BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF036C12

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783853.1|  PREDICTED: uncharacterized protein LOC104232...    199   1e-56   Nicotiana sylvestris
ref|XP_009615691.1|  PREDICTED: uncharacterized protein LOC104108...    196   1e-55   Nicotiana tomentosiformis
ref|XP_009758247.1|  PREDICTED: uncharacterized protein LOC104210...    193   2e-54   Nicotiana sylvestris
ref|XP_009783852.1|  PREDICTED: uncharacterized protein LOC104232...    190   3e-53   Nicotiana sylvestris
ref|XP_009758249.1|  PREDICTED: uncharacterized protein LOC104210...    189   9e-53   Nicotiana sylvestris
ref|XP_009615690.1|  PREDICTED: uncharacterized protein LOC104108...    187   4e-52   Nicotiana tomentosiformis
ref|XP_009604130.1|  PREDICTED: uncharacterized protein LOC104098...    179   3e-49   Nicotiana tomentosiformis
ref|XP_009604129.1|  PREDICTED: uncharacterized protein LOC104098...    176   4e-48   Nicotiana tomentosiformis
ref|XP_006341421.1|  PREDICTED: uncharacterized protein LOC102590599    169   2e-45   Solanum tuberosum [potatoes]
ref|XP_010318696.1|  PREDICTED: uncharacterized protein LOC101254...    167   9e-45   Solanum lycopersicum
ref|XP_004235885.1|  PREDICTED: uncharacterized protein LOC101254...    166   2e-44   Solanum lycopersicum
gb|KDP38724.1|  hypothetical protein JCGZ_04077                         165   5e-44   Jatropha curcas
ref|XP_006366261.1|  PREDICTED: uncharacterized protein LOC102579...    160   2e-42   Solanum tuberosum [potatoes]
ref|XP_002528397.1|  conserved hypothetical protein                     160   3e-42   Ricinus communis
ref|XP_006453554.1|  hypothetical protein CICLE_v10007906mg             158   4e-42   
ref|XP_006453555.1|  hypothetical protein CICLE_v10007906mg             158   2e-41   Citrus clementina [clementine]
gb|KDO62298.1|  hypothetical protein CISIN_1g008832mg                   156   3e-41   Citrus sinensis [apfelsine]
ref|XP_004241674.1|  PREDICTED: uncharacterized protein LOC101256...    157   4e-41   Solanum lycopersicum
ref|XP_006474053.1|  PREDICTED: uncharacterized protein LOC102622...    156   7e-41   Citrus sinensis [apfelsine]
ref|XP_006474052.1|  PREDICTED: uncharacterized protein LOC102622...    156   8e-41   Citrus sinensis [apfelsine]
ref|XP_006366262.1|  PREDICTED: uncharacterized protein LOC102579...    155   1e-40   Solanum tuberosum [potatoes]
ref|XP_008789898.1|  PREDICTED: uncharacterized protein LOC103707259    155   3e-40   Phoenix dactylifera
ref|XP_008791338.1|  PREDICTED: uncharacterized protein LOC103708...    154   3e-40   Phoenix dactylifera
ref|XP_010906671.1|  PREDICTED: uncharacterized protein LOC105033...    154   4e-40   Elaeis guineensis
ref|XP_010322653.1|  PREDICTED: uncharacterized protein LOC101256...    152   2e-39   Solanum lycopersicum
gb|EYU24571.1|  hypothetical protein MIMGU_mgv1a004911mg                152   3e-39   Erythranthe guttata [common monkey flower]
emb|CBI36579.3|  unnamed protein product                                150   4e-39   Vitis vinifera
ref|XP_002274694.1|  PREDICTED: uncharacterized protein LOC100251...    152   4e-39   Vitis vinifera
ref|XP_007223233.1|  hypothetical protein PRUPE_ppa003793mg             152   4e-39   Prunus persica
ref|XP_009360003.1|  PREDICTED: uncharacterized protein LOC103950506    151   4e-39   Pyrus x bretschneideri [bai li]
gb|EYU24572.1|  hypothetical protein MIMGU_mgv1a004911mg                151   5e-39   Erythranthe guttata [common monkey flower]
ref|XP_008223605.1|  PREDICTED: uncharacterized protein LOC103323...    151   6e-39   Prunus mume [ume]
ref|XP_008223604.1|  PREDICTED: uncharacterized protein LOC103323...    151   6e-39   Prunus mume [ume]
emb|CDO98250.1|  unnamed protein product                                150   6e-39   Coffea canephora [robusta coffee]
gb|KJB23595.1|  hypothetical protein B456_004G106800                    147   8e-39   Gossypium raimondii
ref|XP_008791339.1|  PREDICTED: uncharacterized protein LOC103708...    150   1e-38   Phoenix dactylifera
ref|XP_010265510.1|  PREDICTED: uncharacterized protein LOC104603232    150   1e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010906672.1|  PREDICTED: uncharacterized protein LOC105033...    149   2e-38   Elaeis guineensis
ref|XP_011082590.1|  PREDICTED: uncharacterized protein LOC105165312    149   2e-38   Sesamum indicum [beniseed]
gb|KJB23596.1|  hypothetical protein B456_004G106800                    148   3e-38   Gossypium raimondii
gb|KHG03368.1|  ATP-dependent DNA helicase pcrA                         148   5e-38   Gossypium arboreum [tree cotton]
gb|KJB23592.1|  hypothetical protein B456_004G106800                    148   5e-38   Gossypium raimondii
ref|XP_002309367.2|  hypothetical protein POPTR_0006s19420g             147   2e-37   
ref|XP_011012246.1|  PREDICTED: uncharacterized protein LOC105116539    146   3e-37   Populus euphratica
ref|XP_011033365.1|  PREDICTED: uncharacterized protein LOC105131880    146   3e-37   Populus euphratica
ref|XP_010927928.1|  PREDICTED: uncharacterized protein LOC105049...    145   1e-36   Elaeis guineensis
ref|XP_009396105.1|  PREDICTED: uncharacterized protein LOC103981...    144   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004144718.1|  PREDICTED: uncharacterized protein LOC101216574    144   2e-36   Cucumis sativus [cucumbers]
ref|XP_004166179.1|  PREDICTED: uncharacterized LOC101216574            144   2e-36   
ref|XP_004309859.1|  PREDICTED: uncharacterized protein LOC101299924    144   2e-36   Fragaria vesca subsp. vesca
ref|XP_008452508.1|  PREDICTED: uncharacterized protein LOC103493516    143   3e-36   Cucumis melo [Oriental melon]
ref|XP_009396106.1|  PREDICTED: uncharacterized protein LOC103981...    143   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010268524.1|  PREDICTED: uncharacterized protein LOC104605439    143   4e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009336662.1|  PREDICTED: uncharacterized protein LOC103929...    143   5e-36   
ref|XP_007013890.1|  Uncharacterized protein isoform 2                  142   8e-36   
ref|XP_007013889.1|  Uncharacterized protein isoform 1                  142   8e-36   
ref|XP_009336665.1|  PREDICTED: uncharacterized protein LOC103929...    142   9e-36   
ref|XP_011073225.1|  PREDICTED: uncharacterized protein LOC105158248    142   1e-35   Sesamum indicum [beniseed]
gb|KCW78806.1|  hypothetical protein EUGRSUZ_C00240                     141   1e-35   Eucalyptus grandis [rose gum]
ref|XP_010047053.1|  PREDICTED: uncharacterized protein LOC104436016    141   2e-35   Eucalyptus grandis [rose gum]
ref|XP_002324519.2|  hypothetical protein POPTR_0018s11180g             140   3e-35   
ref|XP_010111118.1|  hypothetical protein L484_008495                   140   4e-35   Morus notabilis
ref|XP_006845397.1|  hypothetical protein AMTR_s00019p00062450          140   6e-35   Amborella trichopoda
ref|XP_010094072.1|  hypothetical protein L484_018088                   138   2e-34   Morus notabilis
ref|XP_011018078.1|  PREDICTED: uncharacterized protein LOC105121219    138   2e-34   Populus euphratica
ref|XP_007023516.1|  Uncharacterized protein TCM_027550                 137   3e-34   
gb|KDP41944.1|  hypothetical protein JCGZ_26962                         136   1e-33   Jatropha curcas
ref|XP_006493461.1|  PREDICTED: uncharacterized protein LOC102624...    135   1e-33   Citrus sinensis [apfelsine]
ref|XP_006427676.1|  hypothetical protein CICLE_v10027000mg             134   3e-33   Citrus clementina [clementine]
emb|CDY23256.1|  BnaA08g12900D                                          135   3e-33   Brassica napus [oilseed rape]
ref|XP_009108969.1|  PREDICTED: uncharacterized protein LOC103834656    135   3e-33   Brassica rapa
ref|XP_010525794.1|  PREDICTED: uncharacterized protein LOC104803...    134   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_010525793.1|  PREDICTED: uncharacterized protein LOC104803...    134   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_009127531.1|  PREDICTED: uncharacterized protein LOC103852376    134   5e-33   Brassica rapa
ref|XP_010525791.1|  PREDICTED: uncharacterized protein LOC104803...    134   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_009623108.1|  PREDICTED: uncharacterized protein LOC104114385    134   6e-33   Nicotiana tomentosiformis
gb|KFK29655.1|  hypothetical protein AALP_AA7G161600                    134   6e-33   Arabis alpina [alpine rockcress]
ref|XP_009418538.1|  PREDICTED: uncharacterized protein LOC103998...    134   7e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW76588.1|  hypothetical protein ZEAMMB73_647105                    129   7e-33   
ref|XP_010927929.1|  PREDICTED: uncharacterized protein LOC105049...    134   8e-33   Elaeis guineensis
ref|XP_009800570.1|  PREDICTED: uncharacterized protein LOC104246459    133   1e-32   Nicotiana sylvestris
emb|CDX68693.1|  BnaC01g07600D                                          133   1e-32   
ref|XP_006404909.1|  hypothetical protein EUTSA_v10000158mg             132   1e-32   Eutrema salsugineum [saltwater cress]
gb|AFW76589.1|  hypothetical protein ZEAMMB73_647105                    129   1e-32   
ref|XP_010525792.1|  PREDICTED: uncharacterized protein LOC104803...    133   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_010526305.1|  PREDICTED: uncharacterized protein LOC104803910    132   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_007217228.1|  hypothetical protein PRUPE_ppa005301mg             132   2e-32   
ref|XP_010687648.1|  PREDICTED: uncharacterized protein LOC104901744    132   3e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR16502.1|  unknown                                                 132   4e-32   Picea sitchensis
gb|EPS63967.1|  hypothetical protein M569_10814                         127   5e-32   Genlisea aurea
dbj|BAJ98844.1|  predicted protein                                      131   5e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009336666.1|  PREDICTED: uncharacterized protein LOC103929...    131   6e-32   
ref|XP_002512753.1|  conserved hypothetical protein                     131   6e-32   Ricinus communis
ref|XP_008228846.1|  PREDICTED: uncharacterized protein LOC103328229    131   7e-32   Prunus mume [ume]
ref|XP_002299157.1|  hypothetical protein POPTR_0001s03330g             130   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011034581.1|  PREDICTED: uncharacterized protein LOC105132...    130   1e-31   Populus euphratica
ref|XP_011034584.1|  PREDICTED: uncharacterized protein LOC105132...    130   1e-31   Populus euphratica
ref|XP_011034582.1|  PREDICTED: uncharacterized protein LOC105132...    130   1e-31   Populus euphratica
ref|NP_001143180.1|  uncharacterized protein LOC100275680               130   1e-31   Zea mays [maize]
gb|AFW85535.1|  hypothetical protein ZEAMMB73_400214                    130   1e-31   
ref|XP_006385936.1|  hypothetical protein POPTR_0003s18310g             129   2e-31   
ref|XP_011020564.1|  PREDICTED: uncharacterized protein LOC105122893    129   2e-31   Populus euphratica
emb|CDY36470.1|  BnaC03g67900D                                          130   2e-31   Brassica napus [oilseed rape]
ref|XP_002304738.2|  hypothetical protein POPTR_0003s18310g             129   2e-31   
ref|XP_009137965.1|  PREDICTED: uncharacterized protein LOC103862001    130   2e-31   Brassica rapa
ref|NP_001143086.1|  hypothetical protein                               129   2e-31   Zea mays [maize]
ref|XP_008647634.1|  PREDICTED: hypothetical protein isoform X1         129   2e-31   Zea mays [maize]
gb|KHN24188.1|  hypothetical protein glysoja_042005                     129   3e-31   Glycine soja [wild soybean]
ref|XP_004303224.1|  PREDICTED: uncharacterized protein LOC101296120    129   3e-31   Fragaria vesca subsp. vesca
ref|XP_010655140.1|  PREDICTED: uncharacterized protein LOC100262...    129   3e-31   Vitis vinifera
ref|XP_006412670.1|  hypothetical protein EUTSA_v10024775mg             129   4e-31   Eutrema salsugineum [saltwater cress]
ref|XP_010655142.1|  PREDICTED: uncharacterized protein LOC100262...    129   4e-31   
ref|XP_010655141.1|  PREDICTED: uncharacterized protein LOC100262...    129   4e-31   
ref|XP_010655143.1|  PREDICTED: uncharacterized protein LOC100262...    128   5e-31   Vitis vinifera
ref|XP_006575320.1|  PREDICTED: uncharacterized protein LOC100794...    128   5e-31   Glycine max [soybeans]
gb|KHN30277.1|  hypothetical protein glysoja_042437                     128   5e-31   Glycine soja [wild soybean]
ref|XP_010687332.1|  PREDICTED: uncharacterized protein LOC104901445    128   5e-31   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI25264.3|  unnamed protein product                                128   6e-31   Vitis vinifera
ref|XP_002437983.1|  hypothetical protein SORBIDRAFT_10g005890          128   6e-31   
emb|CDX72268.1|  BnaC07g42900D                                          128   6e-31   
ref|XP_011069649.1|  PREDICTED: uncharacterized protein LOC105155471    128   7e-31   
ref|NP_001057011.1|  Os06g0186600                                       127   7e-31   
ref|XP_006655862.1|  PREDICTED: uncharacterized protein LOC102701454    127   7e-31   Oryza brachyantha
ref|XP_010927930.1|  PREDICTED: uncharacterized protein LOC105049...    127   9e-31   
gb|EAY99950.1|  hypothetical protein OsI_21952                          127   1e-30   Oryza sativa Indica Group [Indian rice]
gb|EAZ36075.1|  hypothetical protein OsJ_20384                          127   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006283391.1|  hypothetical protein CARUB_v10004435mg             128   1e-30   Capsella rubella
emb|CDY39241.1|  BnaA03g50530D                                          128   1e-30   Brassica napus [oilseed rape]
gb|EMT26553.1|  hypothetical protein F775_08200                         127   1e-30   
ref|XP_010227931.1|  PREDICTED: uncharacterized protein LOC100821...    127   1e-30   Brachypodium distachyon [annual false brome]
ref|XP_009395482.1|  PREDICTED: uncharacterized protein LOC103980727    127   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004507038.1|  PREDICTED: uncharacterized protein LOC101500032    127   2e-30   Cicer arietinum [garbanzo]
gb|KFK41359.1|  hypothetical protein AALP_AA2G119900                    127   2e-30   Arabis alpina [alpine rockcress]
ref|XP_003564178.1|  PREDICTED: uncharacterized protein LOC100821...    127   2e-30   Brachypodium distachyon [annual false brome]
emb|CDY34799.1|  BnaA09g41660D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_009117249.1|  PREDICTED: uncharacterized protein LOC103842383    126   2e-30   Brassica rapa
gb|KHN04197.1|  hypothetical protein glysoja_032693                     127   2e-30   Glycine soja [wild soybean]
gb|ADB08053.1|  putative protein                                        127   2e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004964644.1|  PREDICTED: uncharacterized protein LOC101773914    127   2e-30   Setaria italica
ref|XP_003522941.1|  PREDICTED: uncharacterized protein LOC100807349    126   3e-30   Glycine max [soybeans]
gb|KDO55397.1|  hypothetical protein CISIN_1g012603mg                   125   3e-30   Citrus sinensis [apfelsine]
ref|XP_006583081.1|  PREDICTED: uncharacterized protein LOC100808...    127   4e-30   Glycine max [soybeans]
gb|KDO55371.1|  hypothetical protein CISIN_1g012603mg                   125   4e-30   Citrus sinensis [apfelsine]
gb|KDO55369.1|  hypothetical protein CISIN_1g012603mg                   125   4e-30   Citrus sinensis [apfelsine]
gb|KJB23594.1|  hypothetical protein B456_004G106800                    125   4e-30   Gossypium raimondii
gb|EMS68538.1|  hypothetical protein TRIUR3_33455                       125   4e-30   Triticum urartu
ref|XP_009396243.1|  PREDICTED: uncharacterized protein LOC103981292    126   5e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_194807.1|  uncharacterized protein                               126   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KJB68964.1|  hypothetical protein B456_011G001000                    125   6e-30   Gossypium raimondii
gb|KJB68963.1|  hypothetical protein B456_011G001000                    125   7e-30   Gossypium raimondii
gb|EPS69285.1|  hypothetical protein M569_05482                         125   8e-30   Genlisea aurea
ref|XP_004146718.1|  PREDICTED: uncharacterized protein LOC101219584    125   8e-30   Cucumis sativus [cucumbers]
ref|XP_009375478.1|  PREDICTED: uncharacterized protein LOC103964285    125   9e-30   Pyrus x bretschneideri [bai li]
gb|KHG24428.1|  Pesticidal crystal cry1Fa                               124   9e-30   Gossypium arboreum [tree cotton]
emb|CDX76839.1|  BnaC08g34250D                                          124   9e-30   
ref|XP_004161876.1|  PREDICTED: uncharacterized LOC101219584            124   1e-29   
ref|XP_003525940.1|  PREDICTED: uncharacterized protein LOC100792008    125   1e-29   Glycine max [soybeans]
ref|NP_001062613.1|  Os09g0128400                                       120   1e-29   
emb|CDP02853.1|  unnamed protein product                                124   1e-29   Coffea canephora [robusta coffee]
gb|KHN38060.1|  hypothetical protein glysoja_007102                     125   1e-29   Glycine soja [wild soybean]
gb|KGN65185.1|  hypothetical protein Csa_1G257910                       125   1e-29   Cucumis sativus [cucumbers]
ref|XP_006343599.1|  PREDICTED: uncharacterized protein LOC102599998    124   2e-29   Solanum tuberosum [potatoes]
ref|XP_007142109.1|  hypothetical protein PHAVU_008G253300g             125   2e-29   Phaseolus vulgaris [French bean]
ref|XP_008381124.1|  PREDICTED: uncharacterized protein LOC103443996    124   2e-29   
gb|AGV54845.1|  hypothetical protein                                    124   2e-29   Phaseolus vulgaris [French bean]
ref|XP_003530210.1|  PREDICTED: uncharacterized protein LOC100808...    124   2e-29   Glycine max [soybeans]
ref|XP_010438134.1|  PREDICTED: uncharacterized protein LOC104721765    124   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004956336.1|  PREDICTED: uncharacterized protein LOC101782755    124   3e-29   Setaria italica
ref|XP_007138292.1|  hypothetical protein PHAVU_009G196100g             123   3e-29   Phaseolus vulgaris [French bean]
ref|XP_010432947.1|  PREDICTED: uncharacterized protein LOC104717115    124   5e-29   Camelina sativa [gold-of-pleasure]
emb|CDP19486.1|  unnamed protein product                                121   5e-29   Coffea canephora [robusta coffee]
ref|XP_004242622.1|  PREDICTED: uncharacterized protein LOC101251694    123   5e-29   Solanum lycopersicum
gb|AFK36890.1|  unknown                                                 122   6e-29   Lotus japonicus
ref|XP_006600521.1|  PREDICTED: uncharacterized protein LOC100791924    122   7e-29   Glycine max [soybeans]
ref|XP_009354222.1|  PREDICTED: uncharacterized protein LOC103945389    122   8e-29   Pyrus x bretschneideri [bai li]
ref|XP_008462951.1|  PREDICTED: uncharacterized protein LOC103501212    122   8e-29   Cucumis melo [Oriental melon]
ref|XP_008790125.1|  PREDICTED: uncharacterized protein LOC103707...    122   1e-28   
ref|NP_565562.2|  uncharacterized protein                               121   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447673.1|  PREDICTED: uncharacterized protein LOC104730227    122   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_008342829.1|  PREDICTED: uncharacterized protein LOC103405596    121   2e-28   
ref|XP_009345909.1|  PREDICTED: uncharacterized protein LOC103937692    121   2e-28   
gb|KEH28578.1|  hypothetical protein MTR_4g007710                       121   2e-28   Medicago truncatula
ref|XP_009399571.1|  PREDICTED: uncharacterized protein LOC103983938    121   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW70846.1|  hypothetical protein EUGRSUZ_F03986                     120   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010063614.1|  PREDICTED: uncharacterized protein LOC104450...    120   3e-28   Eucalyptus grandis [rose gum]
ref|XP_008790126.1|  PREDICTED: uncharacterized protein LOC103707...    120   3e-28   
gb|KFK41360.1|  hypothetical protein AALP_AA2G119900                    120   4e-28   Arabis alpina [alpine rockcress]
gb|EEE69217.1|  hypothetical protein OsJ_28438                          120   5e-28   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK07465.1|  predicted protein                                      118   6e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004137649.1|  PREDICTED: uncharacterized protein LOC101216149    120   6e-28   Cucumis sativus [cucumbers]
ref|XP_002869363.1|  hypothetical protein ARALYDRAFT_491676             120   9e-28   
gb|AAD03372.2|  expressed protein                                       119   9e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32610.1|  hypothetical protein MTR_4g130310                       119   1e-27   Medicago truncatula
ref|XP_003610264.1|  hypothetical protein MTR_4g130310                  119   1e-27   Medicago truncatula
ref|XP_004954197.1|  PREDICTED: uncharacterized protein LOC101774...    117   1e-27   
gb|EMS63081.1|  hypothetical protein TRIUR3_18987                       119   2e-27   Triticum urartu
ref|XP_009418539.1|  PREDICTED: uncharacterized protein LOC103998...    118   2e-27   
ref|XP_006664800.1|  PREDICTED: uncharacterized protein LOC102717582    118   3e-27   Oryza brachyantha
ref|XP_003577010.1|  PREDICTED: uncharacterized protein LOC100845837    118   3e-27   Brachypodium distachyon [annual false brome]
ref|XP_002878722.1|  hypothetical protein ARALYDRAFT_481267             117   3e-27   
ref|XP_010544349.1|  PREDICTED: uncharacterized protein LOC104816994    117   4e-27   Tarenaya hassleriana [spider flower]
ref|XP_004954196.1|  PREDICTED: uncharacterized protein LOC101774...    117   5e-27   Setaria italica
gb|EMT03088.1|  hypothetical protein F775_10227                         118   6e-27   
ref|XP_010235910.1|  PREDICTED: uncharacterized protein LOC100824...    116   6e-27   
ref|XP_010235911.1|  PREDICTED: uncharacterized protein LOC100824...    116   7e-27   
gb|EEC84117.1|  hypothetical protein OsI_30449                          117   7e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_004507763.1|  PREDICTED: uncharacterized protein LOC101495...    117   7e-27   Cicer arietinum [garbanzo]
ref|XP_010235909.1|  PREDICTED: uncharacterized protein LOC100824...    116   8e-27   
ref|XP_008443832.1|  PREDICTED: uncharacterized protein LOC103487...    117   8e-27   Cucumis melo [Oriental melon]
emb|CDP21215.1|  unnamed protein product                                110   8e-27   Coffea canephora [robusta coffee]
ref|XP_008443830.1|  PREDICTED: uncharacterized protein LOC103487...    117   1e-26   Cucumis melo [Oriental melon]
ref|XP_008443831.1|  PREDICTED: uncharacterized protein LOC103487...    117   1e-26   Cucumis melo [Oriental melon]
emb|CAN68794.1|  hypothetical protein VITISV_016174                     118   1e-26   Vitis vinifera
ref|XP_002452969.1|  hypothetical protein SORBIDRAFT_04g035713          110   1e-26   
ref|XP_006649126.1|  PREDICTED: uncharacterized protein LOC102706173    114   4e-26   Oryza brachyantha
ref|XP_010905052.1|  PREDICTED: uncharacterized protein LOC105032...    114   5e-26   Elaeis guineensis
ref|XP_010905051.1|  PREDICTED: uncharacterized protein LOC105032...    113   1e-25   
ref|XP_010472409.1|  PREDICTED: uncharacterized protein LOC104752037    112   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010417153.1|  PREDICTED: uncharacterized protein LOC104702928    111   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006585654.1|  PREDICTED: uncharacterized protein LOC100808...    113   3e-25   Glycine max [soybeans]
ref|XP_006575319.1|  PREDICTED: uncharacterized protein LOC100794...    112   4e-25   Glycine max [soybeans]
ref|XP_010429365.1|  PREDICTED: uncharacterized protein LOC104713849    110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003531752.1|  PREDICTED: uncharacterized protein LOC100808...    111   2e-24   Glycine max [soybeans]
ref|XP_008679230.1|  PREDICTED: uncharacterized protein LOC103654180    108   5e-24   Zea mays [maize]
gb|EYU37144.1|  hypothetical protein MIMGU_mgv1a006661mg                108   6e-24   Erythranthe guttata [common monkey flower]
gb|AFW64169.1|  hypothetical protein ZEAMMB73_443308                    108   1e-23   
gb|EAY87838.1|  hypothetical protein OsI_09259                          107   2e-23   Oryza sativa Indica Group [Indian rice]
ref|NP_001173180.1|  Os02g0793800                                       107   2e-23   
ref|XP_006294201.1|  hypothetical protein CARUB_v10023197mg             106   3e-23   Capsella rubella
dbj|BAD19195.1|  hypothetical protein                                   107   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EPS64940.1|  hypothetical protein M569_09843                         102   2e-22   Genlisea aurea
ref|XP_010063615.1|  PREDICTED: uncharacterized protein LOC104450...    100   3e-21   
ref|XP_011087483.1|  PREDICTED: uncharacterized protein LOC105168...  97.1    2e-20   
gb|KHN17516.1|  hypothetical protein glysoja_005713                   97.1    7e-20   Glycine soja [wild soybean]
ref|XP_011087482.1|  PREDICTED: uncharacterized protein LOC105168...  97.1    7e-20   Sesamum indicum [beniseed]
emb|CAC84497.1|  hypothetical protein                                 92.8    2e-19   Pinus pinaster [cluster pine]
gb|EMT18992.1|  hypothetical protein F775_00285                       95.5    3e-19   
ref|XP_003610267.1|  hypothetical protein MTR_4g130340                92.4    7e-19   
gb|AES92464.2|  hypothetical protein MTR_4g130340                     92.4    8e-19   Medicago truncatula
ref|XP_001755863.1|  predicted protein                                89.4    2e-18   
ref|XP_001764908.1|  predicted protein                                89.0    2e-18   
ref|XP_010313497.1|  PREDICTED: uncharacterized protein LOC104644...  92.0    7e-18   Solanum lycopersicum
ref|XP_010248612.1|  PREDICTED: uncharacterized protein LOC104591469  91.7    7e-18   Nelumbo nucifera [Indian lotus]
ref|XP_006344846.1|  PREDICTED: uncharacterized protein LOC102579073  92.0    9e-18   
ref|XP_009617801.1|  PREDICTED: uncharacterized protein LOC104110084  91.7    1e-17   Nicotiana tomentosiformis
ref|XP_009804610.1|  PREDICTED: uncharacterized protein LOC104249811  91.3    1e-17   Nicotiana sylvestris
ref|XP_010656631.1|  PREDICTED: uncharacterized protein LOC100251...  90.1    2e-17   Vitis vinifera
ref|XP_010264767.1|  PREDICTED: uncharacterized protein LOC104602687  88.2    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_010938291.1|  PREDICTED: uncharacterized protein LOC105057391  90.5    2e-17   Elaeis guineensis
emb|CDP21606.1|  unnamed protein product                              87.0    4e-17   Coffea canephora [robusta coffee]
ref|XP_002960999.1|  hypothetical protein SELMODRAFT_5765             85.5    4e-17   
emb|CBI39590.3|  unnamed protein product                              89.0    5e-17   Vitis vinifera
gb|EMS58898.1|  hypothetical protein TRIUR3_15959                     88.2    8e-17   Triticum urartu
ref|XP_010659700.1|  PREDICTED: uncharacterized protein LOC100249...  89.0    1e-16   Vitis vinifera
ref|XP_002277974.1|  PREDICTED: uncharacterized protein LOC100249...  89.0    1e-16   Vitis vinifera
emb|CAN72622.1|  hypothetical protein VITISV_030283                   88.6    1e-16   Vitis vinifera
ref|XP_010313502.1|  PREDICTED: uncharacterized protein LOC104644...  87.8    1e-16   Solanum lycopersicum
gb|EYU37246.1|  hypothetical protein MIMGU_mgv1a005144mg              86.7    3e-16   Erythranthe guttata [common monkey flower]
ref|XP_011023771.1|  PREDICTED: uncharacterized protein LOC105125...  86.7    4e-16   Populus euphratica
ref|XP_011023773.1|  PREDICTED: uncharacterized protein LOC105125...  86.7    5e-16   Populus euphratica
ref|XP_002318954.2|  hypothetical protein POPTR_0013s01040g           86.7    5e-16   
ref|XP_011023772.1|  PREDICTED: uncharacterized protein LOC105125...  86.7    5e-16   Populus euphratica
ref|XP_008781330.1|  PREDICTED: uncharacterized protein LOC103701133  82.4    1e-15   
ref|XP_002512506.1|  hypothetical protein RCOM_1434920                85.1    2e-15   
ref|XP_006580837.1|  PREDICTED: uncharacterized protein LOC102669004  84.3    3e-15   
ref|XP_004304864.1|  PREDICTED: uncharacterized protein LOC101299...  84.3    3e-15   Fragaria vesca subsp. vesca
ref|XP_011466143.1|  PREDICTED: uncharacterized protein LOC101299...  84.0    3e-15   Fragaria vesca subsp. vesca
gb|KDP23382.1|  hypothetical protein JCGZ_23215                       84.0    3e-15   Jatropha curcas
ref|XP_008245957.1|  PREDICTED: uncharacterized protein LOC103344...  83.6    4e-15   Prunus mume [ume]
ref|XP_008245953.1|  PREDICTED: uncharacterized protein LOC103344...  83.6    4e-15   Prunus mume [ume]
emb|CDP18247.1|  unnamed protein product                              82.8    5e-15   Coffea canephora [robusta coffee]
ref|XP_010249451.1|  PREDICTED: uncharacterized protein LOC104592004  78.2    3e-14   
ref|XP_010921578.1|  PREDICTED: uncharacterized protein LOC105045119  80.9    3e-14   
ref|XP_010236497.1|  PREDICTED: uncharacterized protein LOC104584078  78.6    4e-14   
ref|XP_008443833.1|  PREDICTED: uncharacterized protein LOC103487...  79.7    9e-14   Cucumis melo [Oriental melon]
ref|XP_009338183.1|  PREDICTED: uncharacterized protein LOC103930562  78.6    2e-13   Pyrus x bretschneideri [bai li]
ref|XP_007031145.1|  Uncharacterized protein TCM_026760               73.9    2e-13   
ref|XP_009391111.1|  PREDICTED: uncharacterized protein LOC103977342  75.1    3e-13   
gb|KJB26316.1|  hypothetical protein B456_004G236700                  77.4    3e-13   Gossypium raimondii
ref|XP_008345670.1|  PREDICTED: uncharacterized protein LOC103408610  77.4    5e-13   
gb|KDP23381.1|  hypothetical protein JCGZ_23214                       77.4    5e-13   
ref|XP_008370378.1|  PREDICTED: uncharacterized protein LOC103433...  77.4    5e-13   
ref|XP_010464129.1|  PREDICTED: uncharacterized protein LOC104744729  75.5    6e-13   
ref|XP_008370379.1|  PREDICTED: uncharacterized protein LOC103433...  77.0    7e-13   
ref|XP_008388930.1|  PREDICTED: uncharacterized protein LOC103451288  73.9    1e-12   
ref|XP_006433530.1|  hypothetical protein CICLE_v10003523mg           75.1    2e-12   
ref|XP_010486053.1|  PREDICTED: uncharacterized protein LOC104764251  75.1    3e-12   
gb|KDO81686.1|  hypothetical protein CISIN_1g009123mg                 74.7    5e-12   
ref|XP_011038912.1|  PREDICTED: uncharacterized protein LOC105135...  73.6    1e-11   
ref|XP_011038918.1|  PREDICTED: uncharacterized protein LOC105135...  73.6    1e-11   
ref|XP_011038913.1|  PREDICTED: uncharacterized protein LOC105135...  73.2    1e-11   
ref|XP_011036954.1|  PREDICTED: uncharacterized protein LOC105134...  73.2    1e-11   
ref|XP_011038915.1|  PREDICTED: uncharacterized protein LOC105135...  73.2    1e-11   
ref|XP_011038917.1|  PREDICTED: uncharacterized protein LOC105135...  73.2    1e-11   
ref|XP_011036953.1|  PREDICTED: uncharacterized protein LOC105134...  73.2    1e-11   
ref|XP_011036951.1|  PREDICTED: uncharacterized protein LOC105134...  73.2    1e-11   
ref|XP_011036952.1|  PREDICTED: uncharacterized protein LOC105134...  73.2    1e-11   
gb|KJB45445.1|  hypothetical protein B456_007G306100                  72.8    1e-11   
gb|KDP38725.1|  hypothetical protein JCGZ_04078                       72.8    2e-11   
gb|EMT30673.1|  hypothetical protein F775_24129                       71.2    3e-11   
ref|XP_006382399.1|  hypothetical protein POPTR_0005s01770g           71.6    4e-11   
ref|XP_006388746.1|  hypothetical protein POPTR_0107s00210g           70.9    5e-11   
ref|XP_003536047.2|  PREDICTED: uncharacterized protein LOC100787534  69.3    8e-11   
ref|XP_002444149.1|  hypothetical protein SORBIDRAFT_07g009701        68.9    9e-11   
ref|XP_010026905.1|  PREDICTED: uncharacterized protein LOC104417300  69.7    2e-10   
ref|XP_008786253.1|  PREDICTED: uncharacterized protein LOC103704...  68.6    3e-10   
ref|XP_008786252.1|  PREDICTED: uncharacterized protein LOC103704...  68.6    3e-10   
ref|XP_008786251.1|  PREDICTED: uncharacterized protein LOC103704...  68.6    3e-10   
ref|XP_010464130.1|  PREDICTED: uncharacterized protein LOC104744730  68.2    4e-10   
ref|XP_008786257.1|  PREDICTED: uncharacterized protein LOC103704...  67.4    7e-10   
ref|XP_011034585.1|  PREDICTED: uncharacterized protein LOC105132...  67.8    8e-10   
ref|XP_008786256.1|  PREDICTED: uncharacterized protein LOC103704...  67.4    8e-10   
ref|XP_008786254.1|  PREDICTED: uncharacterized protein LOC103704...  67.4    8e-10   
ref|XP_010929449.1|  PREDICTED: uncharacterized protein LOC105050918  66.2    1e-09   
ref|XP_010489686.1|  PREDICTED: uncharacterized protein LOC104767347  67.0    1e-09   
gb|KHN23156.1|  hypothetical protein glysoja_030216                   65.5    2e-09   
ref|XP_006605820.1|  PREDICTED: uncharacterized protein LOC102661114  65.5    2e-09   
emb|CDY28207.1|  BnaA01g06420D                                        63.2    3e-09   
ref|XP_009127605.1|  PREDICTED: uncharacterized protein LOC103852450  63.9    3e-09   
gb|KGN66011.1|  hypothetical protein Csa_1G561420                     65.1    5e-09   
ref|XP_008450546.1|  PREDICTED: uncharacterized protein LOC103492...  65.1    5e-09   
ref|XP_008450547.1|  PREDICTED: uncharacterized protein LOC103492...  65.1    5e-09   
ref|XP_010026904.1|  PREDICTED: uncharacterized protein LOC104417299  63.2    1e-08   
ref|XP_006299445.1|  hypothetical protein CARUB_v10015609mg           63.9    1e-08   
ref|XP_002874712.1|  hypothetical protein ARALYDRAFT_352242           63.2    2e-08   
ref|XP_010548773.1|  PREDICTED: uncharacterized protein LOC104820099  61.6    2e-08   
gb|KCW60554.1|  hypothetical protein EUGRSUZ_H03288                   62.4    2e-08   
ref|XP_010094451.1|  hypothetical protein L484_000631                 62.0    3e-08   
ref|XP_002884531.1|  predicted protein                                62.4    4e-08   
ref|XP_002888567.1|  predicted protein                                62.4    4e-08   
ref|XP_002874721.1|  hypothetical protein ARALYDRAFT_911539           60.1    4e-08   
ref|XP_007144998.1|  hypothetical protein PHAVU_007G201100g           61.2    5e-08   
ref|XP_004495661.1|  PREDICTED: uncharacterized protein LOC101510904  61.6    6e-08   
gb|KDP43272.1|  hypothetical protein JCGZ_22824                       60.5    1e-07   
ref|XP_003591216.1|  hypothetical protein MTR_1g084010                60.8    1e-07   
gb|AES61467.2|  hypothetical protein MTR_1g084010                     60.5    1e-07   
gb|KHN25903.1|  hypothetical protein glysoja_018757                   60.8    1e-07   
gb|EYU40505.1|  hypothetical protein MIMGU_mgv1a020593mg              60.1    2e-07   
gb|AAD25610.1|AC005287_12  Hypothetical protein                       60.1    2e-07   
emb|CDY27740.1|  BnaA05g31490D                                        58.5    9e-07   
ref|XP_009147207.1|  PREDICTED: uncharacterized protein LOC103870795  58.2    1e-06   
ref|XP_002990275.1|  hypothetical protein SELMODRAFT_5767             55.5    1e-06   
ref|XP_002961426.1|  hypothetical protein SELMODRAFT_5766             55.5    1e-06   
emb|CDP18840.1|  unnamed protein product                              54.7    1e-06   
emb|CDY05199.1|  BnaC05g46040D                                        57.8    1e-06   
gb|KFK37986.1|  hypothetical protein AALP_AA3G055300                  57.8    1e-06   
gb|KFK37985.1|  hypothetical protein AALP_AA3G055300                  57.8    1e-06   
ref|XP_009383084.1|  PREDICTED: uncharacterized protein LOC103970889  57.0    3e-06   
ref|XP_010507123.1|  PREDICTED: uncharacterized protein LOC104783699  57.0    3e-06   
ref|XP_010674571.1|  PREDICTED: uncharacterized protein LOC104890690  55.8    6e-06   
ref|XP_010417855.1|  PREDICTED: uncharacterized protein LOC104703525  55.5    9e-06   
ref|XP_003295190.1|  hypothetical protein DICPUDRAFT_100178           55.5    1e-05   
ref|XP_006855281.1|  hypothetical protein AMTR_s00057p00033650        55.1    1e-05   
ref|NP_187228.1|  uncharacterized protein                             54.7    1e-05   
ref|XP_644015.1|  hypothetical protein DDB_G0274255                   54.7    2e-05   
ref|XP_009147787.1|  PREDICTED: uncharacterized protein LOC103871...  53.9    2e-05   
ref|XP_009147788.1|  PREDICTED: uncharacterized protein LOC103871...  53.1    3e-05   
ref|XP_008245965.1|  PREDICTED: uncharacterized protein LOC103344...  52.8    7e-05   
gb|EFA76365.1|  hypothetical protein PPL_10130                        52.8    8e-05   
ref|XP_010674173.1|  PREDICTED: uncharacterized protein LOC104890399  52.0    1e-04   
ref|XP_006408986.1|  hypothetical protein EUTSA_v10002069mg           51.6    1e-04   
gb|AHH02392.1|  uncharacterized protein                               48.9    1e-04   
ref|XP_010468029.1|  PREDICTED: uncharacterized protein LOC104748032  48.1    3e-04   
ref|XP_010489685.1|  PREDICTED: uncharacterized protein LOC104767346  50.1    5e-04   
ref|XP_009135973.1|  PREDICTED: uncharacterized protein LOC103860125  50.1    5e-04   
ref|XP_010674187.1|  PREDICTED: uncharacterized protein LOC104890409  50.1    6e-04   
ref|XP_010674185.1|  PREDICTED: uncharacterized protein LOC104890408  49.7    7e-04   
emb|CDX74132.1|  BnaA03g29150D                                        49.3    0.001   



