGNT  142

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y+ENITIPSALI KSFG++LKKA+
Sbjct  143  DYLENITIPSALITKSFGDRLKKAI  167



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   218 bits (554),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 100/145 (69%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANKKACKSFDDFDI  84

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            S+ +K G+ PTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G  +
Sbjct  85   SYKAKPGAFPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDKDEPLITMDTPEESG-RA  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y+ENITIPSALI KSFG++LKKA+
Sbjct  144  DYLENITIPSALITKSFGDRLKKAI  168



>ref|XP_010543160.1| PREDICTED: vacuolar-sorting receptor 2 [Tarenaya hassleriana]
Length=628

 Score =   218 bits (555),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKNNL+V SP+SI+G Y+ A+GNFG+PQYGGSMTG VV+PK N+KGC+ FD F I
Sbjct  23   GRFVVEKNNLRVTSPESIRGIYECAIGNFGVPQYGGSMTGEVVFPKANQKGCQSFDQFDI  82

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SFSSK G LPTFV+VDRGDC F LKAWNAQ AGA+ ILV D+  E LITMD+PEE+ + +
Sbjct  83   SFSSKPGGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVVDNRPEPLITMDAPEEETADA  142

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++NITIPSAL+ KS G  +K A+
Sbjct  143  DYLQNITIPSALVSKSLGNAMKMAI  167



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   218 bits (554),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE+G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEENG  143

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAI  170



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAI  170



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   218 bits (554),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSAL+ +S G  +K A+
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAI  167



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   217 bits (553),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            S ++Y++NITIPSAL+ +S G  +K A+
Sbjct  140  SDADYLQNITIPSALVSRSLGSAIKTAI  167



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   217 bits (553),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 96/148 (65%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FDG
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDG  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSAL+ +S G  +K A+
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAI  167



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAI  170



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  24   SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  83

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  84   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  143

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  144  -NTDYLENITIPSALITKSFGDKLKKAI  170



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   217 bits (553),  Expect = 7e-63, Method: Composition-based stats.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N+K CK FD 
Sbjct  20   SCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDD  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            S ++Y++NITIPSAL+ +S G  +K A+
Sbjct  140  SDADYLQNITIPSALVSRSLGSAIKTAI  167



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  18   CCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKSNRKACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G
Sbjct  78   FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESG  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
              ++Y+ENITIPSALI KSFG++L+KAV
Sbjct  138  -RADYLENITIPSALITKSFGDRLRKAV  164



>ref|NP_001169650.1| hypothetical protein precursor [Zea mays]
 gb|ACN34397.1| unknown [Zea mays]
Length=521

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  21   CCQGRFVVEKNSLKVTAPDGLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  80

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  81   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEE-G  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG++LKKA+
Sbjct  140  GNTDYLENITIPSALITKSFGDRLKKAI  167



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   216 bits (551),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSD-SD  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            +F  K+G LP  V+VDRGDC FALK WNAQNAGA+A+LVADD  E LITMDSPEED ++S
Sbjct  81   TFRRKSGGLPNVVLVDRGDCYFALKVWNAQNAGAAAVLVADDRSEPLITMDSPEEDSAAS  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             YVENITIPSALIEKSF +KLK+A+
Sbjct  141  EYVENITIPSALIEKSFADKLKRAL  165



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SP  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  126  SCHGRFVVEKNSLKVTSPSDMKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  185

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G
Sbjct  186  FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG  245

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  246  -NTDYLENITIPSALITKSFGDKLKKAI  272



>gb|KDO64109.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=362

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI KS G+ +KK++
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSL  165



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   216 bits (550),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 101/145 (70%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            G+F+VEKN+L V SPDS+KGTYDSA+GNFG+PQYGG+M GTV YPKD+R  CK +     
Sbjct  22   GKFLVEKNSLSVTSPDSLKGTYDSAIGNFGVPQYGGTMVGTVTYPKDSRMACKPYSD-SD  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            +F  K+G LP  V+VDRGDC FALK WNAQNAGA+A+LVADD  E LITMDSPEED ++S
Sbjct  81   TFRRKSGGLPNVVLVDRGDCYFALKVWNAQNAGAAAVLVADDRTEPLITMDSPEEDSAAS  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             YVENITIPSALIEKSF +KLK+A+
Sbjct  141  EYVENITIPSALIEKSFADKLKRAL  165



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C  FD 
Sbjct  21   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACSKFDD  80

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK GS PTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD PEE+ 
Sbjct  81   FDISFKSKPGSFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADDKVEPLITMDMPEEES  140

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
              ++Y++NITIPSALI KSFG+ LKKA+
Sbjct  141  GGADYLQNITIPSALISKSFGDNLKKAL  168



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LK+ SPDS+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   I
Sbjct  21   GRFVVEKNSLKLTSPDSLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEED + +
Sbjct  81   SFKSRPGWLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDKVEPLITMDNPEEDDADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI KS G+ +KKA+
Sbjct  141  AYLQNITIPSALISKSLGDSIKKAI  165



>gb|KGN58683.1| hypothetical protein Csa_3G728010 [Cucumis sativus]
Length=522

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + SNY++ I IPSALI KS G+ +KKA+
Sbjct  138  ADSNYLKGIAIPSALISKSLGDDIKKAL  165



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 3/147 (2%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L V SP+ IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  20   STARFVVEKNSLSVTSPEKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNSKGCKDFDS-  78

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
              SF S+ G+LPT +++DRG C FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  79   --SFKSRPGALPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVS  136

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALI KSFGEKLK A+
Sbjct  137  SAKYIENITIPSALIGKSFGEKLKDAI  163



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   216 bits (549),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 97/148 (66%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G VVYPK N K CK FD 
Sbjct  22   SCTGRFVVEKNNLRVTSPESIRGIYECALGNFGVPQYGGSMSGAVVYPKANHKSCKNFDD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMDSPE++ 
Sbjct  82   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDSPEDET  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSAL+ +S G+ +K A+
Sbjct  142  ADADYLQNITIPSALVSRSLGDAIKTAI  169



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 121/147 (82%), Gaps = 1/147 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            +  RFVVEKN+L V SPD IKG +DSA+GNFGIPQYGGSM G VVYPKDN KGCK FD  
Sbjct  21   STARFVVEKNSLSVTSPDKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNNKGCKDFDDS  80

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
              SF SK G+LPT +++DRG C FALK WNAQ AGASA+LVADD+EE LITMD+PEED S
Sbjct  81   S-SFKSKPGALPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVS  139

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            S+ Y+ENITIPSALI K+FG+KLK A+
Sbjct  140  SAKYIENITIPSALIGKTFGQKLKDAI  166



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  25   CCQGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  84

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  85   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG  144

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG++LKKA+
Sbjct  145  -NTDYLENITIPSALITKSFGDRLKKAI  171



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   214 bits (546),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFG+PQYGGSM+G V+YPK N+K CK FD 
Sbjct  20   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVLYPKANQKACKNFDD  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  80   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSAL+ +S G  +K A+
Sbjct  140  TDADYLQNITIPSALVSRSLGSAIKTAI  167



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
 ref|XP_004160331.1| PREDICTED: vacuolar-sorting receptor 1-like [Cucumis sativus]
Length=624

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + SNY++ I IPSALI KS G+ +KKA+
Sbjct  138  ADSNYLKGIAIPSALISKSLGDDIKKAL  165



>gb|KJB71518.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=569

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +++ Y++NITIPSALI KS G+ LKKA+
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKAL  165



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   214 bits (546),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV  PDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTYPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK GSLPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMDSPEE  
Sbjct  78   VGISFKSKPGSLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDRLEPLITMDSPEEAK  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + +NY+++ITIPSALI KS G+++KKA+
Sbjct  138  ADANYLKDITIPSALISKSLGDEIKKAL  165



>gb|KDO64107.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
 gb|KDO64108.1| hypothetical protein CISIN_1g0100101mg, partial [Citrus sinensis]
Length=410

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI KS G+ +KK++
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSL  165



>gb|EEC66779.1| hypothetical protein OsI_33169 [Oryza sativa Indica Group]
Length=231

 Score =   204 bits (519),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN   C+ +DG    
Sbjct  28   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDNADACEAYDG-DRH  86

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++ 
Sbjct  87   FRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAAK  146

Query  545  YVENITIPSALIEKSFGEKLKKAVK  619
            Y++NITIPSALI+K FGE+LKKA+K
Sbjct  147  YIQNITIPSALIDKKFGEQLKKAIK  171



>gb|KDO64106.1| hypothetical protein CISIN_1g0100101mg [Citrus sinensis]
Length=411

 Score =   209 bits (533),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI KS G+ +KK++
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSL  165