>ref|XP_009783853.1| PREDICTED: uncharacterized protein LOC104232363 isoform X2 [Nicotiana 
sylvestris]
Length=531

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 136/170 (80%), Gaps = 5/170 (3%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM T E+ PEL W++GK   VKLE+E D      HGPLNKRSKLSS LQ Q+ +G  
Sbjct  1    MVQLMNTVEVLPELQWRKGKTAVVKLEIEDDLDEA--HGPLNKRSKLSSSLQ-QLSVGAD  57

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQG   K G N GKKEQK NS T
Sbjct  58   GFPVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGNSPKVG-NHGKKEQKGNSVT  115

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  116  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  165



>ref|XP_009615691.1| PREDICTED: uncharacterized protein LOC104108377 isoform X2 [Nicotiana 
tomentosiformis]
Length=531

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 135/170 (79%), Gaps = 5/170 (3%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM T E+ PEL W++GK   VKLE+E D      HGPLNKRSKLSS LQ Q+ +G  
Sbjct  1    MVQLMNTVEVLPELQWRKGKTAVVKLEIEDDLDEA--HGPLNKRSKLSSSLQ-QLSVGAD  57

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LS G   K G N GKKEQK NS T
Sbjct  58   GFPVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSPGNNPKVG-NHGKKEQKGNSVT  115

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  116  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  165



>ref|XP_009758247.1| PREDICTED: uncharacterized protein LOC104210965 isoform X1 [Nicotiana 
sylvestris]
Length=535

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            M  LMKT E  PEL WQRGK +PVK EVE+++  +EE  PLNKRSKLS  LQ Q+G+G  
Sbjct  1    MAQLMKTAETPPELRWQRGKMLPVKREVELENSADEELCPLNKRSKLSYSLQQQLGVGAG  60

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F   P+ Q  PL+EPSPLGL LRKSPSLLDLIQMRLSQ   +KAG + GKK QK ++  
Sbjct  61   GFLVSPL-QDGPLDEPSPLGLRLRKSPSLLDLIQMRLSQSSTAKAGSH-GKKVQKGSTGL  118

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  119  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  168



>ref|XP_009783852.1| PREDICTED: uncharacterized protein LOC104232363 isoform X1 [Nicotiana 
sylvestris]
Length=532

 Score =   190 bits (482),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM T E+ PEL W++GK   VKLE+E D      HGPLNKRSKLSS LQ Q+ +G  
Sbjct  1    MVQLMNTVEVLPELQWRKGKTAVVKLEIEDDLDEA--HGPLNKRSKLSSSLQQQLSVGAD  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQG   K G N GKKEQK NS T
Sbjct  59   GFPVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGNSPKVG-NHGKKEQKGNSVT  116

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  117  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  166



>ref|XP_009758249.1| PREDICTED: uncharacterized protein LOC104210965 isoform X2 [Nicotiana 
sylvestris]
Length=534

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 136/170 (80%), Gaps = 3/170 (2%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            M  LMKT E  PEL WQRGK +PVK EVE+++  +EE  PLNKRSKLS  LQ Q+G+G  
Sbjct  1    MAQLMKTAETPPELRWQRGKMLPVKREVELENSADEELCPLNKRSKLSYSLQ-QLGVGAG  59

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F   P+ Q  PL+EPSPLGL LRKSPSLLDLIQMRLSQ   +KAG + GKK QK ++  
Sbjct  60   GFLVSPL-QDGPLDEPSPLGLRLRKSPSLLDLIQMRLSQSSTAKAGSH-GKKVQKGSTGL  117

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  118  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  167



>ref|XP_009615690.1| PREDICTED: uncharacterized protein LOC104108377 isoform X1 [Nicotiana 
tomentosiformis]
Length=532

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 135/170 (79%), Gaps = 4/170 (2%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM T E+ PEL W++GK   VKLE+E D      HGPLNKRSKLSS LQ Q+ +G  
Sbjct  1    MVQLMNTVEVLPELQWRKGKTAVVKLEIEDDLDEA--HGPLNKRSKLSSSLQQQLSVGAD  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LS G   K G N GKKEQK NS T
Sbjct  59   GFPVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSPGNNPKVG-NHGKKEQKGNSVT  116

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  117  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  166



>ref|XP_009604130.1| PREDICTED: uncharacterized protein LOC104098979 isoform X2 [Nicotiana 
tomentosiformis]
Length=534

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 134/170 (79%), Gaps = 3/170 (2%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            M  LMK  +  PEL WQRGK +PVK EVE++   +EE  PLNKRSKL   LQ Q+G+G  
Sbjct  1    MAQLMKIAKTPPELRWQRGKMLPVKREVELETSSDEELCPLNKRSKLYYSLQ-QLGVGGG  59

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F   P+ Q  PL+EPSPLGL LRKSPSLLDLIQMRLSQG  SK G + GKKEQK ++  
Sbjct  60   GFPVSPL-QDGPLDEPSPLGLRLRKSPSLLDLIQMRLSQGSTSKVGSH-GKKEQKGSTGM  117

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  118  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  167



>ref|XP_009604129.1| PREDICTED: uncharacterized protein LOC104098979 isoform X1 [Nicotiana 
tomentosiformis]
Length=535

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 134/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            M  LMK  +  PEL WQRGK +PVK EVE++   +EE  PLNKRSKL   LQ Q+G+G  
Sbjct  1    MAQLMKIAKTPPELRWQRGKMLPVKREVELETSSDEELCPLNKRSKLYYSLQQQLGVGGG  60

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
             F   P+ Q  PL+EPSPLGL LRKSPSLLDLIQMRLSQG  SK G + GKKEQK ++  
Sbjct  61   GFPVSPL-QDGPLDEPSPLGLRLRKSPSLLDLIQMRLSQGSTSKVGSH-GKKEQKGSTGM  118

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EKLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  119  TEKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  168



>ref|XP_006341421.1| PREDICTED: uncharacterized protein LOC102590599 [Solanum tuberosum]
Length=525

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 130/171 (76%), Gaps = 6/171 (4%)
 Frame = +3

Query  147  MVFLMKTG-EMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LM+T  E +PEL W +GK   VKLE E        +GPLNKRSKLSS    Q+ +G 
Sbjct  1    MVQLMRTTMEESPELQWHKGKNAAVKLEFEDALDEA--YGPLNKRSKLSSSSLQQLVVGA  58

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSS  503
              F   P  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQG  +K G N GK EQK NS 
Sbjct  59   DGFPVAPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGNNAKVG-NQGK-EQKGNSG  115

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            T EKLKASNFPA++L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  116  TIEKLKASNFPATVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  166



>ref|XP_010318696.1| PREDICTED: uncharacterized protein LOC101254582 isoform X2 [Solanum 
lycopersicum]
Length=534

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 132/171 (77%), Gaps = 5/171 (3%)
 Frame = +3

Query  147  MVFLMKTG-EMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LM+T  E +PEL WQ+GK   VKLE E        +GPL+KRSKLSS    Q+ +  
Sbjct  1    MVQLMRTTMEESPELQWQKGKNAAVKLEFEDALDEA--YGPLSKRSKLSSSSLQQLVVEA  58

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSS  503
              F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQG  +K G N GKKEQK N+ 
Sbjct  59   DGFPVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGNNAKVG-NQGKKEQKGNTG  116

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            T EKLKASNFPA++L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  117  TIEKLKASNFPATVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  167



>ref|XP_004235885.1| PREDICTED: uncharacterized protein LOC101254582 isoform X1 [Solanum 
lycopersicum]
Length=535

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 131/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  147  MVFLMKTG-EMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LM+T  E +PEL WQ+GK   VKLE E        +GPL+KRSKLSS    Q  +  
Sbjct  1    MVQLMRTTMEESPELQWQKGKNAAVKLEFEDALDEA--YGPLSKRSKLSSSSLQQQLVVE  58

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSS  503
            +D    P  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQG  +K G N GKKEQK N+ 
Sbjct  59   ADGFPVPPSQYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGNNAKVG-NQGKKEQKGNTG  117

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            T EKLKASNFPA++L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  118  TIEKLKASNFPATVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  168



>gb|KDP38724.1| hypothetical protein JCGZ_04077 [Jatropha curcas]
Length=557

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 133/181 (73%), Gaps = 14/181 (8%)
 Frame = +3

Query  147  MVFLMKTGEM--APELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV LMK+G +   PE     G  VPVKLE+  D   EE HGPLNKRSK S  +Q Q G G
Sbjct  1    MVQLMKSGNLPAEPETPSSCGNKVPVKLEITEDPLEEE-HGPLNKRSKPSQTVQ-QWGAG  58

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAG------GNPG-K  479
             + F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG  S  G       N G K
Sbjct  59   ANAFPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQGSASTPGTQQKENDNLGVK  117

Query  480  KEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
            KE K++  S T++KLKASNFPASILKIGSWEYKSRYEG+LVAKCYFAKHKLVWEVL+GGL
Sbjct  118  KESKSSTASGTTDKLKASNFPASILKIGSWEYKSRYEGELVAKCYFAKHKLVWEVLEGGL  177

Query  654  K  656
            K
Sbjct  178  K  178



>ref|XP_006366261.1| PREDICTED: uncharacterized protein LOC102579955 isoform X1 [Solanum 
tuberosum]
Length=528

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 5/164 (3%)
 Frame = +3

Query  165  TGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPP  344
            TG    +L WQRGK +PVK EV++++  +EE   L+KRSKL S LQ Q+G G  DF  P 
Sbjct  8    TGVAPSDLRWQRGKMLPVKREVDLENFSDEERCQLDKRSKLYSSLQQQLGEGACDF--PV  65

Query  345  VVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKA  524
               +  L+EPSPLGL L+KSPSL+D+IQM+L    M ++ G   KKEQK +++  EKLKA
Sbjct  66   SSSFVSLDEPSPLGLRLKKSPSLVDMIQMKLGGTSMVESLG---KKEQKRSTAMIEKLKA  122

Query  525  SNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SNFP S+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  123  SNFPGSVLRIGTWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  166



>ref|XP_002528397.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33990.1| conserved hypothetical protein [Ricinus communis]
Length=560

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 126/184 (68%), Gaps = 17/184 (9%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM +G    E +    K  PVK+E+  D   EE HGPLNKRSK S  +Q Q G G +
Sbjct  1    MVQLMISGNNPVETETTSSKGAPVKVEIVEDPLEEE-HGPLNKRSKQSQTVQ-QWGAGAN  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS--  500
             +  PPV QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG  S  G   G      NS  
Sbjct  59   AYPVPPV-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQGGASAPGTIQGTDNTNNNSVI  117

Query  501  ------------STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLD  644
                        S+++KLKASNFPASIL+IGSWEYKSRYEG+LVAKCYFAKHKLVWEVL+
Sbjct  118  KKESSNKTTTASSSTDKLKASNFPASILRIGSWEYKSRYEGELVAKCYFAKHKLVWEVLE  177

Query  645  GGLK  656
            GGLK
Sbjct  178  GGLK  181



>ref|XP_006453554.1| hypothetical protein CICLE_v10007906mg [Citrus clementina]
 gb|ESR66794.1| hypothetical protein CICLE_v10007906mg [Citrus clementina]
Length=414

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 128/177 (72%), Gaps = 10/177 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G   P+ +    +  VPVKLE+  D   EE HGPLNKRSK SS LQ Q     
Sbjct  1    MVQLMKSGNPKPDPETTSCREKVPVKLEIVEDSLDEE-HGPLNKRSKPSSTLQQQAWSAW  59

Query  324  SD---FREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA  494
            +D   F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG          KKE KA
Sbjct  60   NDNDSFPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQG-TENGTATAVKKESKA  117

Query  495  ---NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               +S +++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  TAGSSGSTDKLKASNFPASILRIGRWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_006453555.1| hypothetical protein CICLE_v10007906mg [Citrus clementina]
 gb|ESR66795.1| hypothetical protein CICLE_v10007906mg [Citrus clementina]
Length=552

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 128/177 (72%), Gaps = 10/177 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G   P+ +    +  VPVKLE+  D   EE HGPLNKRSK SS LQ Q     
Sbjct  1    MVQLMKSGNPKPDPETTSCREKVPVKLEIVEDSLDEE-HGPLNKRSKPSSTLQQQAWSAW  59

Query  324  SD---FREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA  494
            +D   F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG          KKE KA
Sbjct  60   NDNDSFPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQG-TENGTATAVKKESKA  117

Query  495  ---NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               +S +++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  TAGSSGSTDKLKASNFPASILRIGRWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>gb|KDO62298.1| hypothetical protein CISIN_1g008832mg [Citrus sinensis]
Length=427

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 127/177 (72%), Gaps = 10/177 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G   P+ +    +  VPVKLE+  D   EE HGPLNKRSK SS LQ Q     
Sbjct  1    MVQLMKSGNPKPDPETTSCREKVPVKLEIVEDSLDEE-HGPLNKRSKPSSTLQQQAWSAW  59

Query  324  SD---FREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK-  491
            +D   F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG          KKE K 
Sbjct  60   NDNDSFPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQG-TENGTATAVKKESKD  117

Query  492  --ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               +S +++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  TAGSSGSTDKLKASNFPASILRIGRWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_004241674.1| PREDICTED: uncharacterized protein LOC101256298 isoform X1 [Solanum 
lycopersicum]
Length=527

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  165  TGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPP  344
            TGE   EL WQRGK +PVK EV++++  +EE   L+KR KLSS LQ Q+G G  +F    
Sbjct  8    TGEAPSELRWQRGKMLPVKREVDLENFSDEERCKLDKRFKLSSSLQQQLGEGACNFTVSS  67

Query  345  VVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKA  524
               +  ++EPSPLGL LRK+PSLLD+ Q  L    M ++ G   KKEQK +++  EKLKA
Sbjct  68   --SFMSVDEPSPLGLRLRKTPSLLDMFQTMLGGTSMVESLG---KKEQKRSTAMIEKLKA  122

Query  525  SNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SNFP S+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  123  SNFPGSVLRIGTWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  166



>ref|XP_006474053.1| PREDICTED: uncharacterized protein LOC102622246 isoform X2 [Citrus 
sinensis]
 gb|KDO62296.1| hypothetical protein CISIN_1g008832mg [Citrus sinensis]
Length=544

 Score =   156 bits (395),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 127/177 (72%), Gaps = 10/177 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G   P+ +    +  VPVKLE+  D   EE HGPLNKRSK SS LQ Q     
Sbjct  1    MVQLMKSGNPKPDPETTSCREKVPVKLEIVEDSLDEE-HGPLNKRSKPSSTLQQQAWSAW  59

Query  324  SD---FREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK-  491
            +D   F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG          KKE K 
Sbjct  60   NDNDSFPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQG-TENGTATAVKKESKD  117

Query  492  --ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               +S +++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  TAGSSGSTDKLKASNFPASILRIGRWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_006474052.1| PREDICTED: uncharacterized protein LOC102622246 isoform X1 [Citrus 
sinensis]
 gb|KDO62297.1| hypothetical protein CISIN_1g008832mg [Citrus sinensis]
Length=552

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 127/177 (72%), Gaps = 10/177 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G   P+ +    +  VPVKLE+  D   EE HGPLNKRSK SS LQ Q     
Sbjct  1    MVQLMKSGNPKPDPETTSCREKVPVKLEIVEDSLDEE-HGPLNKRSKPSSTLQQQAWSAW  59

Query  324  SD---FREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK-  491
            +D   F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG          KKE K 
Sbjct  60   NDNDSFPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQG-TENGTATAVKKESKD  117

Query  492  --ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               +S +++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  TAGSSGSTDKLKASNFPASILRIGRWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_006366262.1| PREDICTED: uncharacterized protein LOC102579955 isoform X2 [Solanum 
tuberosum]
Length=527

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 6/164 (4%)
 Frame = +3

Query  165  TGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPP  344
            TG    +L WQRGK +PVK EV++++  +EE   L+KRSKL S LQ Q+G G  DF  P 
Sbjct  8    TGVAPSDLRWQRGKMLPVKREVDLENFSDEERCQLDKRSKLYSSLQ-QLGEGACDF--PV  64

Query  345  VVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKA  524
               +  L+EPSPLGL L+KSPSL+D+IQM+L    M ++ G   KKEQK +++  EKLKA
Sbjct  65   SSSFVSLDEPSPLGLRLKKSPSLVDMIQMKLGGTSMVESLG---KKEQKRSTAMIEKLKA  121

Query  525  SNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SNFP S+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  122  SNFPGSVLRIGTWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  165



>ref|XP_008789898.1| PREDICTED: uncharacterized protein LOC103707259 [Phoenix dactylifera]
Length=564

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 126/173 (73%), Gaps = 4/173 (2%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV L   G + PE +    +  P  +++E++DPL+E+HGPLNKRSK+++PLQ Q     +
Sbjct  1    MVQLANFGTLRPESELPSKEPAPPPVKLEIEDPLDEQHGPLNKRSKITAPLQQQQNTS-A  59

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN---  497
            +   P  +Q N L EPSPLGL LRKSPSL+DLIQMRLS+   S    + GKK+       
Sbjct  60   NMVLPHALQCNLLNEPSPLGLRLRKSPSLVDLIQMRLSEANTSGESSDVGKKKVSGCIGA  119

Query  498  SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SST++K+KASNFPAS+L+IG+WEY S YEGDLVAKCYFAKHKLVWE+LDGGLK
Sbjct  120  SSTTDKMKASNFPASLLRIGTWEYASTYEGDLVAKCYFAKHKLVWEILDGGLK  172



>ref|XP_008791338.1| PREDICTED: uncharacterized protein LOC103708273 isoform X1 [Phoenix 
dactylifera]
Length=552

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 104/136 (76%), Gaps = 4/136 (3%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HG LNKRSK   PLQ Q G   S    P  +QYN L EPSPLGL LRKSPSLLDLIQMRL
Sbjct  43   HGSLNKRSKTDVPLQQQWGTS-SSVVPPQDLQYNLLNEPSPLGLRLRKSPSLLDLIQMRL  101

Query  438  SQGKMSKAGGNPGKKEQKAN---SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCY  608
            SQ   S +  + GKK+   +   S+T+EK+KASNFPAS+L+IG+WEY SRYEGDLVAKCY
Sbjct  102  SQANTSSSSSDVGKKKDARSAGASATTEKMKASNFPASLLRIGTWEYASRYEGDLVAKCY  161

Query  609  FAKHKLVWEVLDGGLK  656
            FAKHKLVWEVLDGGLK
Sbjct  162  FAKHKLVWEVLDGGLK  177



>ref|XP_010906671.1| PREDICTED: uncharacterized protein LOC105033515 isoform X1 [Elaeis 
guineensis]
Length=552

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 4/136 (3%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGPLNKR+K   P+Q Q G   S+   P  ++YN L EPSPLGL LRKSPSLLDLIQMRL
Sbjct  43   HGPLNKRTKADVPVQQQWGTS-SNMVPPQDLRYNLLNEPSPLGLRLRKSPSLLDLIQMRL  101

Query  438  SQGKMSKAGGNPGKKEQK---ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCY  608
            SQ   S +  + GK++       S+TSEK+KASNFPAS+L+IG+WEY SRYEGDLVAKCY
Sbjct  102  SQANTSSSSSDVGKRKDARSACASATSEKMKASNFPASLLRIGTWEYASRYEGDLVAKCY  161

Query  609  FAKHKLVWEVLDGGLK  656
            FAKHKLVWEVLDGGLK
Sbjct  162  FAKHKLVWEVLDGGLK  177



>ref|XP_010322653.1| PREDICTED: uncharacterized protein LOC101256298 isoform X2 [Solanum 
lycopersicum]
Length=526

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 121/164 (74%), Gaps = 6/164 (4%)
 Frame = +3

Query  165  TGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPP  344
            TGE   EL WQRGK +PVK EV++++  +EE   L+KR KLSS LQ Q+G G  +F    
Sbjct  8    TGEAPSELRWQRGKMLPVKREVDLENFSDEERCKLDKRFKLSSSLQ-QLGEGACNFTVSS  66

Query  345  VVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKA  524
               +  ++EPSPLGL LRK+PSLLD+ Q  L    M ++ G   KKEQK +++  EKLKA
Sbjct  67   --SFMSVDEPSPLGLRLRKTPSLLDMFQTMLGGTSMVESLG---KKEQKRSTAMIEKLKA  121

Query  525  SNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SNFP S+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  122  SNFPGSVLRIGTWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  165



>gb|EYU24571.1| hypothetical protein MIMGU_mgv1a004911mg [Erythranthe guttata]
Length=504

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 118/171 (69%), Gaps = 10/171 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpl-eeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMKT    PE   ++  A  VK E  V +   EE+HGPL KR K S        + +
Sbjct  1    MVQLMKTAAAEPEPQTEKTAAAAVKTEEVVVEDSLEEQHGPLYKRPKQS--------LEI  52

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSS  503
              F  PP  QYNPL EPSPLGL LRKSPSLL+LIQ++LSQ    K+G +  K  +   SS
Sbjct  53   GGFTVPPS-QYNPLAEPSPLGLRLRKSPSLLELIQLKLSQSTSPKSGAHTKKDSKAGASS  111

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            + +KLKASNFP S+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  112  SVDKLKASNFPGSVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  162



>emb|CBI36579.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 127/180 (71%), Gaps = 14/180 (8%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G + PE +    +  +PVKLE+E     E  HGP NKRSK S+  Q Q   G 
Sbjct  1    MVQLMKSGSLRPERETTPCRDKLPVKLEIEDSLEEE--HGPFNKRSKPSTSYQ-QWSTGN  57

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPGKKE  485
            + +  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG  S  G       NPG K+
Sbjct  58   NAYPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQGNPSNVGCAPNKGPNPGDKK  116

Query  486  Q--KANSST-SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               K N +  ++KLKASNFPAS+L+IG WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  DPGKGNMALGTDKLKASNFPASLLRIGRWEYASRYEGDLVAKCYFAKHKLVWEVLEGGLK  176



>ref|XP_002274694.1| PREDICTED: uncharacterized protein LOC100251901 isoform X1 [Vitis 
vinifera]
Length=553

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 127/180 (71%), Gaps = 14/180 (8%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G + PE +    +  +PVKLE+E     E  HGP NKRSK S+  Q Q   G 
Sbjct  1    MVQLMKSGSLRPERETTPCRDKLPVKLEIEDSLEEE--HGPFNKRSKPSTSYQ-QWSTGN  57

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPGKKE  485
            + +  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG  S  G       NPG K+
Sbjct  58   NAYPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQGNPSNVGCAPNKGPNPGDKK  116

Query  486  Q--KANSST-SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               K N +  ++KLKASNFPAS+L+IG WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  DPGKGNMALGTDKLKASNFPASLLRIGRWEYASRYEGDLVAKCYFAKHKLVWEVLEGGLK  176



>ref|XP_007223233.1| hypothetical protein PRUPE_ppa003793mg [Prunus persica]
 gb|EMJ24432.1| hypothetical protein PRUPE_ppa003793mg [Prunus persica]
Length=548

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 128/179 (72%), Gaps = 16/179 (9%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +MK+G++      ++   VPVKLE+E     E  HGPLNKR K S   Q +  +G +
Sbjct  1    MVHMMKSGDLQTTPCTEK---VPVKLEMEDALEDE--HGPLNKRPKPSPAFQER-SVGDN  54

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-------NPGKKE  485
             F  PP  QYNPL+EPSPLGL LRKSPSLL+LIQM+L+QG  S  G        +  KKE
Sbjct  55   AFAVPPS-QYNPLDEPSPLGLRLRKSPSLLELIQMKLAQGGASTTGAVQSENASSAVKKE  113

Query  486  QKANSS--TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             KA ++  T++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  114  SKATAAVGTTDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  172



>ref|XP_009360003.1| PREDICTED: uncharacterized protein LOC103950506 [Pyrus x bretschneideri]
Length=553

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 128/180 (71%), Gaps = 14/180 (8%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQ-RGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G++  EL      + VPVKLE+E     E  HGPLNKR K S   Q +  +G 
Sbjct  1    MVQLMKSGDLPTELHTMPCTEKVPVKLEIEDSLEEE--HGPLNKRPKPSPAFQER-SVGD  57

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPG-KK  482
            + F   P  QYNPL+EPSPLGL LRKSPSLL+LIQM+L+QG  S  G       N G KK
Sbjct  58   NAFAVQPS-QYNPLDEPSPLGLRLRKSPSLLELIQMKLAQGSASAVGATESKNLNSGVKK  116

Query  483  EQKANS--STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            E KAN+   T +KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  ECKANAPLGTVDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  176



>gb|EYU24572.1| hypothetical protein MIMGU_mgv1a004911mg [Erythranthe guttata]
Length=503

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpl-eeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMKT    PE   ++  A  VK E  V +   EE+HGPL KR K          + +
Sbjct  1    MVQLMKTAAAEPEPQTEKTAAAAVKTEEVVVEDSLEEQHGPLYKRPK---------SLEI  51

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSS  503
              F  PP  QYNPL EPSPLGL LRKSPSLL+LIQ++LSQ    K+G +  K  +   SS
Sbjct  52   GGFTVPPS-QYNPLAEPSPLGLRLRKSPSLLELIQLKLSQSTSPKSGAHTKKDSKAGASS  110

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            + +KLKASNFP S+L+IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  111  SVDKLKASNFPGSVLRIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  161



>ref|XP_008223605.1| PREDICTED: uncharacterized protein LOC103323388 isoform X2 [Prunus 
mume]
Length=543

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 128/179 (72%), Gaps = 16/179 (9%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +MK+G++      ++   VPVKLE+E     E  HGPLNKR K S   Q +  +G +
Sbjct  1    MVHMMKSGDLQTTPCTEK---VPVKLEMEDALEDE--HGPLNKRPKPSPDFQER-SVGDN  54

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-------NPGKKE  485
             F  PP  QYNPL+EPSPLGL LRKSPSLL+LIQM+L+QG  S  G        +  KKE
Sbjct  55   AFAVPPS-QYNPLDEPSPLGLRLRKSPSLLELIQMKLAQGGASTTGAVQSENASSAVKKE  113

Query  486  QKANSS--TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             KA ++  T++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  114  SKATAAVGTTDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  172



>ref|XP_008223604.1| PREDICTED: uncharacterized protein LOC103323388 isoform X1 [Prunus 
mume]
Length=551

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 128/179 (72%), Gaps = 16/179 (9%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +MK+G++      ++   VPVKLE+E     E  HGPLNKR K S   Q +  +G +
Sbjct  1    MVHMMKSGDLQTTPCTEK---VPVKLEMEDALEDE--HGPLNKRPKPSPDFQER-SVGDN  54

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-------NPGKKE  485
             F  PP  QYNPL+EPSPLGL LRKSPSLL+LIQM+L+QG  S  G        +  KKE
Sbjct  55   AFAVPPS-QYNPLDEPSPLGLRLRKSPSLLELIQMKLAQGGASTTGAVQSENASSAVKKE  113

Query  486  QKANSS--TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             KA ++  T++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  114  SKATAAVGTTDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  172



>emb|CDO98250.1| unnamed protein product [Coffea canephora]
Length=510

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 106/135 (79%), Gaps = 4/135 (3%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GPLNKRSK SS LQ   G  V  F   P  QYNPL+EPSPLGL LRKSPSLL+LIQMRL
Sbjct  16   YGPLNKRSKHSSSLQQGSG-EVGGFSVAPPAQYNPLDEPSPLGLRLRKSPSLLELIQMRL  74

Query  438  SQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYF  611
            SQ    K G +  KKE K  A S +SEKLKASNFPA+IL+IG+WEYKSRYEGDLVAKCYF
Sbjct  75   SQANSPK-GASSSKKELKGAAASGSSEKLKASNFPATILRIGTWEYKSRYEGDLVAKCYF  133

Query  612  AKHKLVWEVLDGGLK  656
            AKHKLV EVLDGGLK
Sbjct  134  AKHKLVREVLDGGLK  148



>gb|KJB23595.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=348

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 129/176 (73%), Gaps = 11/176 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM++G    E +  R KA PVKLE+  D   EE HGP+NKRSKLS  LQ     G +
Sbjct  1    MVQLMRSGTPTAEPEACRDKA-PVKLEIVEDSLEEE-HGPVNKRSKLSPNLQQWTYDGNA  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPG-KKEQ  488
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +   +       N G KKE 
Sbjct  59   -FPIPPA-QYNPLDEPSPLGLKLRKSPSLLDLIQMRLSQSQSGSSAAQAESLNSGVKKES  116

Query  489  KANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KA ++T +KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  KAVAAT-DKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>ref|XP_008791339.1| PREDICTED: uncharacterized protein LOC103708273 isoform X2 [Phoenix 
dactylifera]
Length=551

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 104/137 (76%), Gaps = 7/137 (5%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPV-VQYNpleepsplglslRKSPSLLDLIQMR  434
            HG LNKRSK   PLQ     G S    PP  +QYN L EPSPLGL LRKSPSLLDLIQMR
Sbjct  43   HGSLNKRSKTDVPLQQ---WGTSSSVVPPQDLQYNLLNEPSPLGLRLRKSPSLLDLIQMR  99

Query  435  LSQGKMSKAGGNPGKKEQKAN---SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            LSQ   S +  + GKK+   +   S+T+EK+KASNFPAS+L+IG+WEY SRYEGDLVAKC
Sbjct  100  LSQANTSSSSSDVGKKKDARSAGASATTEKMKASNFPASLLRIGTWEYASRYEGDLVAKC  159

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAKHKLVWEVLDGGLK
Sbjct  160  YFAKHKLVWEVLDGGLK  176



>ref|XP_010265510.1| PREDICTED: uncharacterized protein LOC104603232 [Nelumbo nucifera]
Length=548

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 11/178 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LMK+G + PE +      +PVKLE+E     E  HGP+ K+ K+S P Q Q     S
Sbjct  1    MVQLMKSGSIRPESEPPCRNKLPVKLEIEDPLDEE--HGPVEKKPKISPPRQQQWSSESS  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPG--------KK  482
             +  PP  QYNPL+EPSPLGL L+KSPSLLDLIQM+LSQ      GG  G        K 
Sbjct  59   TYPIPPS-QYNPLDEPSPLGLRLKKSPSLLDLIQMKLSQSNAYTLGGGHGENVELGKRKD  117

Query  483  EQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             + A S  ++KLKASNFPAS+L+IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  SKGAVSGATDKLKASNFPASLLRIGTWEYASRYEGDLVAKCYFAKHKLVWEVLEGGLK  175



>ref|XP_010906672.1| PREDICTED: uncharacterized protein LOC105033515 isoform X2 [Elaeis 
guineensis]
Length=551

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 105/136 (77%), Gaps = 5/136 (4%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGPLNKR+K   P+Q Q G   S+   P  ++YN L EPSPLGL LRKSPSLLDLIQMRL
Sbjct  43   HGPLNKRTKADVPVQ-QWGTS-SNMVPPQDLRYNLLNEPSPLGLRLRKSPSLLDLIQMRL  100

Query  438  SQGKMSKAGGNPGKKEQK---ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCY  608
            SQ   S +  + GK++       S+TSEK+KASNFPAS+L+IG+WEY SRYEGDLVAKCY
Sbjct  101  SQANTSSSSSDVGKRKDARSACASATSEKMKASNFPASLLRIGTWEYASRYEGDLVAKCY  160

Query  609  FAKHKLVWEVLDGGLK  656
            FAKHKLVWEVLDGGLK
Sbjct  161  FAKHKLVWEVLDGGLK  176



>ref|XP_011082590.1| PREDICTED: uncharacterized protein LOC105165312 [Sesamum indicum]
Length=531

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/171 (61%), Positives = 120/171 (70%), Gaps = 15/171 (9%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LMK+G+     + Q  K   VK+EVE     E  H PL+KR     P Q   G+G  
Sbjct  1    MVHLMKSGDS----ESQAEKMAAVKMEVEDSLEEE--HAPLHKR-----PRQQNFGLGGF  49

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGN-PGKKEQKANSS  503
                 P  QYNPL EPSPLGL LRKSPSLL+LIQM+LS+   +K G +  GKKE KA ++
Sbjct  50   TV---PASQYNPLNEPSPLGLRLRKSPSLLELIQMKLSESATAKVGSHGHGKKEPKAGAA  106