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  22   CCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  82   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKK +
Sbjct  142  -NTDYLENITIPSALITKSFGDKLKKVI  168



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV +PD +KGTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  22   CCHGRFVVEKNSLKVTAPDDLKGTYECAIGNFGVPQYGGTMVGFVAYPKANRKACKSFDD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K G+ PTF++VDRGDC FA KAWNAQ AGA+AILVADD +E LITMD+PEE G
Sbjct  82   FDISYKAKPGAFPTFLLVDRGDCYFAKKAWNAQKAGAAAILVADDKDEPLITMDNPEESG  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKK +
Sbjct  142  -NTDYLENITIPSALITKSFGDKLKKVI  168



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   214 bits (545),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 98/145 (68%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L+V +P ++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +
Sbjct  43   ARFVVEKNSLRVTAPVALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDV  102

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF ++ G+LPTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G   
Sbjct  103  SFKARPGALPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDRDEPLITMDTPEESGRVE  162

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y+ENITIPSALI KSFG++LKKA+
Sbjct  163  -YLENITIPSALISKSFGDRLKKAI  186



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SPDS+KG Y+ A+GNFG+PQYGG+M G V YPKDN+K CK F  
Sbjct  19   SCWGRFVVEKNSLKVTSPDSLKGIYECAIGNFGVPQYGGTMVGIVAYPKDNQKACKSFRD  78

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ SK G  PTF++VDRGDC F  KAWNAQNAGA+AILVAD+  E LITMD+PEE+ 
Sbjct  79   FDISYKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADNKAEPLITMDTPEEED  138

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAVK  619
            + ++Y+++ITIPSALI KSFG+ LKKA++
Sbjct  139  TKADYLQDITIPSALISKSFGDSLKKAIE  167



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK ++ F
Sbjct  20   ALGRFVVEKNNLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYNDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S
Sbjct  80   DISFKSKPGRLPTFVLIDRGDCFFTLKAWTAQQAGAAAILVADSKAEPLITMDTPEEDKS  139

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI KS G+ +K A+
Sbjct  140  DADYLQNITIPSALITKSLGDSIKSAL  166



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +++ Y++NITIPSALI KS G+ LKKA+
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKAL  165



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F +SF SK G LPTFV++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED 
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNAQRAGAAAILVADNKVEPLITMDTPEEDN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + + Y++ ITIPSALI KS G+ +K A+
Sbjct  138  ADAEYLDKITIPSALISKSLGDSIKSAL  165



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++VDRGDC F LKAWNAQ AGA+AILVAD  +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKAGAAAILVADSKDEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +++ Y++NITIPSALI KS G+ LKKA+
Sbjct  138  ANAEYLQNITIPSALISKSLGDSLKKAL  165



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LK+ SP+S+KG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   I
Sbjct  21   GRFVVEKNSLKLTSPESLKGVYECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDEVDI  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTFV+ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEED + +
Sbjct  81   SFKSRPGGLPTFVLADRGDCYFTLKAWNAQNGGAAAILVADDKVEPLITMDNPEEDDADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI KS G+ +KKA+
Sbjct  141  AYLQNITIPSALISKSLGDSIKKAL  165



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +A GRFVVEKNNLKV SPDSI+G Y+ A+GNFG+PQYGG++ GTVVYP  N+K CK F+ 
Sbjct  18   TALGRFVVEKNNLKVTSPDSIRGIYECAIGNFGVPQYGGTLVGTVVYPSSNQKACKNFED  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F +SF SK G LPTFV++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED 
Sbjct  78   FDVSFKSKPGHLPTFVLIDRGDCYFTLKAWNAQRAGAAAILVADNKVEPLITMDTPEEDN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + + Y++ ITIPSALI KS G+ +K A+
Sbjct  138  ADAEYLDKITIPSALISKSLGDSIKSAL  165



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   213 bits (543),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+   I
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEEDAQA  140

Query  542  NYVENITIPSALIEKSFGEKLKK  610
            NY++NITIPSALI +S G+ +KK
Sbjct  141  NYLQNITIPSALISQSLGDSIKK  163



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LK+ SPDSIKG Y+ A+GNFG+P+YGG+MTG V YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKITSPDSIKGVYECAIGNFGVPEYGGTMTGIVHYPKANQKACKSFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
             GISF SK GSLPTFV+ DRGDC F +KAWNAQN GA+AILVADD  E LITMDSPEE+ 
Sbjct  78   AGISFKSKPGSLPTFVLADRGDCYFTMKAWNAQNGGAAAILVADDRLEPLITMDSPEEEK  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + +NY++ I IPSALI KS G+ +KKA+
Sbjct  138  ADANYLKGIAIPSALISKSLGDDIKKAL  165



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   213 bits (543),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG++ G VVYPK N+K CK F+   I
Sbjct  21   GRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTLVGNVVYPKANQKSCKSFESADI  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEEDAQA  140

Query  542  NYVENITIPSALIEKSFGEKLKK  610
            NY++NITIPSALI +S G+ +KK
Sbjct  141  NYLQNITIPSALISQSLGDSIKK  163



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   213 bits (542),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SPDS+KG ++ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD 
Sbjct  18   SCLGRFVVEKNSLRVTSPDSVKGIHECAIGNFGVPQYGGTLVGTVVYPKANQKACKGFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VDISFKSKPGGLPTFLLADRGDCYFTLKAWNAQNGGAAAILVADDKLEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++ I IPSALI KS G+ +KKA+
Sbjct  138  ADADYLQKINIPSALITKSLGDSIKKAL  165



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ F  
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANKKACRNFAD  76

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G  PTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   FDISFKSKPGGFPTFLLVDRGDCYFTAKAWNAQNAGAAAILVADDKVEPLITMDTPEEES  136

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAVK  619
              ++Y++NITIPSALI KSFG+ LKKA++
Sbjct  137  GGADYLQNITIPSALISKSFGDNLKKALE  165



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV +PD+++GTY+ A+GNFG+PQYGG+M G V YPK NRK CK FD F I
Sbjct  25   GRFVVEKNSLKVTAPDALRGTYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDDFDI  84

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            S+ +K GS PTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G  +
Sbjct  85   SYKAKPGSFPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESG-RA  143

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +++ENITIPSALI KSFG++L+KAV
Sbjct  144  DHLENITIPSALITKSFGDRLRKAV  168



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV +PDS+KG+Y+ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  93   CCEGRFVVEKNSLKVTAPDSLKGSYECAIGNFGVPQYGGTMVGVVAYPKANRKACKSFDD  152

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ +K GSLPTF++VDRGDC F  KAWNAQNAG +AILVADD +E LITMD+PEE G
Sbjct  153  FDISYKAKPGSLPTFLLVDRGDCFFTKKAWNAQNAGVAAILVADDKDEPLITMDTPEESG  212

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
              ++Y+ENITI SALI KSFG++L+KAV
Sbjct  213  -RADYLENITIASALITKSFGDRLRKAV  239



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   212 bits (540),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNL+V SP+SI+G Y+ ALGNFGIPQYGGSM+G V+YPK N+K CK F  
Sbjct  18   SCMGRFVVEKNNLRVTSPESIRGVYECALGNFGIPQYGGSMSGAVLYPKANQKACKNFAD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E+LITMD+PE++ 
Sbjct  78   FDISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDET  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSAL+ +S G  +K A+
Sbjct  138  TDADYLQNITIPSALVSRSLGSAIKTAI  165



>ref|XP_010253066.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              +SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEEN  136

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS++Y++NITIPSALI KSFG+ +KKA+
Sbjct  137  SSADYLQNITIPSALISKSFGDGIKKAL  164



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP S+KG Y+ A+GNFG+PQYGG+M GTVVYPK N+K C  FD 
Sbjct  17   SCLGRFVVEKNSLRVTSPQSLKGVYECAIGNFGVPQYGGTMVGTVVYPKVNQKACNDFDE  76

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              +SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  77   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEEN  136

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            SS++Y++NITIPSALI KSFG+ +KKA+
Sbjct  137  SSADYLQNITIPSALISKSFGDGIKKAL  164



>ref|XP_007033523.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
 gb|EOY04449.1| Vacuolar sorting receptor isoform 3 [Theobroma cacao]
Length=515

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++VDRGDC F +KAWNAQ AGA+AILVAD+ +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTMKAWNAQKAGAAAILVADNKDEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +S+ YV NITIPSAL+ KS G+ +KKA+
Sbjct  138  ASAEYVLNITIPSALVSKSLGDSIKKAL  165



>emb|CDX91478.1| BnaC04g06720D [Brassica napus]
Length=620

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FG+SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             ++++Y+E I IPSALI KS G+ +K A+
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAI  163