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            + +KLKASNFP SILKIG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  107  SGDKLKASNFPGSILKIGTWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  157



>gb|KJB23596.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=451

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 129/176 (73%), Gaps = 11/176 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM++G    E +  R KA PVKLE+  D   EE HGP+NKRSKLS  LQ     G +
Sbjct  1    MVQLMRSGTPTAEPEACRDKA-PVKLEIVEDSLEEE-HGPVNKRSKLSPNLQQWTYDGNA  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPG-KKEQ  488
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +   +       N G KKE 
Sbjct  59   -FPIPPA-QYNPLDEPSPLGLKLRKSPSLLDLIQMRLSQSQSGSSAAQAESLNSGVKKES  116

Query  489  KANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KA ++T +KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  KAVAAT-DKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>gb|KHG03368.1| ATP-dependent DNA helicase pcrA [Gossypium arboreum]
Length=540

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 129/176 (73%), Gaps = 11/176 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM++G    E +  R KA PVKLE+  D   EE HGP+NKRSKLS  LQ     G +
Sbjct  1    MVQLMRSGTPTAEPEACRDKA-PVKLEIVEDSLEEE-HGPVNKRSKLSPNLQQWSSDGNA  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPG-KKEQ  488
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +   +       N G KKE 
Sbjct  59   -FPIPPA-QYNPLDEPSPLGLKLRKSPSLLDLIQMRLSQSQSGSSAAQAESLNSGVKKES  116

Query  489  KANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KA ++T +KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  KAVAAT-DKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>gb|KJB23592.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=540

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 129/176 (73%), Gaps = 11/176 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV LM++G    E +  R KA PVKLE+  D   EE HGP+NKRSKLS  LQ     G +
Sbjct  1    MVQLMRSGTPTAEPEACRDKA-PVKLEIVEDSLEEE-HGPVNKRSKLSPNLQQWTYDGNA  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPG-KKEQ  488
             F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +   +       N G KKE 
Sbjct  59   -FPIPPA-QYNPLDEPSPLGLKLRKSPSLLDLIQMRLSQSQSGSSAAQAESLNSGVKKES  116

Query  489  KANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KA ++T +KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  117  KAVAAT-DKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>ref|XP_002309367.2| hypothetical protein POPTR_0006s19420g [Populus trichocarpa]
 gb|EEE92890.2| hypothetical protein POPTR_0006s19420g [Populus trichocarpa]
Length=539

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 109/143 (76%), Gaps = 14/143 (10%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVV--QYNpleepsplglslRKSPSLLDLIQM  431
            +GPL+KRSK S  +Q Q G G +     P+   QYNPL+EPSPLGL LRKSPSLLDLIQM
Sbjct  39   YGPLHKRSKASQTIQ-QWGAGANAI---PITAGQYNPLDEPSPLGLQLRKSPSLLDLIQM  94

Query  432  RLSQGKMSKAGG------NPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            RL+QG  S  G       N G KE K  A SS+ +KLKASNFPASIL+IGSWEYKSRYEG
Sbjct  95   RLTQGNASVLGTQETENLNLGFKESKTAAASSSIDKLKASNFPASILRIGSWEYKSRYEG  154

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAKHKLVWEVL+GGLK
Sbjct  155  DLVAKCYFAKHKLVWEVLEGGLK  177



>ref|XP_011012246.1| PREDICTED: uncharacterized protein LOC105116539 [Populus euphratica]
 ref|XP_011012247.1| PREDICTED: uncharacterized protein LOC105116539 [Populus euphratica]
Length=558

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 109/142 (77%), Gaps = 11/142 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GPL+KRSK S  +Q Q G G +     P  QYNPL+EPSPLGL LRKSPSLLDLIQMRL
Sbjct  39   YGPLHKRSKASQTIQ-QWGAGANAI-PIPAGQYNPLDEPSPLGLQLRKSPSLLDLIQMRL  96

Query  438  SQGKMSKAG------GNPG-KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            +QG  S  G       N G KKE K  A SS+ +KLKASNFPASIL+IGSWEYKSRYEGD
Sbjct  97   TQGNASVLGTQETENSNLGFKKESKTAAASSSIDKLKASNFPASILRIGSWEYKSRYEGD  156

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWEVL+GGLK
Sbjct  157  LVAKCYFAKHKLVWEVLEGGLK  178



>ref|XP_011033365.1| PREDICTED: uncharacterized protein LOC105131880 [Populus euphratica]
Length=558

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 109/142 (77%), Gaps = 11/142 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GPL+KRSK S  +Q Q G G +     P  QYNPL+EPSPLGL LRKSPSLLDLIQMRL
Sbjct  39   YGPLHKRSKASQTIQ-QWGAGANAI-PIPAGQYNPLDEPSPLGLQLRKSPSLLDLIQMRL  96

Query  438  SQGKMSKAG------GNPG-KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            +QG  S  G       N G KKE K  A SS+ +KLKASNFPASIL+IGSWEYKSRYEGD
Sbjct  97   TQGNASVLGTQETENSNLGFKKESKTAAASSSIDKLKASNFPASILRIGSWEYKSRYEGD  156

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWEVL+GGLK
Sbjct  157  LVAKCYFAKHKLVWEVLEGGLK  178



>ref|XP_010927928.1| PREDICTED: uncharacterized protein LOC105049857 isoform X1 [Elaeis 
guineensis]
Length=572

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 123/182 (68%), Gaps = 15/182 (8%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGK---------AVPVKlevevddpleeeHGPLNKRSKLSSPL  299
            MV L   G + PE +    +         AVPVKLE+E     +  HGPLNK+SK+++PL
Sbjct  1    MVRLTNFGNLRPESEMPNKEVAMEAPPPTAVPVKLEIEDPLDDK--HGPLNKKSKVTAPL  58

Query  300  QHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGK  479
             HQ     ++      +Q N L+EPSPLGL LRKSPSL+DLIQMRLSQ   S    + GK
Sbjct  59   -HQQWNTSANMVASQALQCNLLDEPSPLGLRLRKSPSLVDLIQMRLSQPNTSGESSDVGK  117

Query  480  KEQK---ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGG  650
            K+       S+T++K+KASNFPAS+L+IG+WEY S YEGDLVAKCYFAKHKLVWE+LDGG
Sbjct  118  KKVARCIGASATTDKMKASNFPASLLRIGAWEYASAYEGDLVAKCYFAKHKLVWEILDGG  177

Query  651  LK  656
            LK
Sbjct  178  LK  179



>ref|XP_009396105.1| PREDICTED: uncharacterized protein LOC103981195 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=525

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 107/144 (74%), Gaps = 12/144 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSP-LQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMR  434
            HGPLNKR K++ P LQ Q G G  D      VQY+ L+EPSPLGL LRKSPSLLDLIQMR
Sbjct  46   HGPLNKRPKVADPHLQQQWGTG-KDMPLTEGVQYDLLDEPSPLGLRLRKSPSLLDLIQMR  104

Query  435  LSQGK-------MSKAG-GNPGKKEQKANSS--TSEKLKASNFPASILKIGSWEYKSRYE  584
            LSQ         M   G G+   KE +++S+  T+EK+KASNFPASIL+IGSWEY SRYE
Sbjct  105  LSQANAAVTSHSMENEGLGDEKNKETRSSSALATTEKMKASNFPASILRIGSWEYVSRYE  164

Query  585  GDLVAKCYFAKHKLVWEVLDGGLK  656
            GDLVAKCYFAK KLVWE+L+GGLK
Sbjct  165  GDLVAKCYFAKRKLVWEILEGGLK  188



>ref|XP_004144718.1| PREDICTED: uncharacterized protein LOC101216574 [Cucumis sativus]
 gb|KGN61066.1| hypothetical protein Csa_2G036640 [Cucumis sativus]
Length=532

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 123/181 (68%), Gaps = 15/181 (8%)
 Frame = +3

Query  147  MVFLMKTGE--MAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV LMK+G   + P++   R K VPVKLE+E     +  HGP  KR K  +    Q   G
Sbjct  1    MVQLMKSGNHSLEPDMASFRDK-VPVKLEIEDSLEED--HGPFPKRLKTVTTDSPQQSDG  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAG-------GNPGK  479
              DF  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQ   + +         +  K
Sbjct  58   NDDFAVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQSTAASSDVAECESFNSSLK  116

Query  480  KEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
            KE K     S+++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWE+L+GGL
Sbjct  117  KENKGTVIPSSTDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEILEGGL  176

Query  654  K  656
            K
Sbjct  177  K  177



>ref|XP_004166179.1| PREDICTED: uncharacterized LOC101216574 [Cucumis sativus]
Length=540

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 123/181 (68%), Gaps = 15/181 (8%)
 Frame = +3

Query  147  MVFLMKTGE--MAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV LMK+G   + P++   R K VPVKLE+E     +  HGP  KR K  +    Q   G
Sbjct  1    MVQLMKSGNHSLEPDMASFRDK-VPVKLEIEDSLEED--HGPFPKRLKTVTTDSPQQSDG  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAG-------GNPGK  479
              DF  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQ   + +         +  K
Sbjct  58   NDDFAVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQSTAASSDVAECESFNSSLK  116

Query  480  KEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
            KE K     S+++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWE+L+GGL
Sbjct  117  KENKGTVIPSSTDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEILEGGL  176

Query  654  K  656
            K
Sbjct  177  K  177



>ref|XP_004309859.1| PREDICTED: uncharacterized protein LOC101299924 [Fragaria vesca 
subsp. vesca]
Length=547

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 127/180 (71%), Gaps = 18/180 (10%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI-GV  323
            MV LM +G++      +    VPVKLE+E     E  HGPLNKRS+ S   Q + G  GV
Sbjct  1    MVQLMSSGDLRQTTPCK--DKVPVKLEIEDSLEEE--HGPLNKRSRPSFAYQERSGDNGV  56

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPG-KK  482
            +     P  QYNPL+EPSPLGL LRKSPSLL+LIQM+L+QG    AG       N G KK
Sbjct  57   A----VPTSQYNPLDEPSPLGLRLRKSPSLLELIQMKLAQGVPPTAGAVQREYLNSGVKK  112

Query  483  EQKANSST--SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            E K N++   ++KLKASNFPAS+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  113  EIKGNAAVGATDKLKASNFPASMLRIGNWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  172



>ref|XP_008452508.1| PREDICTED: uncharacterized protein LOC103493516 [Cucumis melo]
Length=532

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 124/181 (69%), Gaps = 15/181 (8%)
 Frame = +3

Query  147  MVFLMKTGE--MAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV LMK+G   + P++   R K VPVKLE+E     E  HGP  KR K  + +  Q   G
Sbjct  1    MVQLMKSGSRSLDPDMASYRDK-VPVKLEIEDSLEEE--HGPFPKRLKTVTTVSPQQSDG  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAG-------GNPGK  479
              DF  PP  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQ   + +         +  +
Sbjct  58   NDDFPVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQSTAASSDVAECESFNSSLR  116

Query  480  KEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
            KE K     ++++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWE+L+GGL
Sbjct  117  KENKGTIIPASTDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEILEGGL  176

Query  654  K  656
            K
Sbjct  177  K  177



>ref|XP_009396106.1| PREDICTED: uncharacterized protein LOC103981195 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=524

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 105/143 (73%), Gaps = 11/143 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGPLNKR K++ P   Q G G  D      VQY+ L+EPSPLGL LRKSPSLLDLIQMRL
Sbjct  46   HGPLNKRPKVADPHLQQWGTG-KDMPLTEGVQYDLLDEPSPLGLRLRKSPSLLDLIQMRL  104

Query  438  SQGK-------MSKAG-GNPGKKEQKANSS--TSEKLKASNFPASILKIGSWEYKSRYEG  587
            SQ         M   G G+   KE +++S+  T+EK+KASNFPASIL+IGSWEY SRYEG
Sbjct  105  SQANAAVTSHSMENEGLGDEKNKETRSSSALATTEKMKASNFPASILRIGSWEYVSRYEG  164

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAK KLVWE+L+GGLK
Sbjct  165  DLVAKCYFAKRKLVWEILEGGLK  187



>ref|XP_010268524.1| PREDICTED: uncharacterized protein LOC104605439 [Nelumbo nucifera]
Length=560

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 121/178 (68%), Gaps = 11/178 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV  M +G++ PE +      +PVKLE++     E  HGPL K+ K+  P Q Q   G S
Sbjct  1    MVQPMNSGDIRPESEASCRNKLPVKLEIQDTLDEE--HGPLEKKPKIPPPNQQQWSSGSS  58

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKK---EQKAN  497
                PP  QYNPL+EPSPLGL L+KSPSLLDLIQM+LSQG     G  P +    ++K +
Sbjct  59   ACPIPPS-QYNPLDEPSPLGLRLKKSPSLLDLIQMKLSQGNAHTLGDGPSEHLELDKKMD  117

Query  498  S-----STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            S       ++KLKASNFPAS+L+IG+WE  SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  SKGPASGATDKLKASNFPASLLRIGTWECVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  175



>ref|XP_009336662.1| PREDICTED: uncharacterized protein LOC103929234 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336663.1| PREDICTED: uncharacterized protein LOC103929234 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336664.1| PREDICTED: uncharacterized protein LOC103929234 isoform X1 [Pyrus 
x bretschneideri]
Length=555

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 129/181 (71%), Gaps = 14/181 (8%)
 Frame = +3

Query  147  MVFLMKTGEMAPELD-WQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQH-QVGIG  320
            MV LMK+G+  PE       + VPVKLEVE     E  HGPLNKRSK S   Q  Q  IG
Sbjct  1    MVQLMKSGDFGPETHAIPCTEKVPVKLEVEESLEEE--HGPLNKRSKPSPAFQELQRSIG  58

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPG-K  479
             + F  PP  Q+NPL+EPSPLGL LRKSPSLL+LIQM+L+QG  + AG       N G K
Sbjct  59   DNVFAVPPS-QFNPLDEPSPLGLRLRKSPSLLELIQMKLAQGSAAAAGATQIENLNSGVK  117

Query  480  KEQKANS--STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
            KE K N+   T++KLKASNFPAS+L IGSWEYKSRYEGDLVAKCYFAKHKLVWEVL+ GL
Sbjct  118  KECKVNAPLGTADKLKASNFPASLLSIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLEVGL  177

Query  654  K  656
            K
Sbjct  178  K  178



>ref|XP_007013890.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31509.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=544

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 128/178 (72%), Gaps = 11/178 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAV---PVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            MV LM++G + PE + +        PVKLE+  D   EE HGPL+KRSK S  LQ Q   
Sbjct  1    MVQLMRSGNLRPEPEPETTSCRDKPPVKLEIVEDTLEEE-HGPLSKRSKASPNLQ-QWNS  58

Query  318  GVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPGKK  482
             V+ F  PP + YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ + S +       + G K
Sbjct  59   DVNAFPIPPSL-YNPLDEPSPLGLRLRKSPSLLDLIQMRLSQSQSSSSAAEAENLSSGVK  117

Query  483  EQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            ++   + T++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  KEAKAAVTTDKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  175



>ref|XP_007013889.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31508.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=552

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 128/178 (72%), Gaps = 11/178 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAV---PVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            MV LM++G + PE + +        PVKLE+  D   EE HGPL+KRSK S  LQ Q   
Sbjct  1    MVQLMRSGNLRPEPEPETTSCRDKPPVKLEIVEDTLEEE-HGPLSKRSKASPNLQ-QWNS  58

Query  318  GVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPGKK  482
             V+ F  PP + YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ + S +       + G K
Sbjct  59   DVNAFPIPPSL-YNPLDEPSPLGLRLRKSPSLLDLIQMRLSQSQSSSSAAEAENLSSGVK  117

Query  483  EQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            ++   + T++KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  118  KEAKAAVTTDKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  175



>ref|XP_009336665.1| PREDICTED: uncharacterized protein LOC103929234 isoform X2 [Pyrus 
x bretschneideri]
Length=553

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 129/180 (72%), Gaps = 14/180 (8%)
 Frame = +3

Query  147  MVFLMKTGEMAPELD-WQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G+  PE       + VPVKLEVE     E  HGPLNKRSK S   Q +  IG 
Sbjct  1    MVQLMKSGDFGPETHAIPCTEKVPVKLEVEESLEEE--HGPLNKRSKPSPAFQER-SIGD  57

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPG-KK  482
            + F  PP  Q+NPL+EPSPLGL LRKSPSLL+LIQM+L+QG  + AG       N G KK
Sbjct  58   NVFAVPPS-QFNPLDEPSPLGLRLRKSPSLLELIQMKLAQGSAAAAGATQIENLNSGVKK  116

Query  483  EQKANS--STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            E K N+   T++KLKASNFPAS+L IGSWEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  117  ECKVNAPLGTADKLKASNFPASLLSIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLEVGLK  176



>ref|XP_011073225.1| PREDICTED: uncharacterized protein LOC105158248 [Sesamum indicum]
Length=536

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 102/134 (76%), Gaps = 9/134 (7%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGPL+KR     P Q   G+G       P   YNPL+EPSPLGL LRKSPSLL+LIQM+L
Sbjct  37   HGPLHKR-----PKQQNFGLGGFTV---PASGYNPLDEPSPLGLRLRKSPSLLELIQMKL  88

Query  438  SQGKMSKAGGNP-GKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
            SQ    K G +  GK++   ++++ EKLKA+NFPASIL+IG+WEYKSRYEGDLVAKCYFA
Sbjct  89   SQSSSPKVGSHAHGKRQPTGSAASGEKLKAANFPASILRIGTWEYKSRYEGDLVAKCYFA  148

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVLDGGLK
Sbjct  149  KHKLVWEVLDGGLK  162



>gb|KCW78806.1| hypothetical protein EUGRSUZ_C00240 [Eucalyptus grandis]
Length=537

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 129/190 (68%), Gaps = 26/190 (14%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA------------VPVKlevevddpleeeHGPLNKRSKLS  290
            MV LMK+G+   +    RG A            +PVKLE+  D   EE  GPL+KRSK S
Sbjct  1    MVQLMKSGDFGAD----RGAAPCGGGGGGGEKKLPVKLEIVEDPLEEE-FGPLSKRSKGS  55

Query  291  SPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-  467
            S L+   G G + F   P  +YNPL+EPSPLGL LRKSPSLLDLIQM+LSQG  + A   
Sbjct  56   SGLEQLWGAGANAFPVQPS-EYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGTCNLATTQ  114

Query  468  -----NPGKKEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKL  626
                 +   K+ K+N  SST++K+KASNFPAS L+IG WEYKSRYEGDLVAKCYFAKHKL
Sbjct  115  SDNLVHETNKDGKSNASSSTTDKMKASNFPASHLRIGRWEYKSRYEGDLVAKCYFAKHKL  174

Query  627  VWEVLDGGLK  656
            VWEVL+GGLK
Sbjct  175  VWEVLEGGLK  184



>ref|XP_010047053.1| PREDICTED: uncharacterized protein LOC104436016 [Eucalyptus grandis]
 gb|KCW78805.1| hypothetical protein EUGRSUZ_C00240 [Eucalyptus grandis]
Length=545

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 129/190 (68%), Gaps = 26/190 (14%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA------------VPVKlevevddpleeeHGPLNKRSKLS  290
            MV LMK+G+   +    RG A            +PVKLE+  D   EE  GPL+KRSK S
Sbjct  1    MVQLMKSGDFGAD----RGAAPCGGGGGGGEKKLPVKLEIVEDPLEEE-FGPLSKRSKGS  55

Query  291  SPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-  467
            S L+   G G + F   P  +YNPL+EPSPLGL LRKSPSLLDLIQM+LSQG  + A   
Sbjct  56   SGLEQLWGAGANAFPVQPS-EYNPLDEPSPLGLRLRKSPSLLDLIQMKLSQGTCNLATTQ  114

Query  468  -----NPGKKEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKL  626
                 +   K+ K+N  SST++K+KASNFPAS L+IG WEYKSRYEGDLVAKCYFAKHKL
Sbjct  115  SDNLVHETNKDGKSNASSSTTDKMKASNFPASHLRIGRWEYKSRYEGDLVAKCYFAKHKL  174

Query  627  VWEVLDGGLK  656
            VWEVL+GGLK
Sbjct  175  VWEVLEGGLK  184



>ref|XP_002324519.2| hypothetical protein POPTR_0018s11180g [Populus trichocarpa]
 gb|EEF03084.2| hypothetical protein POPTR_0018s11180g [Populus trichocarpa]
Length=561

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 110/145 (76%), Gaps = 16/145 (11%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPV--VQYNpleepsplglslRKSPSLLDLIQM  431
            +GPL+KRSK S  +Q Q G G +     PV   +YNPL+EPSPLGL LRKSPSLLDLIQM
Sbjct  41   YGPLHKRSKASQTIQ-QWGAGANAV---PVSAAEYNPLDEPSPLGLQLRKSPSLLDLIQM  96

Query  432  RLSQGKMSKAGG-------NPG-KKEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRY  581
            RL+QG  + A G       N G KKE K+   S + +KLKASNFPASIL+IGSWEYKSRY
Sbjct  97   RLTQGNNASALGTQQTEKQNLGVKKESKSAPASGSMDKLKASNFPASILRIGSWEYKSRY  156

Query  582  EGDLVAKCYFAKHKLVWEVLDGGLK  656
            EGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  157  EGDLVAKCYFAKHKLVWEVLEGGLK  181



>ref|XP_010111118.1| hypothetical protein L484_008495 [Morus notabilis]
 gb|EXC30164.1| hypothetical protein L484_008495 [Morus notabilis]
Length=534

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 123/183 (67%), Gaps = 20/183 (11%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAV----PVKlevevddpleeeHGPLNKRSKLSSPLQHQVG  314
            MV LM +G+   E   Q   A     PVKLE+E     E  HGP+ KR K +SP   + G
Sbjct  1    MVQLMTSGDFRSE---QETAACTDKPPVKLEIEDSLEDE--HGPVTKRPK-ASPAFQEWG  54

Query  315  IGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPG------  476
               S+    P  QYNPL+EPSPLGL LRKSPSLLDLIQM+LSQG  S  G          
Sbjct  55   -AESNGYSVPASQYNPLDEPSPLGLKLRKSPSLLDLIQMKLSQGGPSTLGAAQTGSVTAG  113

Query  477  -KKEQKANS--STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDG  647
             KKE KAN+   +++KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+G
Sbjct  114  VKKENKANAPVGSADKLKASNFPASLLRIGCWEYKSRYEGDLVAKCYFAKHKLVWEVLEG  173

Query  648  GLK  656
            GLK
Sbjct  174  GLK  176



>ref|XP_006845397.1| hypothetical protein AMTR_s00019p00062450 [Amborella trichopoda]
 gb|ERN07072.1| hypothetical protein AMTR_s00019p00062450 [Amborella trichopoda]
Length=557

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 103/143 (72%), Gaps = 12/143 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSPL-QHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMR  434
            HG +NKR+KL SPL Q Q  +  S   +     YN L EPSPLGL LRKSPSLLDLIQMR
Sbjct  44   HGSVNKRAKLGSPLKQQQWSMSPSTCEQ--TSYYNLLNEPSPLGLRLRKSPSLLDLIQMR  101

Query  435  LSQGKMSKAGGNP------GKKEQK---ANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            LSQG ++  G          KK+ K   A+ ST++KLKASNFPASIL+IG+WE  SRYEG
Sbjct  102  LSQGDITVGGAESHGKLELAKKDTKCATASVSTADKLKASNFPASILRIGNWECISRYEG  161

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAKHKLVWEVLDG LK
Sbjct  162  DLVAKCYFAKHKLVWEVLDGSLK  184



>ref|XP_010094072.1| hypothetical protein L484_018088 [Morus notabilis]
 gb|EXB55162.1| hypothetical protein L484_018088 [Morus notabilis]
Length=518

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 116/172 (67%), Gaps = 10/172 (6%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV  + + E+A  +  +  K  PVK E++      E   PL+KR+KL S  Q+    G+ 
Sbjct  1    MVHFI-SSELAETMKAKGSKKAPVKPEIDDSSEPLE---PLHKRTKLDSSPQN---TGIE  53

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN--S  500
             F  P  + YNPL+EPSPLGL LRKSPSLLDLIQM+LSQ   +    N  KK  K N  S
Sbjct  54   TFAIPSSI-YNPLDEPSPLGLRLRKSPSLLDLIQMKLSQDSAAAKLANLSKKNHKGNAVS  112

Query  501  STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               +KLKASNFPAS+L IG+W+YKSRYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  113  GAPDKLKASNFPASVLNIGTWQYKSRYEGDLVAKCYFAKHKLVWEVLDGSLK  164



>ref|XP_011018078.1| PREDICTED: uncharacterized protein LOC105121219 [Populus euphratica]
Length=561

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 109/145 (75%), Gaps = 16/145 (11%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPV--VQYNpleepsplglslRKSPSLLDLIQM  431
            +G L+KRSK S  +Q Q G G +     PV   +YNPL+EPSPLGL LRKSPSLLDLIQM
Sbjct  41   YGTLHKRSKASQTIQ-QWGAGANAV---PVSAAEYNPLDEPSPLGLQLRKSPSLLDLIQM  96

Query  432  RLSQGKMSKAGG-------NPG-KKEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRY  581
            RL+QG  + A G       N G KKE K+   S + +KLKASNFPASIL+IGSWEYKSRY
Sbjct  97   RLTQGNNASALGTQEAEKQNLGVKKESKSAPASGSMDKLKASNFPASILRIGSWEYKSRY  156

Query  582  EGDLVAKCYFAKHKLVWEVLDGGLK  656
            EGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  157  EGDLVAKCYFAKHKLVWEVLEGGLK  181



>ref|XP_007023516.1| Uncharacterized protein TCM_027550 [Theobroma cacao]
 gb|EOY26138.1| Uncharacterized protein TCM_027550 [Theobroma cacao]
Length=526

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 102/134 (76%), Gaps = 5/134 (4%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
             PL+KRSKL   LQ +  I   DF  PP + YNPL+EPSPLGL L+KSPS LDLIQM+LS
Sbjct  26   APLHKRSKLDPSLQ-EGNIESGDFPIPPSL-YNPLDEPSPLGLRLKKSPSFLDLIQMKLS  83

Query  441  QGKMSKAGGNPGKKEQKANSSTS--EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
            Q   +K      KK+ K  S +   +KLKASNFPAS+L+IGSWEYKSRYEGDLVAKCYFA
Sbjct  84   QQNANKLTA-LKKKDSKGTSVSCGQDKLKASNFPASVLRIGSWEYKSRYEGDLVAKCYFA  142

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVLDGGLK
Sbjct  143  KHKLVWEVLDGGLK  156



>gb|KDP41944.1| hypothetical protein JCGZ_26962 [Jatropha curcas]
Length=507

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 97/132 (73%), Gaps = 14/132 (11%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GPL+KR KL S LQ            P    YNPLEEPSPLGL L+KSPSLLDLIQM+LS
Sbjct  23   GPLHKRFKLDSSLQMI----------PASSLYNPLEEPSPLGLRLKKSPSLLDLIQMKLS  72

Query  441  QGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
            QG  +K       K    + + ++KLKASNFPASILKIG+WEYKSRYEGDLVAKCYFAKH
Sbjct  73   QGNNTKTDN----KITGGSITATDKLKASNFPASILKIGNWEYKSRYEGDLVAKCYFAKH  128

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDGGLK
Sbjct  129  KLVWEVLDGGLK  140



>ref|XP_006493461.1| PREDICTED: uncharacterized protein LOC102624004 isoform X1 [Citrus 
sinensis]
Length=510

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 99/132 (75%), Gaps = 6/132 (5%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GPL KRSKL      +     + F+ PP + YNPLEEPSPLGL L+K+PS LDLI+M+LS
Sbjct  26   GPLKKRSKLKEDCDSET----TSFQFPPSM-YNPLEEPSPLGLRLKKTPSFLDLIEMKLS  80

Query  441  QGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
            Q   SK      KK   A S +++KLKASNFP S+LKIGSWEYKSRYEGDLVAKCYFAKH
Sbjct  81   QENASKLA-KLSKKRGNAVSGSADKLKASNFPGSLLKIGSWEYKSRYEGDLVAKCYFAKH  139

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDGGLK
Sbjct  140  KLVWEVLDGGLK  151



>ref|XP_006427676.1| hypothetical protein CICLE_v10027000mg [Citrus clementina]
 gb|ESR40916.1| hypothetical protein CICLE_v10027000mg [Citrus clementina]
Length=510

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 99/132 (75%), Gaps = 6/132 (5%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GPL KRSKL      +     + F+ PP + YNPLEEPSPLGL L+K+PS LDLI+M+LS
Sbjct  26   GPLKKRSKLKEDCDSET----TSFQFPPSM-YNPLEEPSPLGLRLKKTPSFLDLIEMKLS  80

Query  441  QGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
            Q   S+      KK   A S +++KLKASNFP S+LKIGSWEYKSRYEGDLVAKCYFAKH
Sbjct  81   QENASRLA-KLSKKRGNAVSGSADKLKASNFPGSLLKIGSWEYKSRYEGDLVAKCYFAKH  139

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDGGLK
Sbjct  140  KLVWEVLDGGLK  151



>emb|CDY23256.1| BnaA08g12900D [Brassica napus]
Length=539

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 97/135 (72%), Gaps = 25/135 (19%)
 Frame = +3

Query  258  HGPLNKRSKL--SSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            HGPLNKRSKL  SSP+                 +Y+P + PSPLGLSLRKSPSLLDLIQM
Sbjct  30   HGPLNKRSKLWSSSPMA--------------PAKYSPFDGPSPLGLSLRKSPSLLDLIQM  75

Query  432  RLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYF  611
            RL+Q    KAGG+ G         + EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYF
Sbjct  76   RLTQSGDPKAGGSGG---------SIEKLKASNFPASVLKIGQWEYKSRYEGDLVAKCYF  126

Query  612  AKHKLVWEVLDGGLK  656
            AKHKLVWEVL+ GLK
Sbjct  127  AKHKLVWEVLERGLK  141



>ref|XP_009108969.1| PREDICTED: uncharacterized protein LOC103834656 [Brassica rapa]
Length=559

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 101/143 (71%), Gaps = 24/143 (17%)
 Frame = +3

Query  258  HGPLNKRSKL--SSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            HGPLNKRSKL  SSP+                 +Y+P + PSPLGLSLRKSPSLLDLIQM
Sbjct  33   HGPLNKRSKLWSSSPMA--------------PAKYSPFDGPSPLGLSLRKSPSLLDLIQM  78

Query  432  RLSQGKMSKAGGNPG-KKEQKANSSTS-------EKLKASNFPASILKIGSWEYKSRYEG  587
            RL+Q    KAGG+ G   E K  ++ S       EKLKASNFPAS+LKIG WEYKSRYEG
Sbjct  79   RLTQSGDPKAGGSGGVNHESKCITAGSNLGPGSIEKLKASNFPASVLKIGQWEYKSRYEG  138

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAKHKLVWEVL+ GLK
Sbjct  139  DLVAKCYFAKHKLVWEVLERGLK  161



>ref|XP_010525794.1| PREDICTED: uncharacterized protein LOC104803550 isoform X4 [Tarenaya 
hassleriana]
Length=519

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 117/181 (65%), Gaps = 21/181 (12%)
 Frame = +3

Query  144  LMVFLMKTGEMAPELDWQRG--KAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            +M  +  TG + PEL+         PVKLE+  D   EE +G L+KRSK+  P  HQ   
Sbjct  1    MMELMKSTGNLKPELETATKCRDEFPVKLEIAEDFLEEE-YGALSKRSKIY-PSFHQETY  58

Query  318  GVSDFREP-PVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA  494
             +     P    QYNPL+EPSPLGLSLRKSPS LDLIQMRL+QG         GKK  K+
Sbjct  59   SIDTMAFPLQTTQYNPLDEPSPLGLSLRKSPSFLDLIQMRLAQG---------GKKNSKS  109

Query  495  NSS-------TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
             SS        +EKLKASNFPAS L+IG WEYKSRYEGDL+AKCYFAKHKLVWEVL  GL
Sbjct  110  ASSEAGPSLGAAEKLKASNFPASFLRIGQWEYKSRYEGDLIAKCYFAKHKLVWEVLQHGL  169

Query  654  K  656
            K
Sbjct  170  K  170



>ref|XP_010525793.1| PREDICTED: uncharacterized protein LOC104803550 isoform X3 [Tarenaya 
hassleriana]
Length=525

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 117/181 (65%), Gaps = 21/181 (12%)
 Frame = +3

Query  144  LMVFLMKTGEMAPELDWQRG--KAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            +M  +  TG + PEL+         PVKLE+  D   EE +G L+KRSK+  P  HQ   
Sbjct  1    MMELMKSTGNLKPELETATKCRDEFPVKLEIAEDFLEEE-YGALSKRSKIY-PSFHQETY  58

Query  318  GVSDFREP-PVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA  494
             +     P    QYNPL+EPSPLGLSLRKSPS LDLIQMRL+QG         GKK  K+
Sbjct  59   SIDTMAFPLQTTQYNPLDEPSPLGLSLRKSPSFLDLIQMRLAQG---------GKKNSKS  109

Query  495  NSS-------TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
             SS        +EKLKASNFPAS L+IG WEYKSRYEGDL+AKCYFAKHKLVWEVL  GL
Sbjct  110  ASSEAGPSLGAAEKLKASNFPASFLRIGQWEYKSRYEGDLIAKCYFAKHKLVWEVLQHGL  169

Query  654  K  656
            K
Sbjct  170  K  170



>ref|XP_009127531.1| PREDICTED: uncharacterized protein LOC103852376 [Brassica rapa]
 emb|CDY28214.1| BnaA01g06350D [Brassica napus]
Length=572

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 123/182 (68%), Gaps = 22/182 (12%)
 Frame = +3

Query  147  MVFLMKTGEMAP--ELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV + K+G   P  EL  +    +PVKLE+  DD  E  HGPLNKRSKL S       + 
Sbjct  1    MVEMRKSGVTKPDSELASKCRDELPVKLEIAEDDLEEA-HGPLNKRSKLWSSGTSSSSMA  59

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS  500
             +        +YNPL+EPSPLGLSLRKSPSLLDLIQMRL+Q K + A G+  KKE K  +
Sbjct  60   PA--------KYNPLDEPSPLGLSLRKSPSLLDLIQMRLTQ-KAADAVGSGVKKESKCIT  110

Query  501  STS----------EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGG  650
            + S          EKLKASNFPA++LKIG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ G
Sbjct  111  AASAGATLASGSIEKLKASNFPATVLKIGKWEYKSRYEGDLVAKCYFAKHKLVWEVLEQG  170

Query  651  LK  656
            LK
Sbjct  171  LK  172



>ref|XP_010525791.1| PREDICTED: uncharacterized protein LOC104803550 isoform X1 [Tarenaya 
hassleriana]
Length=527

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 117/181 (65%), Gaps = 21/181 (12%)
 Frame = +3

Query  144  LMVFLMKTGEMAPELDWQRG--KAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            +M  +  TG + PEL+         PVKLE+  D   EE +G L+KRSK+  P  HQ   
Sbjct  1    MMELMKSTGNLKPELETATKCRDEFPVKLEIAEDFLEEE-YGALSKRSKIY-PSFHQETY  58

Query  318  GVSDFREP-PVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA  494
             +     P    QYNPL+EPSPLGLSLRKSPS LDLIQMRL+QG         GKK  K+
Sbjct  59   SIDTMAFPLQTTQYNPLDEPSPLGLSLRKSPSFLDLIQMRLAQG---------GKKNSKS  109

Query  495  NSS-------TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
             SS        +EKLKASNFPAS L+IG WEYKSRYEGDL+AKCYFAKHKLVWEVL  GL
Sbjct  110  ASSEAGPSLGAAEKLKASNFPASFLRIGQWEYKSRYEGDLIAKCYFAKHKLVWEVLQHGL  169

Query  654  K  656
            K
Sbjct  170  K  170



>ref|XP_009623108.1| PREDICTED: uncharacterized protein LOC104114385 [Nicotiana tomentosiformis]
Length=532

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 102/143 (71%), Gaps = 13/143 (9%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQ-HQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMR  434
            + PL KR K S  LQ +Q   G ++F  PP  +YNPL+EPSPLGL LRKSPSLLDLIQMR
Sbjct  27   YAPLTKRPKFS--LQVNQWNAGNNEFPVPPP-EYNPLDEPSPLGLRLRKSPSLLDLIQMR  83

Query  435  LSQGKMSKAGGNPG-------KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            LSQ   S     P        KKE +  A S  ++KLKASNF  S+L+IGSWEY SRYEG
Sbjct  84   LSQNNASSVAPTPAENSTAVSKKETRGVATSGATDKLKASNFSGSLLRIGSWEYASRYEG  143

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAKHKLVWE+L+GGLK
Sbjct  144  DLVAKCYFAKHKLVWEILEGGLK  166



>gb|KFK29655.1| hypothetical protein AALP_AA7G161600 [Arabis alpina]
Length=584

 Score =   134 bits (337),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 122/187 (65%), Gaps = 26/187 (14%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDW---QRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            MV + K+G M PE +    +R   +PVKLE+  DD  E  HGPLNKRSKL S        
Sbjct  1    MVEMRKSGGMRPESELTANKRRDELPVKLEIVEDDLEEV-HGPLNKRSKLWSS-------  52

Query  318  GVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPG---KKEQ  488
            G S     P  +YNPL+EPSPLGL+LRKSPSLLDLIQMRL+Q    +A        KKE 
Sbjct  53   GTSSSVMAPA-KYNPLDEPSPLGLNLRKSPSLLDLIQMRLTQSGDPRAETLQAVGVKKES  111

Query  489  KANSSTS-----------EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWE  635
            K   + S           EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFAKHKLVWE
Sbjct  112  KGIVAASVGGAALAPGSIEKLKASNFPASVLKIGQWEYKSRYEGDLVAKCYFAKHKLVWE  171

Query  636  VLDGGLK  656
            VL+ GLK
Sbjct  172  VLEQGLK  178



>ref|XP_009418538.1| PREDICTED: uncharacterized protein LOC103998710 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 120/180 (67%), Gaps = 19/180 (11%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV L   G++ PE +     ++P+  ++E++DPLE+EHGPLNKRSK         G G S
Sbjct  1    MVQLTNHGKLRPESELPMKMSLPLATKLEIEDPLEDEHGPLNKRSK--------CGTGES  52

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAG---GNPGKKEQKAN  497
                  V+Q N L EPSPLGL LRKSPSL+DLIQMRLSQ   +       +   + +K N
Sbjct  53   -MPLTEVIQNNLLNEPSPLGLRLRKSPSLVDLIQMRLSQANAAANSCILNDENLENEKKN  111

Query  498  SSTS-------EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             + S       EKLKASNFPAS+L+IG+WEY SRYEGDLVAKCYFAK KLVWE+L+GGLK
Sbjct  112  DTRSTIALANTEKLKASNFPASLLRIGTWEYVSRYEGDLVAKCYFAKRKLVWEILEGGLK  171



>gb|AFW76588.1| hypothetical protein ZEAMMB73_647105 [Zea mays]
Length=215

 Score =   129 bits (323),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  SS  E+LKASNFPA+ILK
Sbjct  80   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDSKSGVSSAGERLKASNFPANILK  139

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  140  IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_010927929.1| PREDICTED: uncharacterized protein LOC105049857 isoform X2 [Elaeis 
guineensis]
Length=565

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 117/182 (64%), Gaps = 22/182 (12%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGK---------AVPVKlevevddpleeeHGPLNKRSKLSSPL  299
            MV L   G + PE +    +         AVPVKLE+E     +  HGPLNK+SK  +  
Sbjct  1    MVRLTNFGNLRPESEMPNKEVAMEAPPPTAVPVKLEIEDPLDDK--HGPLNKKSKQWNTS  58

Query  300  QHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGK  479
             + V            +Q N L+EPSPLGL LRKSPSL+DLIQMRLSQ   S    + GK
Sbjct  59   ANMVA--------SQALQCNLLDEPSPLGLRLRKSPSLVDLIQMRLSQPNTSGESSDVGK  110

Query  480  KEQK---ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGG  650
            K+       S+T++K+KASNFPAS+L+IG+WEY S YEGDLVAKCYFAKHKLVWE+LDGG
Sbjct  111  KKVARCIGASATTDKMKASNFPASLLRIGAWEYASAYEGDLVAKCYFAKHKLVWEILDGG  170

Query  651  LK  656
            LK
Sbjct  171  LK  172



>ref|XP_009800570.1| PREDICTED: uncharacterized protein LOC104246459 [Nicotiana sylvestris]
Length=532

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 99/142 (70%), Gaps = 11/142 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GPL KR K SS   +Q   G ++F  PP  +YNPL+EPSPLGL LRKSPSLLDLIQMRL
Sbjct  27   YGPLTKRPK-SSLQVNQWNAGNNEFPVPPP-EYNPLDEPSPLGLRLRKSPSLLDLIQMRL  84

Query  438  SQGKMSKAGGNPGKKEQK---------ANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            SQ   S     P +             A S  ++KLKASNF  S+L+IGSWEY SRYEGD
Sbjct  85   SQNNASSVAPTPAENSTAVSKKGTRGAATSGATDKLKASNFSGSLLRIGSWEYASRYEGD  144

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWE+L+GGLK
Sbjct  145  LVAKCYFAKHKLVWEILEGGLK  166



>emb|CDX68693.1| BnaC01g07600D [Brassica napus]
Length=555

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 115/172 (67%), Gaps = 20/172 (12%)
 Frame = +3

Query  147  MVFLMKTGEM--APELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV + K+G M    EL  +    +PVKLE+  DD  E  HGPLNKRSKL S       + 
Sbjct  1    MVEMRKSGVMRTESELASKCRDDLPVKLEIAEDDLEEA-HGPLNKRSKLWSSGTSSSSMA  59

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS  500
             +        +YNPL+EPSPLGLSLRKSPSLLDLIQMRL+Q      G  PG        
Sbjct  60   PA--------KYNPLDEPSPLGLSLRKSPSLLDLIQMRLTQKAADAVGSAPG--------  103

Query  501  STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             + EKLKASNFPA++LKIG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  104  -SIEKLKASNFPATVLKIGKWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  154



>ref|XP_006404909.1| hypothetical protein EUTSA_v10000158mg [Eutrema salsugineum]
 gb|ESQ46362.1| hypothetical protein EUTSA_v10000158mg [Eutrema salsugineum]
Length=459

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 119/174 (68%), Gaps = 20/174 (11%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +MK+  + PE   +     PVKLE+  D   EE H P NKRS+L S      G  VS
Sbjct  1    MVEMMKSRNLRPEA--EPASKFPVKLEIVEDFLDEE-HSPPNKRSRLWS----NNGTSVS  53

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSS-  503
                  ++++N L+EPSPLGLSLRKSPSL DLIQ RLSQ   S A G+  KKE   N+S 
Sbjct  54   ------LMKFNLLDEPSPLGLSLRKSPSLQDLIQTRLSQ---SVAVGSVVKKESLCNASS  104

Query  504  ---TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
               T EKLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  105  VVGTVEKLKASNFPASVLRIGQWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  158



>gb|AFW76589.1| hypothetical protein ZEAMMB73_647105 [Zea mays]
Length=238

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  SS  E+LKASNFPA+ILK
Sbjct  80   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDSKSGVSSAGERLKASNFPANILK  139

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  140  IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_010525792.1| PREDICTED: uncharacterized protein LOC104803550 isoform X2 [Tarenaya 
hassleriana]
Length=526

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 116/182 (64%), Gaps = 24/182 (13%)
 Frame = +3

Query  144  LMVFLMKTGEMAPELDWQRG--KAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGI  317
            +M  +  TG + PEL+         PVKLE+  D   EE +G L+KRSK+         I
Sbjct  1    MMELMKSTGNLKPELETATKCRDEFPVKLEIAEDFLEEE-YGALSKRSKIYPSFHQTYSI  59

Query  318  GVSDFREPPV--VQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK  491
                F   P+   QYNPL+EPSPLGLSLRKSPS LDLIQMRL+QG         GKK  K
Sbjct  60   DTMAF---PLQTTQYNPLDEPSPLGLSLRKSPSFLDLIQMRLAQG---------GKKNSK  107

Query  492  ANSS-------TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGG  650
            + SS        +EKLKASNFPAS L+IG WEYKSRYEGDL+AKCYFAKHKLVWEVL  G
Sbjct  108  SASSEAGPSLGAAEKLKASNFPASFLRIGQWEYKSRYEGDLIAKCYFAKHKLVWEVLQHG  167

Query  651  LK  656
            LK
Sbjct  168  LK  169



>ref|XP_010526305.1| PREDICTED: uncharacterized protein LOC104803910 [Tarenaya hassleriana]
Length=538

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 121/187 (65%), Gaps = 22/187 (12%)
 Frame = +3

Query  147  MVFLMKT-GEMAPELDW--QRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQV--  311
            MV LMK+ G + PE +   +     PVKLE+  D   EE HG  NKR K+S  L  +   
Sbjct  1    MVELMKSAGNLRPEPETVSKCRNEFPVKLEIAEDFLEEE-HGVPNKRPKVSPSLHQESCS  59

Query  312  -GIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQG-----------KMS  455
              IG S F   P  QYNPL+EPSPLGLSLRKSPSL DLIQMRL+QG           K S
Sbjct  60   KSIGTSAFPVQPA-QYNPLDEPSPLGLSLRKSPSLADLIQMRLAQGSGPNSVPIDSKKDS  118

Query  456  KAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWE  635
            K    PG      +   +EKLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWE
Sbjct  119  KLAAAPGTG---PSPGAAEKLKASNFPASLLRIGQWEYKSRYEGDLVAKCYFAKHKLVWE  175

Query  636  VLDGGLK  656
            VL+ GLK
Sbjct  176  VLEHGLK  182



>ref|XP_007217228.1| hypothetical protein PRUPE_ppa005301mg [Prunus persica]
 gb|EMJ18427.1| hypothetical protein PRUPE_ppa005301mg [Prunus persica]
Length=468

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GP++KR KL S    Q+G+G   F  PP + Y+PL+EPSPLGL L+KSPS LDLIQM+LS
Sbjct  25   GPIHKRLKLDS--VPQLGLGPGKFEVPPSL-YHPLDEPSPLGLHLKKSPSFLDLIQMKLS  81

Query  441  QGKMSKAGGNPGKKEQKANSST--SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
            +    K     GK+  K  +++  S+KLKA NFPASIL+IG+WEYKSRYEGDLVAKCYFA
Sbjct  82   EENSVKLA-TLGKRGHKGTTASGASDKLKAMNFPASILRIGTWEYKSRYEGDLVAKCYFA  140

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVLDG LK
Sbjct  141  KHKLVWEVLDGSLK  154



>ref|XP_010687648.1| PREDICTED: uncharacterized protein LOC104901744 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 9/117 (8%)
 Frame = +3

Query  330  FREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG---NPGKKEQKANS  500
            F  PP  QYNPLEEPSPLGL LRKSPSLL+LIQMRLSQGK S +G    +  + ++++N+
Sbjct  61   FPAPPS-QYNPLEEPSPLGLRLRKSPSLLELIQMRLSQGKPSTSGSVLDDDSRSQERSNT  119

Query  501  -----STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
                   ++KLKASNFPAS+LKIG WEY SRYEGDLVAKCYFAKHKLVWE+L+GGLK
Sbjct  120  KGSAPGATDKLKASNFPASLLKIGCWEYTSRYEGDLVAKCYFAKHKLVWEILEGGLK  176



>gb|ABR16502.1| unknown [Picea sitchensis]
Length=592

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 4/132 (3%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR+K + P Q Q  +G S  R       NPL+EPSPLGL+LRKSPSLLDLIQM+LSQG 
Sbjct  47   SKRAKFAVPCQQQWSVGPSSGRLQSA-HVNPLDEPSPLGLTLRKSPSLLDLIQMKLSQGD  105

Query  450  MSKAGGNPGKKEQ---KANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
             + +G   GK+      A  ++++KLKASNFP SIL+IG+WE  SRYEGDLVAKCYFAKH
Sbjct  106  PAFSGQEEGKRRDVRSSAAQNSADKLKASNFPVSILRIGTWECISRYEGDLVAKCYFAKH  165

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDGGLK
Sbjct  166  KLVWEVLDGGLK  177



>gb|EPS63967.1| hypothetical protein M569_10814, partial [Genlisea aurea]
Length=217

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 88/102 (86%), Gaps = 2/102 (2%)
 Frame = +3