>ref|XP_009143376.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=620

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            E A G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELAFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FG+SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             ++++Y+E I IPSALI KS G+ +K A+
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAI  163



>ref|XP_006842496.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   211 bits (538),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 97/145 (67%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L+V SPDS+K TY+ A+GNFG+PQYGG+M GTV YPK N+K C+ +    I
Sbjct  20   GRFVVEKNSLRVTSPDSLKDTYECAIGNFGVPQYGGTMVGTVTYPKSNQKACREYKEVEI  79

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF SK G LPT V+ DRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ S +
Sbjct  80   SFKSKPGGLPTIVLADRGDCYFTLKAWNAQKAGAAAILVADDKIEPLITMDTPEEENSKA  139

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++NITIPSALI KSFG+ +KKA+
Sbjct  140  DYLQNITIPSALISKSFGDSIKKAL  164



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   211 bits (538),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +S
Sbjct  27   RFVVEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDDFDVS  86

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F ++ G+LPTF++VDRGDC F  KAWNAQNAGA+AILVADD +E LITMD+PEE G    
Sbjct  87   FKARPGALPTFLLVDRGDCYFTKKAWNAQNAGAAAILVADDRDEPLITMDTPEESGRVE-  145

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y+ENITIPSALI KSFG++LKK +
Sbjct  146  YLENITIPSALISKSFGDRLKKTI  169



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   211 bits (538),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF SK G LPTF++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVADDKIEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSALI KSFG+ +K A+
Sbjct  138  AHADYLQNITIPSALISKSFGDSIKNAL  165



>ref|XP_009388213.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=529

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVEKN+LKV SP+S+KG Y+SA+GNFG+PQYGG+M G V YPK N K C  F  
Sbjct  18   TCWGRFVVEKNSLKVTSPNSLKGIYESAIGNFGVPQYGGTMVGIVAYPKVNWKACHNFKD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+ SK G  PTF++VDRGDC F  KAWNAQN+GA+A+LVAD+V E LITM++PEE+ 
Sbjct  78   FDISYKSKPGGFPTFLLVDRGDCYFITKAWNAQNSGAAAVLVADNVAEPLITMNTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAVK  619
            S ++Y++NITIPSALI KSFG++LKKA++
Sbjct  138  SKADYLQNITIPSALISKSFGDRLKKAIE  166



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+ GRFVVEKN+LKV SP+S+KGT++ A+GNFG+PQYGG+M G V YPK NRK CK FD 
Sbjct  17   SSFGRFVVEKNSLKVTSPESLKGTHECAIGNFGVPQYGGTMVGIVSYPKANRKACKSFDD  76

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G  PTF+++DRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PE+  
Sbjct  77   FDISFKSKPGGFPTFLLLDRGDCYFTEKAWNAQNAGAAAILVADDKVENLITMDTPEQYS  136

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAVK  619
               +Y++NITIPSALI KSFG+ LKKA++
Sbjct  137  GGESYLQNITIPSALISKSFGDDLKKALE  165



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVEKN+LKV SP+SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEKNSLKVTSPESIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++VDRGDC F +KAWNAQ AGA+AILVAD+ +E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGGLPTFLLVDRGDCFFTMKAWNAQKAGAAAILVADNKDEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +S+ YV NITIPSAL+ KS G+ +KKA+
Sbjct  138  ASAEYVLNITIPSALVSKSLGDSIKKAL  165



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+S+K  Y+ A+GNFG+PQYGG+M GTVVYPK N+K CK F+ 
Sbjct  18   SCVGRFVVEKNSLRVTSPESLKDVYECAIGNFGVPQYGGTMVGTVVYPKANQKACKSFED  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF SK G LPTF++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VEISFKSKPGGLPTFLLADRGDCFFTLKAWNAQNAGAAAILVADDKIEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSALI KSFG+ +K A+
Sbjct  138  AHADYLQNITIPSALISKSFGDSIKNAL  165



>emb|CDY60753.1| BnaA05g34780D [Brassica napus]
Length=620

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            E   G F+VEKNNLKV SPDSIKG Y+ A+GNFGIP+YGG++ GTVVYP  N KGCK F 
Sbjct  15   ELTFGTFLVEKNNLKVTSPDSIKGVYECAIGNFGIPKYGGTLVGTVVYPMSNHKGCKSFS  74

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FG+SF S  GSLPTF+++DRGDC FALKAWNAQ AGA+AILV+D+  E LITMD+PEED
Sbjct  75   EFGVSFKSSPGSLPTFLLIDRGDCYFALKAWNAQQAGAAAILVSDNKLEPLITMDTPEED  134

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             ++++Y+E I IPSALI KS G+ +K A+
Sbjct  135  TANADYLEKINIPSALISKSLGDSIKSAI  163



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP+ IKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CKGFD   +
Sbjct  21   GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDL  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF S+ G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
             Y++NITIPSALI KS G+ +KK++
Sbjct  141  EYLQNITIPSALISKSLGDSIKKSL  165



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   209 bits (533),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 94/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  29   SCMGRFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  88

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  89   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  148

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + + Y++NITIPSAL+ +S G  +K A+
Sbjct  149  ADAEYLQNITIPSALLSRSLGSAIKTAI  176



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG+M GTV+YPK N+K CK FD 
Sbjct  18   SCLGRFVVEKNSLKVTSPEDLKGVYECAIGNFGVPQYGGTMIGTVIYPKANQKACKDFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              +SF SK G LPTF++ DRGDC F LKAWNAQ AGA+AILV+DD  E LITMD+PEE+ 
Sbjct  78   VDLSFKSKPGGLPTFLLADRGDCFFTLKAWNAQKAGAAAILVSDDKVEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++YV+NI+IPSALI K+FG+++KK++
Sbjct  138  ARADYVQNISIPSALISKTFGDRIKKSL  165



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +S+ Y++NITIPSALI KS G+ LKKA+
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAI  165



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +S+ Y++NITIPSALI KS G+ LKKA+
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAI  165



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+A+LVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAVLVADNQDESLITMDTPEEKN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +S+ Y++NITIPSALI KS G+ LKKA+
Sbjct  138  ASAKYLQNITIPSALISKSLGDSLKKAI  165



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   209 bits (531),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKK  610
            + ++Y++NITIPSALI +S G+ +KK
Sbjct  138  AQADYLQNITIPSALISQSLGDSIKK  163



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   209 bits (531),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 95/146 (65%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP+SIK  Y+ A+GNFG+PQYGG++ G V YPK N+K CK F+ 
Sbjct  18   SCYGRFVVEKNSLRVTSPESIKDVYECAIGNFGVPQYGGTLVGNVAYPKANQKSCKSFES  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF SKAGS+P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   ADISFKSKAGSMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRSEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKK  610
            + ++Y++NITIPSALI +S G+ +KK
Sbjct  138  AQADYLQNITIPSALISQSLGDSIKK  163



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S+ GRFVVEKN+LKV SP+S+KG Y+ A+GNFG+PQYGG+M G VVYPK NRK C+ FD 
Sbjct  17   SSLGRFVVEKNSLKVTSPESLKGIYECAIGNFGVPQYGGTMVGIVVYPKANRKACQSFDD  76

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF  K G  PTF++VDRGDC F  KAW AQNAGA+AILVADD  E LITMD+P E+ 
Sbjct  77   FDISFKPKPGGFPTFLLVDRGDCFFTSKAWKAQNAGAAAILVADDKVEPLITMDTPGEES  136

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAVK  619
              ++Y++NITIPSALI KSFG+ LKKA++
Sbjct  137  GGADYLQNITIPSALISKSFGDNLKKALE  165



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  GRFVVE+N+LKV SP SIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+  CK FD 
Sbjct  18   NCLGRFVVEENSLKVTSPGSIKGVYECAIGNFGVPQYGGTLVGTVVYPKANQGACKIFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G LPTF++V+RGDC F LKAWNAQ AGA+AILVAD+ +E LITMD+PEE  
Sbjct  78   FDISFKSKPGGLPTFLLVNRGDCFFTLKAWNAQKAGAAAILVADNQDESLITMDTPEEKN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +S+ Y++NITIPSALI KS G+ LK A+
Sbjct  138  ASAEYLQNITIPSALISKSLGDSLKNAI  165



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   208 bits (529),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G VVYPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKDVYECAIGNFGVPQYGGTMVGIVVYPKANQKSCKDFAD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKK  610
            + ++Y++NITIPSALI +S G+ +KK
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKK  163



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
              G F+VEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD F
Sbjct  97   CHGGFLVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVTYPKANKKACKSFDDF  156

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             IS+  K GSLPTF++VDRGDC F  KAWNAQNAGA+AILVADD  E LITMD+PEE G 
Sbjct  157  DISYKPKPGSLPTFLLVDRGDCFFTKKAWNAQNAGAAAILVADDKTEPLITMDTPEESG-  215

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  216  NTDYLENITIPSALITKSFGDKLKKAI  242



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   207 bits (528),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKK  610
            + ++Y++NITIPSALI +S G+ +KK
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKK  163



>emb|CDY38157.1| BnaA07g02260D [Brassica napus]
Length=370

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  G FVVEKN+L+V SP+SI+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  45   SCMGMFVVEKNSLRVTSPESIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  104

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  105  FDISFISRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  164

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + + Y+ NITIPSAL+ +S G  +K A+
Sbjct  165  ADAEYLLNITIPSALLSRSLGSTIKTAI  192



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   207 bits (528),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPDSIKNVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKDFAD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF +KAG +P FV+VDRGDC F LKAWNAQ AGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   SDISFKTKAGGMPVFVLVDRGDCYFTLKAWNAQKAGAAAILVADDRNEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKK  610
            + ++Y++NITIPSALI +S G+ +KK
Sbjct  138  AKADYLQNITIPSALISQSLGDSIKK  163



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
              GRFVVEKN+LKV SP+S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F
Sbjct  19   CVGRFVVEKNSLKVTSPNSLKNVYECAIGNFGVPQYGGTLVGTVFYPKANQKACKGFEDF  78

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DISFKSKPGGLPTFLLADRGDCYFTLKAWNAQNGGAAAILVADDRTEPLITMDTPEEENA  138

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++ I IPSALI KS G+ +KKA+
Sbjct  139  DADYLQKIAIPSALISKSLGDSIKKAL  165



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            +  G FVVEKN+L+V +P  +KGTY+ A+GNFG+PQYGG+M G V YPK N+K CK FD 
Sbjct  51   ACRGGFVVEKNSLRVTAPSDLKGTYECAIGNFGVPQYGGTMVGVVAYPKANKKACKSFDD  110

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F IS+  K GSLPTF++VDRGDC F  KAWNAQ+AGA+AILVADD  E LITMD+PEE G
Sbjct  111  FDISYKPKPGSLPTFLLVDRGDCFFTKKAWNAQSAGAAAILVADDKTEPLITMDTPEESG  170

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
             +++Y+ENITIPSALI KSFG+KLKKA+
Sbjct  171  -NTDYLENITIPSALITKSFGDKLKKAI  197



>ref|XP_010039169.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
Length=195

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            ES +GRF V KN+L+V SP+S+KG YDS++G+FG+P+ GG+M GT+VYPK NRK CK F 
Sbjct  17   ESCSGRFTVAKNSLEVTSPESMKGFYDSSIGSFGVPKRGGTMAGTIVYPKSNRKACKSFG  76

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FG+SF+S +G LPTF++ DRGDC F+LKAWNAQNAGA+AIL+ADD  E L  M+SPEE 
Sbjct  77   DFGLSFNSNSGGLPTFLLADRGDCFFSLKAWNAQNAGAAAILIADDRCEPLFNMESPEEY  136

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
               S YV+ I IPSA I+K+ G+ +KKA+
Sbjct  137  NPVSEYVQEIVIPSAFIKKALGDDMKKAL  165



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   206 bits (525),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 95/146 (65%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKNNL+V SP++I+G Y+ ALGNFG+PQYGGSM G VVYPK N+K CK F+ F I
Sbjct  24   GRFVVEKNNLRVTSPEAIRGVYECALGNFGVPQYGGSMAGAVVYPKANQKACKNFNDFDI  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS-  538
            SF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ S+ 
Sbjct  84   SFRSRLAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDETSTD  143

Query  539  SNYVENITIPSALIEKSFGEKLKKAV  616
            + Y++NITIPSALI +S G  +K A+
Sbjct  144  AEYLQNITIPSALISRSLGSAIKTAI  169



>ref|XP_004983263.1| PREDICTED: vacuolar-sorting receptor 3-like [Setaria italica]
Length=631

 Score =   206 bits (524),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 98/146 (67%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G  DSA+GNFGIPQYGGSM G VVYPKDN   C  FDG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRRDSAIGNFGIPQYGGSMAGAVVYPKDNSNACDDFDG-KH  85

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G++PTF++VDRGDC FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  86   PFRAKPGAMPTFLLVDRGDCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  145

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI+K FGE+LKKAVK
Sbjct  146  KYIQNITIPSALIDKKFGEQLKKAVK  171



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S +GRFVVEKN+LK+ SPDS+K  Y+ A+GNFG+PQYGG+M GTVVYPK ++K CK FD 
Sbjct  22   SCSGRFVVEKNSLKITSPDSLKRVYECAIGNFGVPQYGGTMIGTVVYPKADQKACKSFDD  81

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              ISF SK G  PTF++ DRGDC F LKAWNAQ AGA+AILVADD +E LITMD+PEE+ 
Sbjct  82   VDISFKSKPGGRPTFLLADRGDCYFTLKAWNAQKAGAAAILVADDRDEPLITMDNPEEED  141

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y+++ITIPSALI KS G+K+K  +
Sbjct  142  AQADYLQSITIPSALISKSLGDKIKNEL  169



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGFD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKGFDDF  78

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             +SF SK G LPTF++VDRGDC F LKAWNAQ  GA+AILVAD+  E LITMD+PEE+ +
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKGGAAAILVADNRNEPLITMDTPEEENA  138

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++ ITIPSALI KS G+ +KK++
Sbjct  139  DADYLQKITIPSALISKSLGDSIKKSL  165



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   205 bits (522),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 93/145 (64%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F  
Sbjct  21   GRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDFDE  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF  K G LPTF++VDRGDC F LKAWNAQ  G +AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKPKPGGLPTFLLVDRGDCYFTLKAWNAQKGGXAAILVADDRNEPLITMDNPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++ ITIPSALI K  GE +KK++
Sbjct  141  DYLQKITIPSALISKELGESIKKSL  165



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+LKV SP+ +KG Y+ A+GNFG+PQYGG++ GTVVYP+ N+K CK F+ 
Sbjct  20   CVVGRFVVEKNSLKVTSPNPLKGVYECAIGNFGVPQYGGTLVGTVVYPQANQKACKNFED  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F +SF SK G LPTF++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  80   FSVSFKSKPGGLPTFLLADRGDCFFTLKAWNAQNGGAAAILVADDKFEPLITMDNPEEEN  139

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++ ITIPSALI KS G+ ++KA+
Sbjct  140  ADADYLQKITIPSALISKSLGDSIRKAL  167



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   205 bits (522),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 93/145 (64%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+K CKGF+ F  
Sbjct  21   GRFVVEKNSLKVTSPSSMKGLYECAIGNFGVPQYGGTLVGTVYYPKTNQKACKGFEDFDE  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF  K G LPTF++VDRGDC F LKAWNAQ  G +AILVADD  E LITMD+PEE+ + +
Sbjct  81   SFKPKPGGLPTFLLVDRGDCYFTLKAWNAQKGGXAAILVADDRNEPLITMDNPEEENADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++ ITIPSALI K  GE +KK++
Sbjct  141  DYLQKITIPSALISKELGESIKKSL  165



>gb|ACN30885.1| unknown [Zea mays]
Length=625

 Score =   205 bits (521),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  79

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  139

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI++ FG++LKKAVK
Sbjct  140  KYIQNITIPSALIDEKFGDQLKKAVK  165



>ref|NP_001130741.1| uncharacterized protein LOC100191845 precursor [Zea mays]
 gb|ACF79081.1| unknown [Zea mays]
Length=632

 Score =   205 bits (521),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  28   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  86

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  87   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  146

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI++ FG++LKKAVK
Sbjct  147  KYIQNITIPSALIDEKFGDQLKKAVK  172



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFVVEKN+L V SP  +KG +DSA+GNFGIPQYGGSM G VVYPK+N + C  F   
Sbjct  27   AAGRFVVEKNSLMVISPSELKGKHDSAIGNFGIPQYGGSMAGAVVYPKENARACDQFSRS  86

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             + F  KAG+LP FV++DRGDC FA K WNAQNAGASA+LV DD  E LITMD P ED  
Sbjct  87   DL-FKPKAGALPNFVLIDRGDCLFAKKVWNAQNAGASAVLVVDDKNEPLITMDLPREDDE  145

Query  536  SSNYVENITIPSALIEKSFGEKLKKAVK  619
            ++ Y+ENITIPSALI+K FGE+LKKAV+
Sbjct  146  AAKYIENITIPSALIDKKFGEQLKKAVR  173