Query  351  QYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASN  530
            +YNPL+EPSPLGL LRKSPSLL+LIQ++LSQG  S    +  KKE K+  S+ +KLKASN
Sbjct  9    EYNPLDEPSPLGLRLRKSPSLLELIQIKLSQG--SAGTQSHVKKEAKSGVSSGDKLKASN  66

Query  531  FPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            FP S+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  67   FPGSVLRIGNWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  108



>dbj|BAJ98844.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=529

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 99/144 (69%), Gaps = 24/144 (17%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQ---YNpleepsplglslRKSPSLLDLIQ  428
            HGPL KR++ + P              PP  Q   +N L+EPSPLGL L+KSPSLLDLIQ
Sbjct  38   HGPLGKRARPAQP-------------SPPPHQDMYHNVLDEPSPLGLRLKKSPSLLDLIQ  84

Query  429  MRLSQ-----GKMSKAGGNPGKKEQ---KANSSTSEKLKASNFPASILKIGSWEYKSRYE  584
            MRLSQ     G+ S     P KK+      +SS  E+LKASNFPAS+L+IG+WEY SRYE
Sbjct  85   MRLSQANSDAGQSSTDNAEPSKKKDLKSGTSSSAGERLKASNFPASVLRIGTWEYTSRYE  144

Query  585  GDLVAKCYFAKHKLVWEVLDGGLK  656
            GDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  145  GDLVAKCYFAKHKLVWEVLEGGLK  168



>ref|XP_009336666.1| PREDICTED: uncharacterized protein LOC103929234 isoform X3 [Pyrus 
x bretschneideri]
Length=539

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 122/180 (68%), Gaps = 28/180 (16%)
 Frame = +3

Query  147  MVFLMKTGEMAPELD-WQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G+  PE       + VPVKLEVE     E  HGPLNKRSK S           
Sbjct  1    MVQLMKSGDFGPETHAIPCTEKVPVKLEVEESLEEE--HGPLNKRSKPS-----------  47

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPG-KK  482
                 P   ++NPL+EPSPLGL LRKSPSLL+LIQM+L+QG  + AG       N G KK
Sbjct  48   -----PAFQEFNPLDEPSPLGLRLRKSPSLLELIQMKLAQGSAAAAGATQIENLNSGVKK  102

Query  483  EQKANS--STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            E K N+   T++KLKASNFPAS+L IGSWEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  103  ECKVNAPLGTADKLKASNFPASLLSIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLEVGLK  162



>ref|XP_002512753.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49256.1| conserved hypothetical protein [Ricinus communis]
Length=517

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 110/156 (71%), Gaps = 20/156 (13%)
 Frame = +3

Query  204  KAVPVKlevevddpleeeHGPLNKRSKL---SSPLQHQVGIGVSDFREPPVVQYNpleep  374
            K  PVKLE++    LE++ GPL+KRSK    SS LQ      +S+  E P          
Sbjct  14   KKSPVKLELDDSSSLEDQLGPLHKRSKFDYSSSSLQMIPAASLSNPLEEP----------  63

Query  375  splglslRKSPSLLDLIQMRLSQGKMSKAGGNPG-KKEQK-ANSSTSEKLKASNFPASIL  548
            SPLGL L+KSPS LDLIQM+LSQ     A  NP  KK+QK A  + ++KLKASNFPA++L
Sbjct  64   SPLGLRLKKSPSFLDLIQMKLSQ-----AANNPNSKKDQKTAVITATDKLKASNFPATLL  118

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +IG+WEYKSR+EGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  119  RIGNWEYKSRHEGDLVAKCYFAKHKLVWEVLDGGLK  154



>ref|XP_008228846.1| PREDICTED: uncharacterized protein LOC103328229 [Prunus mume]
Length=523

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 102/134 (76%), Gaps = 6/134 (4%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GP++KR KL S    Q+G+G   F  PP + Y+PL+EPSPLGL L+KSPS LDLIQM+LS
Sbjct  25   GPIHKRLKLDS--VPQLGLGPGKFEVPPSL-YHPLDEPSPLGLHLKKSPSFLDLIQMKLS  81

Query  441  QGKMSKAGGNPGKKEQKANSST--SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
            +    K     GK+  K  +++  S+KLKA NFPAS+L+IG+WEYKSRYEGDLVAKCYFA
Sbjct  82   EENSVKLA-TLGKRGHKGTTASGASDKLKAMNFPASLLRIGTWEYKSRYEGDLVAKCYFA  140

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVLDG LK
Sbjct  141  KHKLVWEVLDGSLK  154



>ref|XP_002299157.1| hypothetical protein POPTR_0001s03330g [Populus trichocarpa]
 gb|EEE83962.1| hypothetical protein POPTR_0001s03330g [Populus trichocarpa]
Length=510

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 96/132 (73%), Gaps = 14/132 (11%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
             PL+KRSKL   LQ  +         P  V YNPL+EPSP+GL+L+KSPS LDLIQM+LS
Sbjct  27   SPLHKRSKLDPCLQVII---------PDAVLYNPLQEPSPIGLTLKKSPSFLDLIQMKLS  77

Query  441  QGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
            Q   S          +K +S+ ++KLKASNF AS+LKIGSWE KSRYEGDLVAKCYFAKH
Sbjct  78   QQNTSNT-----MLSKKPSSAAADKLKASNFTASLLKIGSWECKSRYEGDLVAKCYFAKH  132

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDGGLK
Sbjct  133  KLVWEVLDGGLK  144



>ref|XP_011034581.1| PREDICTED: uncharacterized protein LOC105132669 isoform X1 [Populus 
euphratica]
Length=512

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 95/131 (73%), Gaps = 14/131 (11%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            PL+KRSKL   LQ            P  V YNPLEEPSP+GL+L+KSPS LDLIQM+LSQ
Sbjct  28   PLHKRSKLDPSLQ---------VMNPDAVLYNPLEEPSPIGLTLKKSPSFLDLIQMKLSQ  78

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
               S          +K +S+ ++KLKASNF AS+LKIGSWE KSRYEGDLVAKCYFAKHK
Sbjct  79   QNTSNT-----MLSKKPSSAAADKLKASNFTASLLKIGSWECKSRYEGDLVAKCYFAKHK  133

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  134  LVWEVLDGGLK  144



>ref|XP_011034584.1| PREDICTED: uncharacterized protein LOC105132669 isoform X3 [Populus 
euphratica]
Length=506

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 95/131 (73%), Gaps = 14/131 (11%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            PL+KRSKL   LQ            P  V YNPLEEPSP+GL+L+KSPS LDLIQM+LSQ
Sbjct  28   PLHKRSKLDPSLQ---------VMNPDAVLYNPLEEPSPIGLTLKKSPSFLDLIQMKLSQ  78

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
               S          +K +S+ ++KLKASNF AS+LKIGSWE KSRYEGDLVAKCYFAKHK
Sbjct  79   QNTSNT-----MLSKKPSSAAADKLKASNFTASLLKIGSWECKSRYEGDLVAKCYFAKHK  133

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  134  LVWEVLDGGLK  144



>ref|XP_011034582.1| PREDICTED: uncharacterized protein LOC105132669 isoform X2 [Populus 
euphratica]
Length=508

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 95/131 (73%), Gaps = 14/131 (11%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            PL+KRSKL   LQ            P  V YNPLEEPSP+GL+L+KSPS LDLIQM+LSQ
Sbjct  28   PLHKRSKLDPSLQ---------VMNPDAVLYNPLEEPSPIGLTLKKSPSFLDLIQMKLSQ  78

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
               S          +K +S+ ++KLKASNF AS+LKIGSWE KSRYEGDLVAKCYFAKHK
Sbjct  79   QNTSNT-----MLSKKPSSAAADKLKASNFTASLLKIGSWECKSRYEGDLVAKCYFAKHK  133

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  134  LVWEVLDGGLK  144



>ref|NP_001143180.1| uncharacterized protein LOC100275680 [Zea mays]
 gb|ACG29566.1| hypothetical protein [Zea mays]
Length=532

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  S+  E+LKASNFPASILK
Sbjct  77   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDNKSGASAAGERLKASNFPASILK  136

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  137  IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>gb|AFW85535.1| hypothetical protein ZEAMMB73_400214 [Zea mays]
Length=532

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  S+  E+LKASNFPASILK
Sbjct  77   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDNKSGASAAGERLKASNFPASILK  136

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  137  IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>ref|XP_006385936.1| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
 gb|ERP63733.1| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
Length=495

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 92/131 (70%), Gaps = 13/131 (10%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            PL KRSKL  P         S    P  V +NPL EPSP+GL+L+KSPS LDLIQM+LSQ
Sbjct  30   PLFKRSKLDHP--------SSQVMNPDGVAFNPLGEPSPIGLTLKKSPSFLDLIQMKLSQ  81

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
               S          +K  S  ++KLKASNFPAS LKIG+WEYKSRYEGDLVAKCYFAKHK
Sbjct  82   QNTSNT-----MLSKKPGSVAADKLKASNFPASFLKIGNWEYKSRYEGDLVAKCYFAKHK  136

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  137  LVWEVLDGGLK  147



>ref|XP_011020564.1| PREDICTED: uncharacterized protein LOC105122893 [Populus euphratica]
Length=514

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 92/131 (70%), Gaps = 13/131 (10%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            PL KRSKL  P         S    P  V +NPL EPSP+GL+L+KSPS LDLIQM+LSQ
Sbjct  30   PLFKRSKLDHP--------SSQVMNPDGVAFNPLGEPSPIGLTLKKSPSFLDLIQMKLSQ  81

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
               S          +K  S  ++KLKASNFPAS LKIG+WEYKSRYEGDLVAKCYFAKHK
Sbjct  82   QNTSHT-----MLSKKPGSVAADKLKASNFPASFLKIGNWEYKSRYEGDLVAKCYFAKHK  136

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  137  LVWEVLDGGLK  147



>emb|CDY36470.1| BnaC03g67900D [Brassica napus]
Length=554

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 92/143 (64%), Gaps = 30/143 (21%)
 Frame = +3

Query  258  HGPLNKRSKL--SSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            HGPL KRSKL  SSP+            EP  +  +            RKSPSLLDLIQM
Sbjct  33   HGPLKKRSKLWSSSPMA---------LAEPSPLGLSL-----------RKSPSLLDLIQM  72

Query  432  RLSQGKMSKAGGN-PGKKEQKANSSTS-------EKLKASNFPASILKIGSWEYKSRYEG  587
            RL+Q    KAGG+   K+E K  ++ S       EKLKASNFPA++LKIG WEYKSRYEG
Sbjct  73   RLTQSGDPKAGGSGVVKQESKCITAGSNLGPGSIEKLKASNFPATVLKIGQWEYKSRYEG  132

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAKHKLVWEVL+ GLK
Sbjct  133  DLVAKCYFAKHKLVWEVLERGLK  155



>ref|XP_002304738.2| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
 gb|EEE79717.2| hypothetical protein POPTR_0003s18310g [Populus trichocarpa]
Length=467

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 92/131 (70%), Gaps = 13/131 (10%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            PL KRSKL  P         S    P  V +NPL EPSP+GL+L+KSPS LDLIQM+LSQ
Sbjct  30   PLFKRSKLDHP--------SSQVMNPDGVAFNPLGEPSPIGLTLKKSPSFLDLIQMKLSQ  81

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
               S          +K  S  ++KLKASNFPAS LKIG+WEYKSRYEGDLVAKCYFAKHK
Sbjct  82   QNTSNT-----MLSKKPGSVAADKLKASNFPASFLKIGNWEYKSRYEGDLVAKCYFAKHK  136

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  137  LVWEVLDGGLK  147



>ref|XP_009137965.1| PREDICTED: uncharacterized protein LOC103862001 [Brassica rapa]
Length=568

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 114/171 (67%), Gaps = 22/171 (13%)
 Frame = +3

Query  183  ELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNp  362
            EL  +R    PVKLE+  DD  EE HGPLNKRS+L S        G S     P  +YNP
Sbjct  10   ELSAKRRAEFPVKLEIVEDDLEEE-HGPLNKRSRLWSS-------GTSSSPMAPA-KYNP  60

Query  363  leepsplglslRKSPSLLDLIQMRLSQGKMSKAGG---NPGKKEQKA----------NSS  503
            L+EPSPLGLSLRKSPSLLDLIQMRL+Q   SKA        KKE K              
Sbjct  61   LDEPSPLGLSLRKSPSLLDLIQMRLTQSGDSKAETLQTTGVKKESKCIAAASAGAALAPG  120

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            + EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  121  SIEKLKASNFPASVLKIGKWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  171



>ref|NP_001143086.1| hypothetical protein [Zea mays]
 gb|ACG28854.1| hypothetical protein [Zea mays]
 gb|AFW76590.1| hypothetical protein ZEAMMB73_647105 [Zea mays]
Length=535

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  SS  E+LKASNFPA+ILK
Sbjct  80   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDSKSGVSSAGERLKASNFPANILK  139

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  140  IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>ref|XP_008647634.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACR36410.1| unknown [Zea mays]
 gb|AFW76591.1| hypothetical protein ZEAMMB73_647105 [Zea mays]
Length=539

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  SS  E+LKASNFPA+ILK
Sbjct  80   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDSKSGVSSAGERLKASNFPANILK  139

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  140  IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  174



>gb|KHN24188.1| hypothetical protein glysoja_042005 [Glycine soja]
Length=530

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 97/141 (69%), Gaps = 8/141 (6%)
 Frame = +3

Query  258  HGPLNKRSKLS-SPL-QHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            H PLNKR K S SPL Q Q      D         N L+EPSPLGL LRKSPSLLDLIQM
Sbjct  30   HAPLNKRCKPSASPLPQPQQWNASDDGSVSSPSHLNILDEPSPLGLRLRKSPSLLDLIQM  89

Query  432  RLSQG------KMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDL  593
            +LSQG       +S       +    + +  ++KLKASNFPAS+L+IGSWEYKSRYEGDL
Sbjct  90   KLSQGSAQPSEDLSSGAKRESRAAAVSGAGGADKLKASNFPASLLRIGSWEYKSRYEGDL  149

Query  594  VAKCYFAKHKLVWEVLDGGLK  656
            VAKCYFAKHKLVWEVL+GGLK
Sbjct  150  VAKCYFAKHKLVWEVLEGGLK  170



>ref|XP_004303224.1| PREDICTED: uncharacterized protein LOC101296120 [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
             PL KR KL S    Q G G +     P+  Y+PLEEPSPLGL LRKSPSLLDLIQMRL+
Sbjct  28   APLQKRPKLDSSSLEQWGSGGATCAVAPL-GYDPLEEPSPLGLQLRKSPSLLDLIQMRLT  86

Query  441  QGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
            Q K  K G    KK  K  A S  ++KLKA NFPAS+L+IG+WEYKS++EGDLVAKCYFA
Sbjct  87   QQKAVKLG----KKNHKGAAGSGATDKLKAMNFPASLLRIGTWEYKSKHEGDLVAKCYFA  142

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVLDG LK
Sbjct  143  KHKLVWEVLDGSLK  156



>ref|XP_010655140.1| PREDICTED: uncharacterized protein LOC100262159 isoform X1 [Vitis 
vinifera]
Length=531

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 113/174 (65%), Gaps = 12/174 (7%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSP--LQHQVGIG  320
            MV +M  G  + E   +  K VPVK EVE  D    +     KR KL S   L  + G  
Sbjct  1    MVEVMSCGGTSAEYGKRCRKMVPVKSEVEDWDEPGLKQA--QKRLKLYSSQGLNQETGA-  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN-  497
                  PP+ QYN L+EPSPLGL L+KSPS LDLIQMRL+QG   K G + GKK  K   
Sbjct  58   ---LHIPPL-QYNLLDEPSPLGLQLKKSPSFLDLIQMRLTQGNGPKLG-SVGKKVTKGTP  112

Query  498  -SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +S SEKLKASNF ASIL+IG WEY SRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  113  VTSASEKLKASNFAASILRIGKWEYVSRYEGDLVAKCYFAKHKLVWEILDGSLK  166



>ref|XP_006412670.1| hypothetical protein EUTSA_v10024775mg [Eutrema salsugineum]
 gb|ESQ54123.1| hypothetical protein EUTSA_v10024775mg [Eutrema salsugineum]
Length=578

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 124/189 (66%), Gaps = 34/189 (18%)
 Frame = +3

Query  147  MVFLMKTGEMAPE--LDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV + K+G + PE  L  +    +PVKLE+  DD  EE HGPLNKRS+L S        G
Sbjct  1    MVEMRKSGGIRPESELAAKCRDELPVKLEIAEDDLEEE-HGPLNKRSRLWSS-------G  52

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNP---------  473
             S     P  +YNPL+EPSPLGLSLRKSPSLL+LIQMRL+Q       G+P         
Sbjct  53   TSSSPMAPA-KYNPLDEPSPLGLSLRKSPSLLELIQMRLTQS------GDPKSESGSVSS  105

Query  474  -GKKEQKANSSTS-------EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLV  629
              KKE K  ++ S       EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFAKHKLV
Sbjct  106  GVKKESKCITAGSTLAPGSIEKLKASNFPASLLKIGQWEYKSRYEGDLVAKCYFAKHKLV  165

Query  630  WEVLDGGLK  656
            WEVL+ GLK
Sbjct  166  WEVLEQGLK  174



>ref|XP_010655142.1| PREDICTED: uncharacterized protein LOC100262159 isoform X3 [Vitis 
vinifera]
Length=499

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 113/174 (65%), Gaps = 12/174 (7%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSP--LQHQVGIG  320
            MV +M  G  + E   +  K VPVK EVE  D    +     KR KL S   L  + G  
Sbjct  1    MVEVMSCGGTSAEYGKRCRKMVPVKSEVEDWDEPGLKQA--QKRLKLYSSQGLNQETGA-  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN-  497
                  PP+ QYN L+EPSPLGL L+KSPS LDLIQMRL+QG   K G + GKK  K   
Sbjct  58   ---LHIPPL-QYNLLDEPSPLGLQLKKSPSFLDLIQMRLTQGNGPKLG-SVGKKVTKGTP  112

Query  498  -SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +S SEKLKASNF ASIL+IG WEY SRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  113  VTSASEKLKASNFAASILRIGKWEYVSRYEGDLVAKCYFAKHKLVWEILDGSLK  166



>ref|XP_010655141.1| PREDICTED: uncharacterized protein LOC100262159 isoform X2 [Vitis 
vinifera]
Length=501

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 113/174 (65%), Gaps = 12/174 (7%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSP--LQHQVGIG  320
            MV +M  G  + E   +  K VPVK EVE  D    +     KR KL S   L  + G  
Sbjct  1    MVEVMSCGGTSAEYGKRCRKMVPVKSEVEDWDEPGLKQA--QKRLKLYSSQGLNQETGA-  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN-  497
                  PP+ QYN L+EPSPLGL L+KSPS LDLIQMRL+QG   K G + GKK  K   
Sbjct  58   ---LHIPPL-QYNLLDEPSPLGLQLKKSPSFLDLIQMRLTQGNGPKLG-SVGKKVTKGTP  112

Query  498  -SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +S SEKLKASNF ASIL+IG WEY SRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  113  VTSASEKLKASNFAASILRIGKWEYVSRYEGDLVAKCYFAKHKLVWEILDGSLK  166



>ref|XP_010655143.1| PREDICTED: uncharacterized protein LOC100262159 isoform X4 [Vitis 
vinifera]
Length=467

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 113/174 (65%), Gaps = 12/174 (7%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSP--LQHQVGIG  320
            MV +M  G  + E   +  K VPVK EVE  D    +     KR KL S   L  + G  
Sbjct  1    MVEVMSCGGTSAEYGKRCRKMVPVKSEVEDWDEPGLKQA--QKRLKLYSSQGLNQETGA-  57

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN-  497
                  PP+ QYN L+EPSPLGL L+KSPS LDLIQMRL+QG   K G + GKK  K   
Sbjct  58   ---LHIPPL-QYNLLDEPSPLGLQLKKSPSFLDLIQMRLTQGNGPKLG-SVGKKVTKGTP  112

Query  498  -SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +S SEKLKASNF ASIL+IG WEY SRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  113  VTSASEKLKASNFAASILRIGKWEYVSRYEGDLVAKCYFAKHKLVWEILDGSLK  166



>ref|XP_006575320.1| PREDICTED: uncharacterized protein LOC100794550 isoform X2 [Glycine 
max]
Length=535

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 99/142 (70%), Gaps = 10/142 (7%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H PLNKR K SS  Q Q     S        QYN L+EPSPLGL LRKSPSLLDLI+M+L
Sbjct  31   HAPLNKRFKSSSTSQEQWNASNSASSSS-PSQYNILDEPSPLGLRLRKSPSLLDLIEMKL  89

Query  438  SQGKMSKAGGNPG-------KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            SQG +  A            KKE +  A S + EKLKASNFPAS+L+IGSWEYKS++EGD
Sbjct  90   SQGNVIIANTQNENFLSSGLKKESRGAAASDSVEKLKASNFPASLLRIGSWEYKSKHEGD  149

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWEVL+G LK
Sbjct  150  LVAKCYFAKHKLVWEVLEGELK  171



>gb|KHN30277.1| hypothetical protein glysoja_042437 [Glycine soja]
Length=535

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 99/142 (70%), Gaps = 10/142 (7%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H PLNKR K SS  Q Q     S        QYN L+EPSPLGL LRKSPSLLDLI+M+L
Sbjct  31   HAPLNKRFKSSSTSQEQWNASNSASSSS-PSQYNILDEPSPLGLRLRKSPSLLDLIEMKL  89

Query  438  SQGKMSKAGGNPG-------KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            SQG +  A            KKE +  A S + EKLKASNFPAS+L+IGSWEYKS++EGD
Sbjct  90   SQGNVIIANTQNENFLSSGLKKESRGAAASDSVEKLKASNFPASLLRIGSWEYKSKHEGD  149

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWEVL+G LK
Sbjct  150  LVAKCYFAKHKLVWEVLEGELK  171



>ref|XP_010687332.1| PREDICTED: uncharacterized protein LOC104901445 [Beta vulgaris 
subsp. vulgaris]
Length=524

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 99/131 (76%), Gaps = 6/131 (5%)
 Frame = +3

Query  267  LNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQG  446
            ++KR K  S  Q + G GV++     V++YNPLEEPSPLGL L+KSPS LDLIQM++SQ 
Sbjct  31   MSKRPKFDSSHQDKNG-GVNN----GVLEYNPLEEPSPLGLKLKKSPSFLDLIQMKMSQE  85

Query  447  KMSKAGGNPGKKEQKANSSTS-EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
            K +       +KE+ A    +  KLKASNFPA+ LKIG+WEYKSRYEGDLVAKCYFAKHK
Sbjct  86   KTASLAKTLARKEKAAAPDNNINKLKASNFPATSLKIGTWEYKSRYEGDLVAKCYFAKHK  145

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  146  LVWEVLDGGLK  156



>emb|CBI25264.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = +3

Query  342  PVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKAN--SSTSEK  515
            P +QYN L+EPSPLGL L+KSPS LDLIQMRL+QG   K G + GKK  K    +S SEK
Sbjct  41   PPLQYNLLDEPSPLGLQLKKSPSFLDLIQMRLTQGNGPKLG-SVGKKVTKGTPVTSASEK  99

Query  516  LKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            LKASNF ASIL+IG WEY SRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  100  LKASNFAASILRIGKWEYVSRYEGDLVAKCYFAKHKLVWEILDGSLK  146



>ref|XP_002437983.1| hypothetical protein SORBIDRAFT_10g005890 [Sorghum bicolor]
 gb|EER89350.1| hypothetical protein SORBIDRAFT_10g005890 [Sorghum bicolor]
Length=472

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 74/95 (78%), Gaps = 8/95 (8%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILK  551
            +KSPSLLDLIQMRLSQ        M  +G  P KK+   +  S+  E+LKASNFPA++LK
Sbjct  17   KKSPSLLDLIQMRLSQASNAGESSMDNSGSEPSKKKDNKSGASAAGERLKASNFPANVLK  76

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IGSWEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  77   IGSWEYVSRYEGDLVAKCYFAKHKLVWEVLEGGLK  111