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score =   205 bits (521),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN   C+ +DG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDNADACEAYDG-DR  85

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  86   HFRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  145

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI+K FGE+LKKA+K
Sbjct  146  KYIQNITIPSALIDKKFGEQLKKAIK  171



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   204 bits (520),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPKDN   C+ +DG   
Sbjct  27   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKDNADACEAYDG-DR  85

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  86   HFRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  145

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI+K FGE+LKKA+K
Sbjct  146  KYIQNITIPSALIDKKFGEQLKKAIK  171



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
              GRFVVEKN+LKV SP S+K  Y+ A+GNFG+PQYGG++ GTV YPK N+K CK FD F
Sbjct  19   CVGRFVVEKNSLKVTSPSSLKSVYECAIGNFGVPQYGGTLVGTVYYPKANQKACKSFDDF  78

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             +SF SK G LPTF++VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE+ +
Sbjct  79   DVSFKSKPGGLPTFLLVDRGDCFFTLKAWNAQKGGAAAILVADDRNEPLITMDTPEEENA  138

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++ ITIPSALI KS G+ +KK++
Sbjct  139  DADYLQKITIPSALISKSLGDSIKKSL  165



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFTD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G++P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNAQRAGAGAILVADDRVEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSALI KS G+ +KK +
Sbjct  138  AQADYLQNITIPSALISKSLGDSIKKEL  165



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V SP SIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  18   SCLGRFVVEKNSLRVTSPSSIKDVYECAIGNFGVPQYGGTMVGIVMYPKANQKSCKNFAD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF SK G++P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  78   FDISFKSKPGAMPVFLLVDRGDCYFTLKAWNAQRAGAGAILVADDRVEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSALI KS G+ +KK +
Sbjct  138  AQADYLQNITIPSALISKSLGDSIKKEL  165



>gb|ACG44286.1| vacuolar sorting receptor 3 precursor [Zea mays]
Length=575

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG   
Sbjct  21   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-  79

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S
Sbjct  80   PFRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAS  139

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI++ FG++LKKAVK
Sbjct  140  KYIQNITIPSALIDEKFGDQLKKAVK  165



>ref|XP_008787225.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=568

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFVVEKN+L V SP  I+G +DSA+GNFGIPQYGGSM GTVVYPK N   CK F   
Sbjct  27   AAGRFVVEKNSLMVTSPSEIRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNNYACKEFSAS  86

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             + F  K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  87   DL-FKPKPGALPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  145

Query  536  SSNYVENITIPSALIEKSFGEKLKKAVK  619
            ++ Y++NITIPSALI+K+FGEKLKKAV+
Sbjct  146  AAKYIQNITIPSALIDKNFGEKLKKAVR  173



>ref|XP_009125765.1| PREDICTED: LOW QUALITY PROTEIN: vacuolar-sorting receptor 2 [Brassica 
rapa]
Length=643

 Score =   204 bits (518),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 92/148 (62%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+L+V S + I+G Y+ ALGNFG+PQYGGSM+G+VVYPK N+K CK F+ 
Sbjct  30   SCMGRFVVEKNSLRVTSAEFIRGIYECALGNFGVPQYGGSMSGSVVYPKANQKACKNFED  89

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F ISF S+   LPTFV+VDRGDC F LKAWNAQ AGA+ ILVAD+  E LITMD+PE++ 
Sbjct  90   FDISFRSRVSGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEPLITMDAPEDET  149

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + + Y++NITIPSAL+ +S G  +K A+
Sbjct  150  ADAEYLQNITIPSALLSRSLGSAIKTAI  177



>gb|AFW68896.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=548

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG    
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-P  87

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  545  YVENITIPSALIEKSFGEKLKKAVK  619
            Y++NITIPSALI++ FG++LKKAVK
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVK  172



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +2

Query  194  VEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGISFSS  373
            +EKN+L+V +P+++KG Y+ A+GNFG+PQYGG+M G V YPK NRK CKGFD F +SF +
Sbjct  330  LEKNSLRVTAPEALKGAYECAIGNFGVPQYGGTMVGVVAYPKANRKACKGFDEFDVSFKA  389

Query  374  KAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSNYVE  553
            + G+LPTF++VDRGDC FA KAWN QNAGA+AILVADD +E LITMD+PEE G    Y+E
Sbjct  390  RPGALPTFLLVDRGDCYFAKKAWNVQNAGAAAILVADDRDEPLITMDTPEESGRVE-YLE  448

Query  554  NITIPSALIEKSFGEKLKKAV  616
            NITIPSALI KSFG++LKKA+
Sbjct  449  NITIPSALISKSFGDRLKKAI  469



>ref|XP_004510100.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=629

 Score =   202 bits (515),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK NR GC  F+ 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKFNRNGCNKFND  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
               S +SK GS PTFV+VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  
Sbjct  80   GDTSLTSKPGSFPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDRIEPLITMDTPEEGN  139

Query  533  SSS--NYVENITIPSALIEKSFGEKLKKAV  616
             ++  +Y+E ITIPSALI KS G+ +K A+
Sbjct  140  GANDDDYIEKITIPSALISKSLGDNIKMAL  169



>ref|XP_006661708.1| PREDICTED: vacuolar-sorting receptor 3-like [Oryza brachyantha]
Length=627

 Score =   202 bits (515),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 93/146 (64%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEKN+L V SP S++G +DSA+GNFG+PQYGGSM GTVVYPK+N   C  FDG   
Sbjct  23   ARFVVEKNSLMVTSPTSLRGRHDSAIGNFGVPQYGGSMAGTVVYPKENADACDAFDG-DR  81

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
             F +K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  ++
Sbjct  82   HFRAKPGALPNFLLIDRGNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEAA  141

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             Y++NITIPSALI+K FGE+LKK++K
Sbjct  142  KYIQNITIPSALIDKKFGEQLKKSIK  167



>gb|AFW68895.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=601

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG    
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-P  87

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  545  YVENITIPSALIEKSFGEKLKKAVK  619
            Y++NITIPSALI++ FG++LKKAVK
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVK  172



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   202 bits (515),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVV+KN+LKV SP+S+KG ++ A+GNFG+PQYGG++ GTVVYP  N+  CK F  F +
Sbjct  27   GRFVVQKNSLKVTSPNSMKGAHECAIGNFGVPQYGGTLVGTVVYPSANQHACKEFREFDL  86

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF +K G LP FV+ DRGDC F LKAWNAQN GA+AILVADD EE LITMD PEE  + +
Sbjct  87   SFKTKPGGLPVFVLADRGDCYFTLKAWNAQNGGAAAILVADDREEPLITMDVPEEQKADA  146

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y+E ITIPSALI K+ G+ +KKA+
Sbjct  147  DYLEKITIPSALIRKNLGDSIKKAL  171



>gb|AAN60346.1| unknown [Arabidopsis thaliana]
Length=216

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKS  136

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI K+ G+ +K A+
Sbjct  137  DADYLQNITIPSALITKTLGDSIKSAL  163



>gb|AFW68894.1| hypothetical protein ZEAMMB73_054159 [Zea mays]
Length=618

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 117/145 (81%), Gaps = 1/145 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP S++G +DSA+GNFGIPQYGGSM G VVYPKDN K C  FDG    
Sbjct  29   RFVVEKNSLMVTSPTSLRGRHDSAIGNFGIPQYGGSMAGAVVYPKDNAKACDDFDGRH-P  87

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F +K G++PTF+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +S 
Sbjct  88   FRAKPGAMPTFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEASK  147

Query  545  YVENITIPSALIEKSFGEKLKKAVK  619
            Y++NITIPSALI++ FG++LKKAVK
Sbjct  148  YIQNITIPSALIDEKFGDQLKKAVK  172



>ref|XP_003623631.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AES79849.1| vacuolar sorting receptor [Medicago truncatula]
Length=625

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            E   GRF+VEKN+L++ SP S+KG+Y+ A+GNFG+PQYGG++ G+VVYP  N+KGCK F 
Sbjct  18   ECCFGRFLVEKNSLRITSPKSLKGSYECAIGNFGVPQYGGTLVGSVVYPNVNQKGCKNFT  77

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-  526
             F  SF S  G+ PTFV+VDRGDC F LKAWNAQN GA+AILVADD EE LITMD+PEE 
Sbjct  78   DFSASFHSMPGNFPTFVLVDRGDCYFTLKAWNAQNGGAAAILVADDREETLITMDTPEEG  137

Query  527  DGSSSNYVENITIPSALIEKSFGEKLKKAV  616
            +  + +Y+E I IPSALI KS G+++KKA+
Sbjct  138  NVVNDDYIEKINIPSALISKSLGDRIKKAL  167



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            + A G+F+VEKNNLKV SP++IKG Y+ A+GNFGIP+YGG++ G VV+P  N K CK F 
Sbjct  17   QLALGKFLVEKNNLKVTSPETIKGVYECAIGNFGIPKYGGTLVGAVVHPVSNHKACKSFS  76

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
             FG+SF S  G LPTF+++DRGDC F LKAWNAQ AGA+AILVAD+  E LITMD+PEED
Sbjct  77   EFGVSFKSTPGRLPTFLLIDRGDCYFTLKAWNAQQAGAAAILVADNKLEPLITMDTPEED  136

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAV  616
             + ++Y++ ITIPSALI KS G+ +K A+
Sbjct  137  NADADYLDKITIPSALISKSLGDSIKSAL  165



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   201 bits (512),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 90/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SPDS+KG ++ A+GNFG+PQYGG++ G+V YPK N+K C  F  
Sbjct  18   SCFGRFVVEKNSLKVASPDSLKGLHECAIGNFGVPQYGGTLVGSVFYPKSNQKACTNFQD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              +SF +K G +P F++ DRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE+ 
Sbjct  78   VDLSFQTKPGGIPIFLLADRGDCYFTLKAWNAQNGGAAAILVADDRVEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKK  610
            + ++Y++NITIPSALI K  G+K+KK
Sbjct  138  ARADYLQNITIPSALISKDLGDKIKK  163



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SPDS+K  Y+ A+GNFG+P YGGSM G+V YPK N K CK F  
Sbjct  18   SCLGRFVVEKNSLKVTSPDSLKDVYECAIGNFGVPDYGGSMAGSVFYPKSNEKACKNFQD  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F I+  +K G LP F++ DRG+C F LKAWNAQNAGA+AILVADD  E LITMD+PEE+ 
Sbjct  78   FDIALKTKPGGLPIFLLADRGECFFTLKAWNAQNAGAAAILVADDRVEPLITMDTPEEED  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y++NITIPSALI K  G+K+KK +
Sbjct  138  ARADYLQNITIPSALISKDLGDKIKKEL  165



>pdb|4TJV|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vacuolar Sorting Receptor 1
 pdb|4TJX|A Chain A, Crystal Structure Of Protease-associated Domain Of Arabidopsis 
Vsr1 In Complex With Aleurain Peptide
Length=165

 Score =   189 bits (479),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F IS
Sbjct  3    RFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDIS  62

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S ++
Sbjct  63   FKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDAD  122

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            Y++NITIPSALI K+ G+ +K A+
Sbjct  123  YLQNITIPSALITKTLGDSIKSAL  146



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+LKV SP S++G Y+ A+GNFG+PQYGG+M G V +PK N+KGCK F    I
Sbjct  25   GRFVVEKNSLKVTSPSSLRGVYECAIGNFGVPQYGGAMGGIVAFPKSNQKGCKPFSDDDI  84

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF  K G LP F++V+RG+C F LKAW+AQNAGA+A+LV DD  E LITMD+PEE G+  
Sbjct  85   SFKPKPGGLPVFLLVERGECFFTLKAWHAQNAGAAAVLVGDDRMEPLITMDTPEEGGAED  144

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +YV NITIPSAL+ KSFG+KLKK+V
Sbjct  145  DYVRNITIPSALVSKSFGDKLKKSV  169



>gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKN+LKV SPDS++G Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK FD 
Sbjct  18   SCFGRFVVEKNSLKVTSPDSVRGIYECAIGNFGVPQYGGTLVGTVVYPKANQKACKEFDE  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
               SF SK G LPTFV+VDRGDC F  KAWNAQ  GA+AILV+DD  E LITMD+PEE+ 
Sbjct  78   ADGSFKSKPGGLPTFVLVDRGDCYFTSKAWNAQRGGAAAILVSDDKIEPLITMDTPEEEN  137

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + + Y++ I IPSALI KS G+ +KKA+
Sbjct  138  ADAEYLQKINIPSALISKSLGDSIKKAL  165



>ref|XP_006341299.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Solanum tuberosum]
Length=578

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSD  75

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F I + SK G +P F++VDRGDC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGMPVFLLVDRGDCFFTLKAWNAQQAGAGAILVADDRVEPLITMDTPEEED  135

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y+++ITIPSALI KS G+ +KK +
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKKEL  163



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   199 bits (506),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKNNLKV SP+S++G Y+ A+GNFG+PQYGG M G+V YPK N+KGC  F    +
Sbjct  24   GRFVVEKNNLKVTSPESVRGVYECAIGNFGVPQYGGVMVGSVFYPKTNQKGCNTFQDSDL  83

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-DGSS  538
            S  +K G +P FV+ DRG+C F LKAWNAQN GA+AILVADD  E LITMD+PEE D + 
Sbjct  84   SSKTKPGGIPLFVLADRGECYFTLKAWNAQNGGAAAILVADDRVEPLITMDTPEEADAAQ  143

Query  539  SNYVENITIPSALIEKSFGEKLKKAV  616
            +NY++NITIPSALI    G+++KK +
Sbjct  144  ANYLQNITIPSALISNQLGDRIKKVL  169



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            E   GRFVVEKN+L+V +P S+KGTY+ A+GNFG+P+YGG++ G+VVYPK N+KGC  F 
Sbjct  17   ECTVGRFVVEKNSLRVTAPTSLKGTYECAIGNFGVPKYGGTLVGSVVYPKVNQKGCLNFT  76

Query  350  GFGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE-  526
               ++F SK G  PTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE 
Sbjct  77   --DVNFQSKPGVFPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEG  134

Query  527  DGSSSNYVENITIPSALIEKSFGEKLKKAV  616
             G++ +YV+NI+IPSALI KSFG+ +KKA+
Sbjct  135  KGTNDDYVDNISIPSALISKSFGDSIKKAL  164



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   199 bits (506),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 88/143 (62%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKNNL+V SP S++G Y+ A+GNFG+PQYGG+M G+V YPK N+K C  F    I
Sbjct  28   GRFVVEKNNLRVTSPGSVRGIYECAIGNFGVPQYGGTMLGSVFYPKANQKACNTFQDSDI  87

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            ++ +K G +P F++ DRGDC F LKAWNAQNAGA+AILVADD  E LITMD+PEE  + +
Sbjct  88   TWKNKPGGIPIFLLADRGDCYFTLKAWNAQNAGAAAILVADDRIEPLITMDTPEETDAQA  147

Query  542  NYVENITIPSALIEKSFGEKLKK  610
            +Y++NI+IPSALI K  GE++KK
Sbjct  148  DYLQNISIPSALISKELGERMKK  170



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFVVEKN+L V SP  I+G +DSA+GNFGIPQYGGSM GTVVYPK N   C+ F   
Sbjct  25   AAGRFVVEKNSLMVTSPSDIRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNNYACEKFSAS  84

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             + F  K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  85   DL-FKPKPGALPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  143

Query  536  SSNYVENITIPSALIEKSFGEKLKKA  613
            ++ Y++NITIPSALI+K+FGEKLKKA
Sbjct  144  AAKYIQNITIPSALIDKNFGEKLKKA  169



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 116/150 (77%), Gaps = 2/150 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M GTVVYPK N+ GC  F+ 
Sbjct  18   SCMGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGTVVYPKLNKNGCTKFND  77

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
               S +SK GS PTFV+VDRGDC F LKAWNAQ  GA+AILVADD  E LITMD+PEE  
Sbjct  78   ADTSLNSKPGSFPTFVLVDRGDCYFTLKAWNAQIGGAAAILVADDRVEPLITMDTPEEGN  137

Query  533  SSSN--YVENITIPSALIEKSFGEKLKKAV  616
             ++N  YVE ITIPSALI KS G+ +KKA+
Sbjct  138  GATNDDYVEKITIPSALISKSVGDSIKKAL  167



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 118/150 (79%), Gaps = 5/150 (3%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  GRFVVEKNNLK+ SP S++G Y+ A+GNFG+P+YGG+M G+VVYPK N+ GC+ FD 
Sbjct  20   SCVGRFVVEKNNLKITSPKSLRGIYECAIGNFGVPKYGGTMIGSVVYPKSNQNGCRNFDA  79

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
               S SSK G+ PTFV+VDRGDC F LKAWNAQ  GA+AILVAD+ EE LITMD+PEE  
Sbjct  80   ---SLSSKPGTFPTFVLVDRGDCYFTLKAWNAQKGGAAAILVADNREEPLITMDTPEEGN  136