>emb|CDX72268.1| BnaC07g42900D [Brassica napus]
Length=566

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 100/146 (68%), Gaps = 21/146 (14%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H  LNKRS+L S        G S     P + YNPL+EPSPLGLSLRKSPSLLDLIQMRL
Sbjct  34   HASLNKRSRLWS-------CGTSSSPMAPAM-YNPLDEPSPLGLSLRKSPSLLDLIQMRL  85

Query  438  SQGKMSKAGGNPG---KKEQKANSSTS----------EKLKASNFPASILKIGSWEYKSR  578
            +Q   SKA        KKE K  ++ S          EKLKASNFPAS+LKIG WEYKSR
Sbjct  86   TQSGDSKAETMQTTGVKKESKCITAASAGATLAPGSIEKLKASNFPASVLKIGKWEYKSR  145

Query  579  YEGDLVAKCYFAKHKLVWEVLDGGLK  656
            YEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  146  YEGDLVAKCYFAKHKLVWEVLEQGLK  171



>ref|XP_011069649.1| PREDICTED: uncharacterized protein LOC105155471 [Sesamum indicum]
Length=512

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 90/126 (71%), Gaps = 10/126 (8%)
 Frame = +3

Query  306  QVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKA--------  461
            Q+  G   F  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQ              
Sbjct  12   QLSSGNHAFAVPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQESSPSVSVTSSEVA  70

Query  462  -GGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEV  638
              GN    +    SS ++KLKASNFPAS+L+IGSWEY SRYEGDLVAKCYFAKHKLVWEV
Sbjct  71   DSGNKKDMKGSTASSANDKLKASNFPASLLRIGSWEYVSRYEGDLVAKCYFAKHKLVWEV  130

Query  639  LDGGLK  656
            L+GGLK
Sbjct  131  LEGGLK  136



>ref|NP_001057011.1| Os06g0186600 [Oryza sativa Japonica Group]
 dbj|BAF18925.1| Os06g0186600 [Oryza sativa Japonica Group]
 dbj|BAG94307.1| unnamed protein product [Oryza sativa Japonica Group]
Length=472

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 11/97 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGN---------PGKKEQKANSSTS-EKLKASNFPASI  545
            RKSPSLLDLIQMRLSQ   S AG +         P KK+ K+ +ST+ E+LKASNFPA+I
Sbjct  17   RKSPSLLDLIQMRLSQAN-STAGQSSADDCSSEPPKKKDLKSGTSTAGERLKASNFPANI  75

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            L+IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  76   LRIGTWEYISRYEGDLVAKCYFAKHKLVWEVLEGGLK  112



>ref|XP_006655862.1| PREDICTED: uncharacterized protein LOC102701454 [Oryza brachyantha]
Length=472

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGN--------PGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQMRLSQ   S    +        P KK+ K+ +ST+ E+LKASNFPA+IL
Sbjct  17   RKSPSLLDLIQMRLSQANSSAGQSSVDNCNSEPPKKKDLKSGTSTAGERLKASNFPANIL  76

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  77   RIGTWEYISRYEGDLVAKCYFAKHKLVWEVLEGGLK  112



>ref|XP_010927930.1| PREDICTED: uncharacterized protein LOC105049857 isoform X3 [Elaeis 
guineensis]
Length=505

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 73/90 (81%), Gaps = 3/90 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK---ANSSTSEKLKASNFPASILKIGSWE  566
            RKSPSL+DLIQMRLSQ   S    + GKK+       S+T++K+KASNFPAS+L+IG+WE
Sbjct  23   RKSPSLVDLIQMRLSQPNTSGESSDVGKKKVARCIGASATTDKMKASNFPASLLRIGAWE  82

Query  567  YKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            Y S YEGDLVAKCYFAKHKLVWE+LDGGLK
Sbjct  83   YASAYEGDLVAKCYFAKHKLVWEILDGGLK  112



>gb|EAY99950.1| hypothetical protein OsI_21952 [Oryza sativa Indica Group]
Length=525

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 76/96 (79%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGN--------PGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQMRLSQ   S    +        P KK+ K+ +ST+ E+LKASNFPA+IL
Sbjct  70   RKSPSLLDLIQMRLSQANSSAGQSSADDCSSEPPKKKDLKSGTSTAGERLKASNFPANIL  129

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  130  RIGTWEYISRYEGDLVAKCYFAKHKLVWEVLEGGLK  165



>gb|EAZ36075.1| hypothetical protein OsJ_20384 [Oryza sativa Japonica Group]
Length=509

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 78/97 (80%), Gaps = 11/97 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGN---------PGKKEQKANSSTS-EKLKASNFPASI  545
            RKSPSLLDLIQMRLSQ   S AG +         P KK+ K+ +ST+ E+LKASNFPA+I
Sbjct  54   RKSPSLLDLIQMRLSQAN-STAGQSSADDCSSEPPKKKDLKSGTSTAGERLKASNFPANI  112

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            L+IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  113  LRIGTWEYISRYEGDLVAKCYFAKHKLVWEVLEGGLK  149



>ref|XP_006283391.1| hypothetical protein CARUB_v10004435mg [Capsella rubella]
 gb|EOA16289.1| hypothetical protein CARUB_v10004435mg [Capsella rubella]
Length=586

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 108/189 (57%), Positives = 124/189 (66%), Gaps = 28/189 (15%)
 Frame = +3

Query  147  MVFLMKTGEMAPE--LDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV + K+G + PE  L  +    +PVKLE+  DD  EE H PLNKRSKL S        G
Sbjct  1    MVEMRKSGSLRPESELAAKCRDELPVKLEIAEDDLEEE-HAPLNKRSKLWSS-------G  52

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ-----GKMSKAG--GNPGK  479
             S     P  +YNPL+EPSPLGLSLRKSPSLL+LIQMRL+       +M +AG  G+  K
Sbjct  53   ASSSPMAPA-KYNPLDEPSPLGLSLRKSPSLLELIQMRLTHCGDPKAEMIQAGAAGSGVK  111

Query  480  KEQKA----------NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLV  629
            KE K              + EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFAKHKLV
Sbjct  112  KENKGIAAASAGATLAPGSIEKLKASNFPASLLKIGQWEYKSRYEGDLVAKCYFAKHKLV  171

Query  630  WEVLDGGLK  656
            WEVL+ GLK
Sbjct  172  WEVLEQGLK  180



>emb|CDY39241.1| BnaA03g50530D [Brassica napus]
Length=567

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 114/173 (66%), Gaps = 26/173 (15%)
 Frame = +3

Query  183  ELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPPVV--QY  356
            EL  +R    PVKLE+  DD  EE H PLNKRS+L S          S     P+V  +Y
Sbjct  10   ELSAKRRAEFPVKLEIVEDDLEEE-HAPLNKRSRLWS----------SGTSSSPMVPAKY  58

Query  357  NpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPG---KKEQKA----------N  497
            NPL+EPSPLGLSLRKSPSLLDLIQMRL+Q   SKA        KKE K            
Sbjct  59   NPLDEPSPLGLSLRKSPSLLDLIQMRLTQSGDSKAETMQTAGVKKESKCIAAASAGAALA  118

Query  498  SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
              + EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  119  PGSIEKLKASNFPASVLKIGKWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  171



>gb|EMT26553.1| hypothetical protein F775_08200 [Aegilops tauschii]
Length=471

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 75/94 (80%), Gaps = 7/94 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQ-----GKMSKAGGNPGKKE--QKANSSTSEKLKASNFPASILKI  554
            +KSPSLLDLIQMRLSQ     G+ +     P KK+  +   SS SE+LKASNFPAS+LKI
Sbjct  17   KKSPSLLDLIQMRLSQANSDAGQSTTDNAEPSKKKDLKSGTSSASERLKASNFPASVLKI  76

Query  555  GSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            G+W+Y S+YEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  77   GTWKYTSKYEGDLVAKCYFAKHKLVWEVLEGGLK  110



>ref|XP_010227931.1| PREDICTED: uncharacterized protein LOC100821383 isoform X2 [Brachypodium 
distachyon]
Length=471

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 75/97 (77%), Gaps = 11/97 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAG--------GNPGKKE--QKANSSTSEKLKASNFPASI  545
            RKSPSLLDLIQMRLSQ   S AG        G P KK+  +   SS  E+LKASNFPA+I
Sbjct  17   RKSPSLLDLIQMRLSQAN-SNAGQSSTDNCSGEPPKKKDVKSGTSSAGERLKASNFPANI  75

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            L+IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  76   LRIGTWEYISRYEGDLVAKCYFAKHKLVWEVLEGGLK  112



>ref|XP_009395482.1| PREDICTED: uncharacterized protein LOC103980727 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 125/185 (68%), Gaps = 19/185 (10%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPL---QHQVGI  317
            MV LM  G++ P+ +    K +P  ++VE +D LE+EHGP +KR K++ P    Q +   
Sbjct  1    MVQLMSYGKLRPDSELPI-KKLPAPVKVETEDQLEDEHGPPDKRFKMARPPPPPQQKWET  59

Query  318  GVSDFREPPV--VQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG--------  467
            G +    PP   +++N L EPSPLGL LRKSPSLL+LIQMRLSQ   +   G        
Sbjct  60   GET---MPPTDAIEHNLLNEPSPLGLRLRKSPSLLNLIQMRLSQANAAVGSGIMKNESLE  116

Query  468  NPGKKEQKANSS--TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVL  641
            +  KK+ ++  +   +EK+KASNFPAS+L+IG+WEY SRYEGDLVAKCYFAK KLVWE+L
Sbjct  117  DKNKKDTRSTCALANTEKIKASNFPASLLRIGAWEYASRYEGDLVAKCYFAKRKLVWEIL  176

Query  642  DGGLK  656
            +GGLK
Sbjct  177  EGGLK  181



>ref|XP_004507038.1| PREDICTED: uncharacterized protein LOC101500032 [Cicer arietinum]
Length=516

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 8/89 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTS--EKLKASNFPASILKIGSWEY  569
            +KSPSLLDLIQMRLSQ   SK      KK+ KA+++ +   KLKASNFPA++LKIG+WEY
Sbjct  75   KKSPSLLDLIQMRLSQQHDSK------KKDHKASAAATADSKLKASNFPATVLKIGTWEY  128

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  129  KSRYEGDLVAKCYFAKHKLVWEVLDGCLK  157



>gb|KFK41359.1| hypothetical protein AALP_AA2G119900 [Arabis alpina]
Length=468

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 118/176 (67%), Gaps = 17/176 (10%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +MK   M PE  ++    +PVKLE+  D   EE HGPLNKRSKL      + G  +S
Sbjct  1    MVEMMKPRYMLPE--FKPASKLPVKLEIVEDFLEEE-HGPLNKRSKL-----WRNGTNMS  52

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMS--KAGGNPGKKEQKANS  500
                P   +++ L+EPSPLGLSL+KSPS  DLIQMRLSQ   +  K   +  KKE   N 
Sbjct  53   -LMTP--TKFSLLDEPSPLGLSLKKSPSFQDLIQMRLSQSSDTNFKTLQDDVKKENMGND  109

Query  501  S----TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +    T EKLKASNFPA++++IG WEYKSRYEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  110  TSVVGTVEKLKASNFPATVIRIGQWEYKSRYEGDLVAKCYFAKHKLVWEVLQQGLK  165



>ref|XP_003564178.1| PREDICTED: uncharacterized protein LOC100821383 isoform X1 [Brachypodium 
distachyon]
Length=536

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 75/97 (77%), Gaps = 11/97 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAG--------GNPGKKE--QKANSSTSEKLKASNFPASI  545
            RKSPSLLDLIQMRLSQ   S AG        G P KK+  +   SS  E+LKASNFPA+I
Sbjct  82   RKSPSLLDLIQMRLSQAN-SNAGQSSTDNCSGEPPKKKDVKSGTSSAGERLKASNFPANI  140

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            L+IG+WEY SRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  141  LRIGTWEYISRYEGDLVAKCYFAKHKLVWEVLEGGLK  177



>emb|CDY34799.1| BnaA09g41660D [Brassica napus]
Length=429

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 97/137 (71%), Gaps = 24/137 (18%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GP NKRSKL S      G  VS    PP    N L+EPSPLGLSLRKSPSL DLIQMRL
Sbjct  27   NGPANKRSKLWSN-----GTSVSLI--PP----NLLDEPSPLGLSLRKSPSLQDLIQMRL  75

Query  438  SQGKMSKAGGNPGKKEQKANSS----TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            SQ           KKE  AN+S    T EKLKASNFPA++L+IG WEYKSRYEGDLVAKC
Sbjct  76   SQSV---------KKETIANASSLVGTVEKLKASNFPATVLRIGQWEYKSRYEGDLVAKC  126

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAKHKLVWEVL+ GLK
Sbjct  127  YFAKHKLVWEVLEQGLK  143



>ref|XP_009117249.1| PREDICTED: uncharacterized protein LOC103842383 [Brassica rapa]
Length=429

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 97/137 (71%), Gaps = 24/137 (18%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GP NKRSKL S      G  VS    PP    N L+EPSPLGLSLRKSPSL DLIQMRL
Sbjct  27   NGPANKRSKLWSN-----GTSVSLI--PP----NLLDEPSPLGLSLRKSPSLQDLIQMRL  75

Query  438  SQGKMSKAGGNPGKKEQKANSS----TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            SQ           KKE  AN+S    T EKLKASNFPA++L+IG WEYKSRYEGDLVAKC
Sbjct  76   SQSV---------KKETIANASSLVGTVEKLKASNFPATVLRIGQWEYKSRYEGDLVAKC  126

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAKHKLVWEVL+ GLK
Sbjct  127  YFAKHKLVWEVLEQGLK  143



>gb|KHN04197.1| hypothetical protein glysoja_032693 [Glycine soja]
Length=599

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 100/138 (72%), Gaps = 17/138 (12%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL SP + Q G        PP   YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLESPPK-QCGASDESISIPPA-SYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQQE  88

Query  450  MSKAGGNPGKKEQKANSST---------SEKLKASNFPASILKIGSWEYKSRYEGDLVAK  602
             SK      KK+QKA+SS+           KLKASNFP +ILKIG+WEYKSRYEGDLVAK
Sbjct  89   ESK------KKDQKASSSSAAAAAAAAADSKLKASNFPGTILKIGNWEYKSRYEGDLVAK  142

Query  603  CYFAKHKLVWEVLDGGLK  656
            CYFAKHKLVWEVLDG LK
Sbjct  143  CYFAKHKLVWEVLDGCLK  160



>gb|ADB08053.1| putative protein [Triticum aestivum]
Length=530

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 7/94 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQ-----GKMSKAGGNPGKKE--QKANSSTSEKLKASNFPASILKI  554
            +KSPSLLDLIQMRLSQ     G+ S     P KK+  +   SS  E+LKASNFPAS+LKI
Sbjct  76   KKSPSLLDLIQMRLSQANSDAGQSSTDNAEPSKKKDLKSGTSSAGERLKASNFPASVLKI  135

Query  555  GSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            G WEY S+YEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  136  GKWEYTSKYEGDLVAKCYFAKHKLVWEVLEGGLK  169



>ref|XP_004964644.1| PREDICTED: uncharacterized protein LOC101773914 [Setaria italica]
Length=541

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 97/140 (69%), Gaps = 14/140 (10%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GPL+KR+K +            D      + +N L+EPSPLGL L+KSPSLLDLIQMRLS
Sbjct  47   GPLSKRAKAAQSAPPTPPQQQQD------MYHNVLDEPSPLGLRLKKSPSLLDLIQMRLS  100

Query  441  QGK------MSKAGGNPGKKEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRYEGDLV  596
            Q        +  +G  P KK+   +  S+  E+LKASNFPA+ILKIG+WEY SRYEGDLV
Sbjct  101  QASNAGESSIDNSGSEPSKKKDNKSGVSAAGERLKASNFPANILKIGTWEYVSRYEGDLV  160

Query  597  AKCYFAKHKLVWEVLDGGLK  656
            AKCYFAKHKLVWEVL+GGLK
Sbjct  161  AKCYFAKHKLVWEVLEGGLK  180



>ref|XP_003522941.1| PREDICTED: uncharacterized protein LOC100807349 [Glycine max]
Length=533

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 100/145 (69%), Gaps = 12/145 (8%)
 Frame = +3

Query  258  HGPLNKRSKLS-SPL-QHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            H PLNKR K S SPL Q Q      D         N L+EPSPLGL LRKSPSLLDLIQM
Sbjct  30   HAPLNKRCKPSASPLPQPQQWNASDDGSVSSPSHLNILDEPSPLGLRLRKSPSLLDLIQM  89

Query  432  RLSQGKMSKAG--GNPGKKEQKANSSTS--------EKLKASNFPASILKIGSWEYKSRY  581
            +LSQG   +     +  K+E +  S+ +        +KLKASNFPAS+L+IGSWEYKSRY
Sbjct  90   KLSQGSAQQKEDLSSEAKRESRCASAAAASSGAGAADKLKASNFPASLLRIGSWEYKSRY  149

Query  582  EGDLVAKCYFAKHKLVWEVLDGGLK  656
            EGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  150  EGDLVAKCYFAKHKLVWEVLEGGLK  174



>gb|KDO55397.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=415

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +K+PS LDLI+M+LSQ   SK      KK   A S +++KLKASNFP S+LKIGSWEYKS
Sbjct  16   KKTPSFLDLIEMKLSQENASKLA-KLSKKRGNAVSGSADKLKASNFPGSLLKIGSWEYKS  74

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  75   RYEGDLVAKCYFAKHKLVWEVLDGGLK  101



>ref|XP_006583081.1| PREDICTED: uncharacterized protein LOC100808320 isoform X2 [Glycine 
max]
Length=600

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 101/139 (73%), Gaps = 18/139 (13%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL SP + Q G        PP   YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLESPPK-QCGASDESISIPPA-SYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQQE  88

Query  450  MSKAGGNPGKKEQKANSSTSE----------KLKASNFPASILKIGSWEYKSRYEGDLVA  599
             SK      KK+QKA+SS+S           KLKASNFP +ILKIG+WEYKSRYEGDLVA
Sbjct  89   ESK------KKDQKASSSSSVAAAAAAAADSKLKASNFPGTILKIGNWEYKSRYEGDLVA  142

Query  600  KCYFAKHKLVWEVLDGGLK  656
            KCYFAKHKLVWEVLDG LK
Sbjct  143  KCYFAKHKLVWEVLDGCLK  161



>gb|KDO55371.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55372.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55373.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55374.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55375.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55376.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55377.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55378.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55379.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55380.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55381.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55382.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55383.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55384.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55385.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55386.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=460

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +K+PS LDLI+M+LSQ   SK      KK   A S +++KLKASNFP S+LKIGSWEYKS
Sbjct  16   KKTPSFLDLIEMKLSQENASKLA-KLSKKRGNAVSGSADKLKASNFPGSLLKIGSWEYKS  74

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  75   RYEGDLVAKCYFAKHKLVWEVLDGGLK  101



>gb|KDO55369.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
 gb|KDO55370.1| hypothetical protein CISIN_1g012603mg [Citrus sinensis]
Length=459

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +K+PS LDLI+M+LSQ   SK      KK   A S +++KLKASNFP S+LKIGSWEYKS
Sbjct  16   KKTPSFLDLIEMKLSQENASKLA-KLSKKRGNAVSGSADKLKASNFPGSLLKIGSWEYKS  74

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  75   RYEGDLVAKCYFAKHKLVWEVLDGGLK  101



>gb|KJB23594.1| hypothetical protein B456_004G106800 [Gossypium raimondii]
Length=493

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 91/111 (82%), Gaps = 7/111 (6%)
 Frame = +3

Query  342  PVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG-----NPG-KKEQKANSS  503
            P  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +   +       N G KKE KA ++
Sbjct  15   PPAQYNPLDEPSPLGLKLRKSPSLLDLIQMRLSQSQSGSSAAQAESLNSGVKKESKAVAA  74

Query  504  TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            T +KLKASNFPASIL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  75   T-DKLKASNFPASILRIGHWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  124



>gb|EMS68538.1| hypothetical protein TRIUR3_33455 [Triticum urartu]
Length=532

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 7/94 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQ-----GKMSKAGGNPGKKE--QKANSSTSEKLKASNFPASILKI  554
            +KSPSLLDLIQMRLSQ     G+ S     P KK+  +   SS  E+LKASNFPAS+LKI
Sbjct  78   KKSPSLLDLIQMRLSQANSDAGQSSTDNAEPSKKKDLKSGTSSAGERLKASNFPASVLKI  137

Query  555  GSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            G WEY S+YEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  138  GKWEYTSKYEGDLVAKCYFAKHKLVWEVLEGGLK  171



>ref|XP_009396243.1| PREDICTED: uncharacterized protein LOC103981292 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 98/145 (68%), Gaps = 15/145 (10%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPP--VVQYNpleepsplglslRKSPSLLDLIQM  431
            HGPL+KR K+ +      GIG S    PP  ++Q N L EPSPLGL LRKSPSLLDLIQM
Sbjct  42   HGPLDKRPKMDTSPLLPWGIGGS---MPPTELIQNNLLNEPSPLGLHLRKSPSLLDLIQM  98

Query  432  RLSQGKMSKAGG---NPGKKEQKANSSTS-------EKLKASNFPASILKIGSWEYKSRY  581
            RLSQ   S       N   ++ K     S       EK+KASNFPAS+L+IG+WEY SRY
Sbjct  99   RLSQASASVKSSVMRNESLEDVKNEDFKSTGALANIEKMKASNFPASLLRIGTWEYASRY  158

Query  582  EGDLVAKCYFAKHKLVWEVLDGGLK  656
            EGDLVAKCYFAK KLVWE+L+GGLK
Sbjct  159  EGDLVAKCYFAKRKLVWEILEGGLK  183



>ref|NP_194807.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB52451.1| putative protein [Arabidopsis thaliana]
 emb|CAB79796.1| putative protein [Arabidopsis thaliana]
 gb|AAO42289.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63938.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85808.1| uncharacterized protein AT4G30780 [Arabidopsis thaliana]
Length=589

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 127/191 (66%), Gaps = 30/191 (16%)
 Frame = +3

Query  147  MVFLMKTGEMAPELD--WQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV + K+G + PE +   +    +PVKLE+  DD  EE HGPLNKRS+L SP       G
Sbjct  1    MVEMRKSGGLRPESESAARCRDELPVKLEIAEDDLEEE-HGPLNKRSRLWSP-------G  52

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ------GKMSKAG--GNPG  476
             S     P  +YNPL+EPSPLGLSL+KSPSLL+LIQM+++        +  KAG  G+  
Sbjct  53   TSSSTMAPA-KYNPLDEPSPLGLSLKKSPSLLELIQMKITHCGDPKAAETLKAGALGSGL  111

Query  477  KKEQKANSSTS-----------EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
            K+E K  ++ +           EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFAKHK
Sbjct  112  KRESKTIAAAASVGPTLAPGSIEKLKASNFPASLLKIGQWEYKSRYEGDLVAKCYFAKHK  171

Query  624  LVWEVLDGGLK  656
            LVWEVL+ GLK
Sbjct  172  LVWEVLEQGLK  182



>gb|KJB68964.1| hypothetical protein B456_011G001000 [Gossypium raimondii]
Length=474

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEY  569
            +KSPS LDLIQM+LSQ    K   +  KK+ K  + S   +KLKASNFPA+IL+IGSWEY
Sbjct  70   KKSPSFLDLIQMKLSQQNADKLTAH-NKKDSKGVSVSGVRDKLKASNFPAAILRIGSWEY  128

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  129  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  157



>gb|KJB68963.1| hypothetical protein B456_011G001000 [Gossypium raimondii]
Length=488

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEY  569
            +KSPS LDLIQM+LSQ    K   +  KK+ K  + S   +KLKASNFPA+IL+IGSWEY
Sbjct  70   KKSPSFLDLIQMKLSQQNADKLTAH-NKKDSKGVSVSGVRDKLKASNFPAAILRIGSWEY  128

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  129  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  157



>gb|EPS69285.1| hypothetical protein M569_05482, partial [Genlisea aurea]
Length=516

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 90/121 (74%), Gaps = 7/121 (6%)
 Frame = +3

Query  315  IGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGN-------P  473
            +G+ D       +YNPL+EPSPLGL LRKSPSLL+LIQM+LSQG  + AG          
Sbjct  30   VGMDDGSTVSPSEYNPLDEPSPLGLRLRKSPSLLELIQMKLSQGTTATAGNQNHHVAKEA  89