Query  533  SS--SNYVENITIPSALIEKSFGEKLKKAV  616
             +   +Y+E I+IPSALI KS G+K+K+A+
Sbjct  137  GAKDDDYIEKISIPSALISKSLGDKIKQAL  166



>ref|XP_003573873.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=629

 Score =   197 bits (502),  Expect = 9e-56, Method: Composition-based stats.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 2/147 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+L V SP +++G +DSA+GNFGIPQYGGSM G VVYPK N   C  FDG G  
Sbjct  24   RFVVEKNSLMVTSPTTLRGRHDSAIGNFGIPQYGGSMAGAVVYPKANTDACDSFDGGGKE  83

Query  365  --FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  538
              F +  G+LP+F+++DR +C FA K WNAQNAGASA+LV DD +E LITMD P ED  +
Sbjct  84   HIFRNNPGALPSFLLIDRRNCLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDEA  143

Query  539  SNYVENITIPSALIEKSFGEKLKKAVK  619
            + Y++NITIPSALI+K FGE+LKKAVK
Sbjct  144  AKYIQNITIPSALIDKKFGEQLKKAVK  170



>ref|XP_009421105.1| PREDICTED: vacuolar-sorting receptor 3-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = +2

Query  179  AGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFG  358
            AGRFVVEKN+L V SP  IKG +DSA+GNFGIPQYGGSM G VVYPK+N   C  F    
Sbjct  28   AGRFVVEKNSLMVISPSEIKGKHDSAIGNFGIPQYGGSMAGAVVYPKENAAACDEFSRPD  87

Query  359  ISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  538
            + F SK G+LP F+++DRGDC F  K WNAQNAGASA+LV DD +E LITMD P ED  S
Sbjct  88   L-FRSKVGALPNFLLIDRGDCLFTKKVWNAQNAGASAVLVVDDKDEPLITMDLPLEDDES  146

Query  539  SNYVENITIPSALIEKSFGEKLKKAVK  619
            + Y++NITIPSALI+K FGE+LK AV+
Sbjct  147  AKYIQNITIPSALIDKRFGEQLKTAVR  173



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD F
Sbjct  20   AAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             +SF  K G LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMDSPE  G 
Sbjct  80   DLSFKPKPGGLPVFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSG-  138

Query  536  SSNYVENITIPSALIEKSFGEKLKKAVK  619
             ++Y+E IT+PSAL+ K FG+ LKKA++
Sbjct  139  -TDYIEKITVPSALVTKKFGDDLKKALE  165



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFVVEKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK N+K C+ FD F
Sbjct  20   AAGRFVVEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANKKACRSFDDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             +SF  K G LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMDSPE  G 
Sbjct  80   DLSFKPKPGGLPIFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRLEPLITMDSPESSG-  138

Query  536  SSNYVENITIPSALIEKSFGEKLKKAVK  619
             ++Y+E IT+PSAL+ K FG+ LKKA++
Sbjct  139  -TDYIEKITVPSALVTKKFGDDLKKALE  165



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  179  AGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFG  358
            AGRFVVEKN+L V SP  ++G +DSA+GNFGIPQYGGSM GTVVYPK N+  C+ F    
Sbjct  28   AGRFVVEKNSLMVTSPSELRGKHDSAIGNFGIPQYGGSMAGTVVYPKTNKYVCEEFSDSD  87

Query  359  ISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  538
            + F  K G+LP F++VDRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  +
Sbjct  88   L-FKPKPGALPNFLLVDRGECLFAKKVWNAQNAGASAVLVIDDKDEPLITMDLPREDDKA  146

Query  539  SNYVENITIPSALIEKSFGEKLKKAV  616
            + Y++NITIPSALI+K FGEKLKKAV
Sbjct  147  AKYIQNITIPSALIDKKFGEKLKKAV  172



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
               GRFVVEKN+L+V SPDSIK  Y+ A+GNFG+PQYGG+M G V+YPK N+K CK F  
Sbjct  16   CCMGRFVVEKNSLRVTSPDSIKEVYECAIGNFGVPQYGGTMVGNVMYPKTNQKSCKNFSD  75

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
            F I + SK G +P F++VDR DC F LKAWNAQ AGA AILVADD  E LITMD+PEE+ 
Sbjct  76   FDIFYKSKPGGMPVFLLVDRRDCFFTLKAWNAQQAGAGAILVADDRVEPLITMDTPEEED  135

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            + ++Y+++ITIPSALI KS G+ +KK +
Sbjct  136  AKADYLQDITIPSALISKSLGDSIKKEL  163



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score =   196 bits (499),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 98/150 (65%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  G+F+VEKN++ + +PDSIKGTYDSA+GNFG+PQYGGSM G VVYP+     C+ F  
Sbjct  22   SCWGKFLVEKNSISITTPDSIKGTYDSAIGNFGVPQYGGSMVGNVVYPEKGATACRNFSE  81

Query  353  FGISFSS-KAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
            FGI+F   K+G LPT ++VDRGDC FALK W+AQ AGA+A+LVADD  E LITMDSPEED
Sbjct  82   FGITFKGLKSGGLPTVLLVDRGDCYFALKVWHAQLAGAAAVLVADDKTEPLITMDSPEED  141

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAVK  619
              S+ YV+NITIPSAL+EKSFG+KLK A++
Sbjct  142  NVSAEYVQNITIPSALVEKSFGDKLKAALQ  171



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score =   196 bits (499),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 98/150 (65%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S  G+F+VEKN++ + +PDSIKGTYDSA+GNFG+PQYGGSM G VVYP+     C+ F  
Sbjct  22   SCWGKFLVEKNSISITTPDSIKGTYDSAIGNFGVPQYGGSMVGNVVYPEKGATACRNFSE  81

Query  353  FGISFSS-KAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
            FGI+F   K+G LPT ++VDRGDC FALK W+AQ AGA+A+LVADD  E LITMDSPEED
Sbjct  82   FGITFKGLKSGGLPTVLLVDRGDCYFALKVWHAQLAGAAAVLVADDKTEPLITMDSPEED  141

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAVK  619
              S+ YV+NITIPSAL+EKSFG+KLK A++
Sbjct  142  NVSAEYVQNITIPSALVEKSFGDKLKAALQ  171



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DISFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI KS G+ LK A+
Sbjct  140  DADYLQNITIPSALITKSLGDSLKSAL  166



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFV EKN+L+V SP  ++G Y+ A+GNFG+PQYGG+M G VVYPK NRK CK FD F
Sbjct  24   AAGRFVGEKNSLRVTSPAGLRGVYECAIGNFGMPQYGGTMHGVVVYPKANRKACKAFDEF  83

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             +SF  K+G LP F++VDRGDC F  K WNAQ+AGA+A+LVADD  E LITMDSPE  G 
Sbjct  84   DLSFKPKSGGLPVFLLVDRGDCYFTTKGWNAQSAGAAAVLVADDRVEPLITMDSPESSG-  142

Query  536  SSNYVENITIPSALIEKSFGEKLKKAVK  619
             ++Y+E IT+PSAL+ K FG+ LKK+++
Sbjct  143  -TDYIEKITVPSALVTKKFGDDLKKSLE  169



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   196 bits (499),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 90/146 (62%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  FG+
Sbjct  36   GRFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANTKACKPFADFGL  95

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF+ KAG LP F++VDRGDC F  K WNAQ AGA+A+LVADD  E LITMD+PE  G   
Sbjct  96   SFNPKAGGLPVFLLVDRGDCYFTTKGWNAQTAGAAAVLVADDRAEPLITMDTPESSGKE-  154

Query  542  NYVENITIPSALIEKSFGEKLKKAVK  619
             ++ENIT+PSAL+ K FG+ LK A++
Sbjct  155  -HLENITVPSALVSKRFGDDLKGALE  179



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   196 bits (498),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 88/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+    
Sbjct  21   ARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDTDE  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF  K G LPTFV+VDRGDC F LKAWNAQ  GA+AILV D+  E+LITMD+PE++ + +
Sbjct  81   SFKPKPGGLPTFVLVDRGDCYFTLKAWNAQKGGAAAILVVDNKNEQLITMDTPEQEDADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++NITIPSALI K  G+ +KK++
Sbjct  141  DYLQNITIPSALISKELGDSIKKSL  165



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   196 bits (498),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 88/145 (61%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
             RFVVEK++LKV SP S+KG Y+ A+GNFG+PQYGG++ GTV YPK N+  CKGF+    
Sbjct  21   ARFVVEKSSLKVTSPSSMKGEYECAIGNFGVPQYGGTLVGTVYYPKTNQMACKGFEDTDE  80

Query  362  SFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSS  541
            SF  K G LPTFV+VDRGDC F LKAWNAQ  GA+AILV D+  E+LITMD+PE++ + +
Sbjct  81   SFKPKPGGLPTFVLVDRGDCYFTLKAWNAQKGGAAAILVVDNKNEQLITMDTPEQEDADA  140

Query  542  NYVENITIPSALIEKSFGEKLKKAV  616
            +Y++NITIPSALI K  G+ +KK++
Sbjct  141  DYLQNITIPSALISKELGDSIKKSL  165



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AVGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             I+F SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI KS G+ LK A+
Sbjct  140  DADYLQNITIPSALIAKSLGDSLKSAL  166



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   195 bits (495),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  20   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             I+F SKAG LPTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DITFKSKAGRLPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI KS G+ LK A+
Sbjct  140  DADYLQNITIPSALITKSLGDSLKSAL  166



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AAGRFVVEKN+L V SP  ++G +DSA+GNFGIPQYGGSM G VVYPK NR  C+ F   
Sbjct  27   AAGRFVVEKNSLMVTSPSELRGKHDSAIGNFGIPQYGGSMAGMVVYPKTNRYACEKFSAS  86

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             + F  K G+LP F+++DRG+C FA K WNAQNAGASA+LV DD +E LITMD P ED  
Sbjct  87   DL-FRPKPGALPNFLLIDRGECLFAKKVWNAQNAGASAVLVVDDKDEPLITMDLPREDDE  145

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
            ++ Y++NI IPSALI+K+FG+KLKK V
Sbjct  146  AAKYIQNIMIPSALIDKNFGKKLKKVV  172



>ref|XP_004959891.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=636

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            AA RFVVEKN+L+V SP +++G Y+ A+GNFG+PQYGG+M G VVYPK N K CK F  F
Sbjct  30   AAARFVVEKNSLRVTSPAALRGVYECAIGNFGMPQYGGTMHGVVVYPKANGKACKPFADF  89

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
            G+SF  K G LP F++VDRGDC F  K WNAQN+GA+A+LVADD  E LITMDSPE  G+
Sbjct  90   GLSFKPKPGGLPVFLLVDRGDCYFTTKGWNAQNSGAAAVLVADDKVEPLITMDSPESSGT  149

Query  536  SSNYVENITIPSALIEKSFGEKLKKAVK  619
               ++ENITIPSAL+ K FG+ L+KA++
Sbjct  150  E--HMENITIPSALVTKRFGDDLRKALQ  175



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   194 bits (494),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK +  F
Sbjct  17   AMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDF  76

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G LPTFV++DRGDC F LKAW AQ AGA+AILVAD   E LITMD+PEED S
Sbjct  77   DISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKS  136

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI K+ G+ +K A+
Sbjct  137  DADYLQNITIPSALITKTLGDSIKSAL  163



>gb|KHN40635.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=618

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    ++
Sbjct  22   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSD--VN  79

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G LPTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  80   FQSKPGGLPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  139

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            YV+ I+IPSALI KS G+ +K+A+
Sbjct  140  YVDKISIPSALISKSLGDSIKQAL  163



>ref|XP_003552313.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=619

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = +2

Query  185  RFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGIS  364
            RFVVEKN+LKV SP S+KGTY+ A+GNFG+P+YGG++ G+V+YPK N+KGC  F    ++
Sbjct  23   RFVVEKNSLKVTSPKSLKGTYECAIGNFGVPKYGGTLVGSVLYPKVNQKGCTNFSD--VN  80

Query  365  FSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSSSN  544
            F SK G LPTF++VDRGDC F LKAWNAQN GA+AILVADD  E LITMD+PEE  ++ +
Sbjct  81   FQSKPGGLPTFLLVDRGDCYFTLKAWNAQNGGAAAILVADDKAETLITMDTPEEGKANDD  140

Query  545  YVENITIPSALIEKSFGEKLKKAV  616
            YV+ I+IPSALI KS G+ +K+A+
Sbjct  141  YVDKISIPSALISKSLGDSIKQAL  164



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   194 bits (492),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  176  AAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGF  355
            A GRFVVEKNNLKV SPDSIKG Y+ A+GNFG+PQYGG++ GTVVYPK N+K CK ++ F
Sbjct  20   ALGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYNDF  79

Query  356  GISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGS  535
             ISF SK G  PTFV++DRGDC F LKAW AQ AGA+AILVAD+  E LITMD+PEED S
Sbjct  80   DISFKSKPGQKPTFVLIDRGDCFFTLKAWIAQQAGAAAILVADNKAEPLITMDTPEEDKS  139

Query  536  SSNYVENITIPSALIEKSFGEKLKKAV  616
             ++Y++NITIPSALI KS G+ +K A+
Sbjct  140  DADYLQNITIPSALITKSLGDSIKSAL  166



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   194 bits (493),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 93/147 (63%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +2

Query  182  GRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDGFGI  361
            GRFVVEKN+++V SPD +KG Y+ A+GNFG+PQYGG++ G V YPK NRK C+ FD F I
Sbjct  24   GRFVVEKNSIQVTSPDELKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACQSFDQFDI  83

Query  362  SFSSK-AGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDGSS  538
            SF  K AG  PTFV+VDRG+C F  KAWNAQNAGA+A+LV DD  E LITMD+PEE    
Sbjct  84   SFKPKQAGGRPTFVLVDRGECFFTTKAWNAQNAGAAAVLVVDDKSEPLITMDNPEE---G  140

Query  539  SNYVENITIPSALIEKSFGEKLKKAVK  619
              ++ENITIPS LI K  GE LKK+V+
Sbjct  141  KEHLENITIPSVLITKKLGESLKKSVE  167



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +2

Query  170  ESAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFD  349
            ++AAGRFVVEKN+L+V SPDSIKG Y+ A+GNFG+PQYGG++ G V YPK NRK CK F+
Sbjct  20   DTAAGRFVVEKNSLRVTSPDSIKGKYECAIGNFGVPQYGGTLHGWVEYPKSNRKACKSFE  79

Query  350  GFGISF-SSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEE  526
             F ISF S+++G  P FV++DRGDC F  KAWNAQNAGA+A+LVAD+  E LITMD+P++
Sbjct  80   DFDISFKSTRSGGRPKFVLIDRGDCYFTTKAWNAQNAGAAAVLVADNKLEPLITMDNPDD  139

Query  527  DGSSSNYVENITIPSALIEKSFGEKLKKAVK  619
             G+   ++ENITIPS LI K  G+ LKK+ +
Sbjct  140  AGTE--HLENITIPSVLITKELGDNLKKSAE  168



>gb|ABR17707.1| unknown [Picea sitchensis]
Length=628

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S +GRFVVEKN++ V +P S++G   SA+GNFG+P YGG+M G VVYP+  +  CK F+ 
Sbjct  24   SVSGRFVVEKNSITVIAPYSLRGKRQSAIGNFGVPDYGGTMIGKVVYPEKGKDACKSFEE  83

Query  353  FGISFS-SKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEED  529
            FG+SF+ S + S P FV++DRGDC FALK WNAQNAGA+A+LVADD +E LITMDSPEED
Sbjct  84   FGVSFNKSNSHSDPVFVLIDRGDCYFALKVWNAQNAGAAAVLVADDRDEPLITMDSPEED  143

Query  530  GSSSNYVENITIPSALIEKSFGEKLKKAVK  619
             +++ Y++ I+IPSALIEKSFG+ LKK ++
Sbjct  144  KAAARYLDKISIPSALIEKSFGDDLKKVLE  173



>gb|EPS72005.1| hypothetical protein M569_02753, partial [Genlisea aurea]
Length=557

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  173  SAAGRFVVEKNNLKVFSPDSIKGTYDSALGNFGIPQYGGSMTGTVVYPKDNRKGCKGFDG  352
            S   RFVVEKNNLKV SP+S+KG Y+ A+GNFG+PQYGG+M G+V YPK NR  C  F G
Sbjct  15   SCTARFVVEKNNLKVTSPESLKGLYECAIGNFGVPQYGGTMPGSVYYPKSNRHACSDFRG  74

Query  353  FGISFSSKAGSLPTFVIVDRGDCRFALKAWNAQNAGASAILVADDVEERLITMDSPEEDG  532
              I++ +K G +P F++VDRG+C F LKAWN+Q AG +A+LV+DD  E LITMDSPEE  
Sbjct  75   SDITWRNKPGGIPAFLLVDRGECYFTLKAWNSQKAGVAAVLVSDDRIEPLITMDSPEESD  134

Query  533  SSSNYVENITIPSALIEKSFGEKLKKAV  616
            +  NY++NITIPSALI K  G+++K  +
Sbjct  135  AQPNYLQNITIPSALITKQLGDRIKNEL  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520