Query  474  GKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  653
                  A +S+ +KLKASNFP S+L+IG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL
Sbjct  90   KAVAAAAAASSGDKLKASNFPGSLLRIGNWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGL  149

Query  654  K  656
            K
Sbjct  150  K  150



>ref|XP_004146718.1| PREDICTED: uncharacterized protein LOC101219584 [Cucumis sativus]
Length=534

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 74/98 (76%), Gaps = 12/98 (12%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQ-----KANSS------TSEKLKASNFPAS  542
            RKSPSLLDLIQM+LSQG  + A G P   E      KA S       T+EKLKASNFPAS
Sbjct  73   RKSPSLLDLIQMKLSQGSSTTAAG-PSNAETFDFVVKAESQDATVPGTNEKLKASNFPAS  131

Query  543  ILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             LKIG WEYKSR+EGDLVAKCY+AKHKLVWE+L+GGLK
Sbjct  132  HLKIGRWEYKSRHEGDLVAKCYYAKHKLVWEILEGGLK  169



>ref|XP_009375478.1| PREDICTED: uncharacterized protein LOC103964285 [Pyrus x bretschneideri]
Length=494

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEY  569
            +KSPS LDLIQM+LSQ K +K     GK+  K  A S  S+KLKA NFPAS+L+IG+WEY
Sbjct  62   KKSPSFLDLIQMKLSQEKSAKLA-TLGKRSHKGAAASGASDKLKAMNFPASLLRIGTWEY  120

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  121  KSRYEGDLVAKCYFAKHKLVWEVLDGSLK  149



>gb|KHG24428.1| Pesticidal crystal cry1Fa [Gossypium arboreum]
Length=488

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 5/130 (4%)
 Frame = +3

Query  273  KRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKM  452
            KRSKL   LQ +  +    F   P + YNPL+EPSPLGL L+KSPS LDLIQM+LSQ   
Sbjct  31   KRSKLDPCLQ-EGNVESGKFPISPSL-YNPLDEPSPLGLRLKKSPSFLDLIQMKLSQQNG  88

Query  453  SKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKL  626
             K   +  KK+ K  + S   +KLKASNFPA+IL+IGSWEYKSRYEGDLVAKCYFAKHKL
Sbjct  89   DKLTAH-NKKDSKGVSVSGVRDKLKASNFPAAILRIGSWEYKSRYEGDLVAKCYFAKHKL  147

Query  627  VWEVLDGGLK  656
            VWEVLDGGLK
Sbjct  148  VWEVLDGGLK  157



>emb|CDX76839.1| BnaC08g34250D [Brassica napus]
Length=428

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 97/137 (71%), Gaps = 24/137 (18%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            +GP NKRSK+ S      G  VS    PP    N L+EPSPLGLSLRKSPSL DLIQMRL
Sbjct  27   NGPANKRSKVWSN-----GTSVSLI--PP----NLLDEPSPLGLSLRKSPSLQDLIQMRL  75

Query  438  SQGKMSKAGGNPGKKEQKANSS----TSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            SQ           KKE  AN+S    T EKLKASNFPA++L+IG WEYKSRYEGDLVAKC
Sbjct  76   SQSV---------KKETIANASSLVGTVEKLKASNFPATLLRIGQWEYKSRYEGDLVAKC  126

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAKHKLVWEVL+ GLK
Sbjct  127  YFAKHKLVWEVLEQGLK  143



>ref|XP_004161876.1| PREDICTED: uncharacterized LOC101219584 [Cucumis sativus]
Length=497

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 74/98 (76%), Gaps = 12/98 (12%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQ-----KANSS------TSEKLKASNFPAS  542
            RKSPSLLDLIQM+LSQG  + A G P   E      KA S       T+EKLKASNFPAS
Sbjct  51   RKSPSLLDLIQMKLSQGSSTTAAG-PSNAETFDFVVKAESQDATVPGTNEKLKASNFPAS  109

Query  543  ILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             LKIG WEYKSR+EGDLVAKCY+AKHKLVWE+L+GGLK
Sbjct  110  HLKIGRWEYKSRHEGDLVAKCYYAKHKLVWEILEGGLK  147



>ref|XP_003525940.1| PREDICTED: uncharacterized protein LOC100792008 [Glycine max]
Length=533

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 6/93 (6%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQG------KMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIG  557
            RKSPSLLDLIQM+LSQG       +S       +    + +  ++KLKASNFPAS+L+IG
Sbjct  81   RKSPSLLDLIQMKLSQGSAQPSEDLSSGAKRESRAAAVSGAGGADKLKASNFPASLLRIG  140

Query  558  SWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SWEYKSRYEGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  141  SWEYKSRYEGDLVAKCYFAKHKLVWEVLEGGLK  173



>ref|NP_001062613.1| Os09g0128400 [Oryza sativa Japonica Group]
 dbj|BAF24527.1| Os09g0128400 [Oryza sativa Japonica Group]
Length=221

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 92/131 (70%), Gaps = 9/131 (7%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            P +KRS+L+  LQH    G S        Q+  L+EPSPLGL L+KSPSL+DLIQM+L Q
Sbjct  32   PFHKRSRLA--LQHWSTDGGS-VSNQQSSQHGFLDEPSPLGLRLKKSPSLVDLIQMKLVQ  88

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
                   G     +    +S SEKLKASNFP S+L+IGSWE+ SRYEGDLVAKCYFAKHK
Sbjct  89   A------GKAKDVQHSGTASASEKLKASNFPGSVLRIGSWEWVSRYEGDLVAKCYFAKHK  142

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  143  LVWEVLDGGLK  153



>emb|CDP02853.1| unnamed protein product [Coffea canephora]
Length=535

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 96/146 (66%), Gaps = 14/146 (10%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQH-----QVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDL  422
            HG L+KRS+LS          Q     +DF   P+ QYNPL EPSPLGL LRKSPSLLDL
Sbjct  32   HGRLSKRSRLSPSTSSSPPFIQWSTANNDFTATPL-QYNPLNEPSPLGLRLRKSPSLLDL  90

Query  423  IQMRLSQGKMSKAGGNPGKKEQKAN--------SSTSEKLKASNFPASILKIGSWEYKSR  578
            IQMRLSQ   S      G     AN        S  ++K+KASNF AS+++IG WE+ +R
Sbjct  91   IQMRLSQNNASPVVAQSGSSTSTANKDAKNTAASIATDKMKASNFTASVIRIGRWEFVAR  150

Query  579  YEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +EGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  151  HEGDLVAKCYFAKHKLVWEVLEAGLK  176



>gb|KHN38060.1| hypothetical protein glysoja_007102 [Glycine soja]
Length=601

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 98/139 (71%), Gaps = 19/139 (14%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL SP   + G        PP   YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLESP--PKCGSSDESLSIPPA-SYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQQE  87

Query  450  MSKAGGNPGKKEQKANSST----------SEKLKASNFPASILKIGSWEYKSRYEGDLVA  599
             SK      KK+QKA+SS             KLKASNFP +ILKIG+WEYKSRYEGDLVA
Sbjct  88   ESK------KKDQKASSSASSAAAAAAAADSKLKASNFPGTILKIGTWEYKSRYEGDLVA  141

Query  600  KCYFAKHKLVWEVLDGGLK  656
            KCYFAKHKLVWEVLDG LK
Sbjct  142  KCYFAKHKLVWEVLDGCLK  160



>gb|KGN65185.1| hypothetical protein Csa_1G257910 [Cucumis sativus]
Length=651

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 74/98 (76%), Gaps = 12/98 (12%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQ-----KANSS------TSEKLKASNFPAS  542
            RKSPSLLDLIQM+LSQG  + A G P   E      KA S       T+EKLKASNFPAS
Sbjct  190  RKSPSLLDLIQMKLSQGSSTTAAG-PSNAETFDFVVKAESQDATVPGTNEKLKASNFPAS  248

Query  543  ILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             LKIG WEYKSR+EGDLVAKCY+AKHKLVWE+L+GGLK
Sbjct  249  HLKIGRWEYKSRHEGDLVAKCYYAKHKLVWEILEGGLK  286



>ref|XP_006343599.1| PREDICTED: uncharacterized protein LOC102599998 [Solanum tuberosum]
Length=533

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 99/141 (70%), Gaps = 9/141 (6%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQ--HQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            HGPL KRSK SS     +Q   G  +F  PP  +YNPL+EPSPLGL LRKSPSLLDLI M
Sbjct  27   HGPLTKRSKSSSASSSFNQWDAGNDEFPVPPP-EYNPLDEPSPLGLRLRKSPSLLDLITM  85

Query  432  RLSQGKMSK-AGGNPGKKEQK-----ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDL  593
            RLSQ   S  A  NP           + S  ++KLKASNF  S+L+IGSWEY SRYEGDL
Sbjct  86   RLSQNSGSSIAPENPTSVSNTGTKGASTSVATDKLKASNFSGSLLRIGSWEYASRYEGDL  145

Query  594  VAKCYFAKHKLVWEVLDGGLK  656
            VAKCYFAKHKLVWE+L+GGLK
Sbjct  146  VAKCYFAKHKLVWEILEGGLK  166



>ref|XP_007142109.1| hypothetical protein PHAVU_008G253300g [Phaseolus vulgaris]
 gb|ESW14103.1| hypothetical protein PHAVU_008G253300g [Phaseolus vulgaris]
Length=597

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 92/129 (71%), Gaps = 3/129 (2%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL +P +        D    P   YNPL+EPSPLGL L+KSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLETPPKCDSS---DDSLSIPPTSYNPLDEPSPLGLRLKKSPSLLDLIQMRLSQQE  87

Query  450  MSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLV  629
             SK           A+++   KLKASNFP +ILKIG+WEYKSRYEGDLVAKCYFAKHKLV
Sbjct  88   ESKKKDQKASAASAASAAADSKLKASNFPGTILKIGTWEYKSRYEGDLVAKCYFAKHKLV  147

Query  630  WEVLDGGLK  656
            WEVLDG LK
Sbjct  148  WEVLDGCLK  156



>ref|XP_008381124.1| PREDICTED: uncharacterized protein LOC103443996 [Malus domestica]
Length=500

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 71/89 (80%), Gaps = 3/89 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEY  569
            +KSPS LDLIQM+LSQ K  K     GK+  K  A S  S+KLKA NFPAS+L+IG+WEY
Sbjct  62   KKSPSFLDLIQMKLSQEKSXKLA-TLGKRSHKGAAASGASDKLKAMNFPASLLRIGTWEY  120

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  121  KSRYEGDLVAKCYFAKHKLVWEVLDGSLK  149



>gb|AGV54845.1| hypothetical protein [Phaseolus vulgaris]
Length=597

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 92/129 (71%), Gaps = 3/129 (2%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL +P +        D    P   YNPL+EPSPLGL L+KSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLETPPKCDSS---DDSLSIPPTSYNPLDEPSPLGLRLKKSPSLLDLIQMRLSQQE  87

Query  450  MSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLV  629
             SK           A+++   KLKASNFP +ILKIG+WEYKSRYEGDLVAKCYFAKHKLV
Sbjct  88   ESKKKDQKASAASAASAAADSKLKASNFPGTILKIGTWEYKSRYEGDLVAKCYFAKHKLV  147

Query  630  WEVLDGGLK  656
            WEVLDG LK
Sbjct  148  WEVLDGCLK  156



>ref|XP_003530210.1| PREDICTED: uncharacterized protein LOC100808320 isoform X1 [Glycine 
max]
Length=599

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 100/139 (72%), Gaps = 19/139 (14%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL SP   + G        PP   YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLESP--PKCGASDESISIPPA-SYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQQE  87

Query  450  MSKAGGNPGKKEQKANSSTSE----------KLKASNFPASILKIGSWEYKSRYEGDLVA  599
             SK      KK+QKA+SS+S           KLKASNFP +ILKIG+WEYKSRYEGDLVA
Sbjct  88   ESK------KKDQKASSSSSVAAAAAAAADSKLKASNFPGTILKIGNWEYKSRYEGDLVA  141

Query  600  KCYFAKHKLVWEVLDGGLK  656
            KCYFAKHKLVWEVLDG LK
Sbjct  142  KCYFAKHKLVWEVLDGCLK  160



>ref|XP_010438134.1| PREDICTED: uncharacterized protein LOC104721765 [Camelina sativa]
Length=587

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 101/155 (65%), Gaps = 32/155 (21%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVV--QYNpleepsplglslRKSPSLLDLIQM  431
            H PLNKRSKL S          S     P+V  +YNPL+EPSPLGLSLRKSPSLL+LIQM
Sbjct  39   HAPLNKRSKLWS----------SGGSSSPMVPAKYNPLDEPSPLGLSLRKSPSLLELIQM  88

Query  432  RLSQGKMSKAGGNPG-------KKEQKANSSTS-------------EKLKASNFPASILK  551
            RL+     K+   PG       KKE K   + S             EKLKASNFPAS+LK
Sbjct  89   RLTHCGDPKSETMPGCAVGSGVKKESKGIGAASAASVGSTLAPGSIEKLKASNFPASLLK  148

Query  552  IGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  149  IGQWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  183



>ref|XP_004956336.1| PREDICTED: uncharacterized protein LOC101782755 [Setaria italica]
Length=519

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 8/88 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA-NSSTSEKLKASNFPASILKIGSWEYK  572
            RKSPSLLDL+QM+L+Q        N G + ++A N+  SEKLKASNFP S+L+IGSWE+ 
Sbjct  76   RKSPSLLDLVQMKLAQA-------NKGTEARQAINTGASEKLKASNFPGSVLRIGSWEWV  128

Query  573  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  129  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  156



>ref|XP_007138292.1| hypothetical protein PHAVU_009G196100g [Phaseolus vulgaris]
 gb|ESW10286.1| hypothetical protein PHAVU_009G196100g [Phaseolus vulgaris]
Length=534

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 99/142 (70%), Gaps = 13/142 (9%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGP NKR K SS    Q     SD         N L+EPSPLGL LRKSPSLLDLIQM+L
Sbjct  38   HGPFNKRHKPSS----QQWSASSDASVSSPSNLNILDEPSPLGLRLRKSPSLLDLIQMKL  93

Query  438  SQGKMSKAGG-NPGKKEQK--------ANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            SQG + +    +PG K +         A S+ ++KLKASNFPA +L+IGSWEYKSRYEGD
Sbjct  94   SQGTVQQDENLSPGVKRESRAATAAASAASAAADKLKASNFPALLLRIGSWEYKSRYEGD  153

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWEVL+GGLK
Sbjct  154  LVAKCYFAKHKLVWEVLEGGLK  175



>ref|XP_010432947.1| PREDICTED: uncharacterized protein LOC104717115 [Camelina sativa]
Length=591

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 123/194 (63%), Gaps = 35/194 (18%)
 Frame = +3

Query  147  MVFLMKTGEMAPE--LDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIG  320
            MV + K+G + PE  L  +    +PVKLE+  DD  EE H P NKRSKL S         
Sbjct  1    MVEMRKSGGLRPESELAAKCRDELPVKLEIAEDDLEEE-HAPFNKRSKLWS---------  50

Query  321  VSDFREPPVV--QYNpleepsplglslRKSPSLLDLIQMRL-------SQGKMSKAGGNP  473
             S     P+V  +YNPL+EPSPLGLSLRKSPSLL+LIQMRL       S+   + A G+ 
Sbjct  51   -SGGSSSPMVPAKYNPLDEPSPLGLSLRKSPSLLELIQMRLTHCGDPKSETMQAGAVGSG  109

Query  474  GKKEQKANSSTS-------------EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
             KKE K   + S             EKLKASNFPAS+LKIG WEYKSRYEGDLVAKCYFA
Sbjct  110  VKKESKGIGAASAASVGSTLAPGSIEKLKASNFPASLLKIGQWEYKSRYEGDLVAKCYFA  169

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVL+ GLK
Sbjct  170  KHKLVWEVLEQGLK  183



>emb|CDP19486.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 85/105 (81%), Gaps = 3/105 (3%)
 Frame = +3

Query  348  VQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLK  521
             QYNPL+EP PLGL LRKSPSLL+LIQMRLSQ    K G +  KKE K  A S +SEKLK
Sbjct  46   AQYNPLDEPRPLGLRLRKSPSLLELIQMRLSQANSPK-GASSSKKELKGAAASGSSEKLK  104

Query  522  ASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            ASNFPA+IL+IG+ EYKSRY GDLVAKCYFAKHKLV EVLDGG K
Sbjct  105  ASNFPATILRIGTREYKSRYGGDLVAKCYFAKHKLVREVLDGGHK  149



>ref|XP_004242622.1| PREDICTED: uncharacterized protein LOC101251694 [Solanum lycopersicum]
Length=533

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 99/142 (70%), Gaps = 11/142 (8%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQ--HQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQM  431
            HGPL KRSKLSS     +Q   G  +   PP  +YNPL+EPSPLGL LRKSPSLLDLI M
Sbjct  27   HGPLTKRSKLSSASSSFNQWDAGNDELPVPPP-EYNPLDEPSPLGLKLRKSPSLLDLITM  85

Query  432  RLSQGKMSKAG-------GNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGD  590
            RLSQ   S           N G K   + S  ++KLKASNF  S+L+IG+WEY SRYEGD
Sbjct  86   RLSQNNASSTAPENPTSVSNTGTK-GASTSVATDKLKASNFSGSLLRIGTWEYASRYEGD  144

Query  591  LVAKCYFAKHKLVWEVLDGGLK  656
            LVAKCYFAKHKLVWE+L+GGLK
Sbjct  145  LVAKCYFAKHKLVWEILEGGLK  166



>gb|AFK36890.1| unknown [Lotus japonicus]
Length=397

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 67/87 (77%), Gaps = 3/87 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            RKSPSLLDLIQMR SQ   S+ G   G       ++   KLKASNFP ++LKIG+WEYKS
Sbjct  73   RKSPSLLDLIQMRPSQQHDSRMGDQKGSG---GGAAADSKLKASNFPGTVLKIGTWEYKS  129

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  130  RYEGDLVAKCYFAKHKLVWEVLDGCLK  156



>ref|XP_006600521.1| PREDICTED: uncharacterized protein LOC100791924 [Glycine max]
Length=493

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 96/143 (67%), Gaps = 10/143 (7%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQ-HQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMR  434
            H P NKR K SS  Q  Q              QYN L+EPSPLGL LRKSPSLLDLIQM+
Sbjct  32   HAPPNKRFKSSSASQDEQWNASNGASSSSSPSQYNILDEPSPLGLRLRKSPSLLDLIQMK  91

Query  435  LSQGKMSKAGGNPG-------KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            LSQG +  A            KKE +  A S + EKLKASNFPAS+L+IGSWEYKS++EG
Sbjct  92   LSQGNVIIANTQDENFISSGLKKESRGAAASGSVEKLKASNFPASLLRIGSWEYKSKHEG  151

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAKCYFAK KLVWEV++G LK
Sbjct  152  DLVAKCYFAKQKLVWEVIEGELK  174



>ref|XP_009354222.1| PREDICTED: uncharacterized protein LOC103945389 [Pyrus x bretschneideri]
Length=497

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 70/89 (79%), Gaps = 3/89 (3%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEY  569
            +KSPS LDLIQM+LSQ K  K     GK+  K  A S   +KLKA NFPAS+L+IG+WEY
Sbjct  62   KKSPSFLDLIQMKLSQQKSDKLA-TLGKRSHKGAAASGAPDKLKAMNFPASLLRIGTWEY  120

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  121  KSRYEGDLVAKCYFAKHKLVWEVLDGSLK  149



>ref|XP_008462951.1| PREDICTED: uncharacterized protein LOC103501212 [Cucumis melo]
Length=516

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 73/89 (82%), Gaps = 4/89 (4%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS--STSEKLKASNFPASILKIGSWEY  569
            +KSPSLLDLIQ +LSQ   +   G   KK+QK  +  +T++KLKASNFPA ILKIG+WEY
Sbjct  74   KKSPSLLDLIQAKLSQE--TAKLGTLSKKDQKGGNAFTTADKLKASNFPALILKIGTWEY  131

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  132  KSRYEGDLVAKCYFAKHKLVWELLDGNLK  160



>ref|XP_008790125.1| PREDICTED: uncharacterized protein LOC103707426 isoform X1 [Phoenix 
dactylifera]
Length=502

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 99/143 (69%), Gaps = 10/143 (7%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGP +K+S+ +S  Q Q      D      + YN L+EPSPLGL LRKSPSLLDLIQMRL
Sbjct  13   HGPFSKKSRNASLPQQQGRDSEFDMVLLQGMPYNILDEPSPLGLRLRKSPSLLDLIQMRL  72

Query  438  SQ---GKMS----KAGGNPGKKEQ---KANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            SQ   G MS        + GKK      A S T++KLKASNFPA +L+IG+WE +S+YEG
Sbjct  73   SQVNSGTMSCILASENADSGKKIDFKFDAVSGTTDKLKASNFPAILLRIGTWERESKYEG  132

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAK YFAKHKLVWEVL+GGLK
Sbjct  133  DLVAKIYFAKHKLVWEVLEGGLK  155



>ref|NP_565562.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK68836.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL06884.1| At2g24100/F27D4.1 [Arabidopsis thaliana]
 gb|AAP49526.1| At2g24100 [Arabidopsis thaliana]
 gb|AEC07529.1| uncharacterized protein AT2G24100 [Arabidopsis thaliana]
Length=466

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 102/175 (58%), Gaps = 25/175 (14%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +M++     +    R    PVKLE+  D   EE H PLNKRSKL S      G  VS
Sbjct  1    MVEMMRSENHLRQASKHRNNNFPVKLEIIEDSLEEE-HAPLNKRSKLWSN-----GTSVS  54

Query  327  DF---REPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKA-  494
             F    EP  +  +            +KSPS  +LI+M+LSQ   S    N  KKE    
Sbjct  55   KFSLLEEPSPLGLSL-----------KKSPSFQELIEMKLSQ---SGDDSNSVKKESFGF  100

Query  495  -NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
                T EKLKASNFPA+IL+IG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  101  GGVGTVEKLKASNFPATILRIGQWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  155



>ref|XP_010447673.1| PREDICTED: uncharacterized protein LOC104730227 [Camelina sativa]
Length=587

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 104/156 (67%), Gaps = 33/156 (21%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVV--QYNpleepsplglslRKSPSLLDLIQM  431
            H P NKRSKL S          S     P+V  +YNPL+EPSPLGLSLRKSPSLL+LIQM
Sbjct  39   HAPFNKRSKLWS----------SGGSSSPMVPAKYNPLDEPSPLGLSLRKSPSLLELIQM  88

Query  432  RL-----SQGKMSKAGGNPG---KKEQKANSSTS-------------EKLKASNFPASIL  548
            RL     S+ +  +AGG  G   KKE K  ++ S             EKLKASNFPAS+L
Sbjct  89   RLTHCGDSKSETMQAGGAVGSGVKKESKGLAAASAASVGSSLAPGSIEKLKASNFPASLL  148

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIG WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  149  KIGQWEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  184



>ref|XP_008342829.1| PREDICTED: uncharacterized protein LOC103405596 [Malus domestica]
 ref|XP_008362425.1| PREDICTED: uncharacterized protein LOC103426114 [Malus domestica]
Length=496

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 94/134 (70%), Gaps = 11/134 (8%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
            GP +KR KL S  Q    +  S         Y+PL+EPSPLGL L+KSPS LDLIQM+LS
Sbjct  25   GPSHKRLKLDSSPQMPGDVDAS--------VYHPLDEPSPLGLQLKKSPSFLDLIQMKLS  76

Query  441  QGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFA  614
            Q   +K     GK+  K  A S   +KLKA NFPAS+L+IG+WEYKSRYEGDLVAKCYFA
Sbjct  77   QEXSAKLA-TLGKRSHKGAAASGAPDKLKAMNFPASLLRIGTWEYKSRYEGDLVAKCYFA  135

Query  615  KHKLVWEVLDGGLK  656
            KHKLVWEVLDG LK
Sbjct  136  KHKLVWEVLDGSLK  149



>ref|XP_009345909.1| PREDICTED: uncharacterized protein LOC103937692, partial [Pyrus 
x bretschneideri]
Length=512

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 96/126 (76%), Gaps = 10/126 (8%)
 Frame = +3

Query  306  QVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKM-------SKAG  464
            Q  +G ++F   P  QYNPL+EPSPLGL LRKSPSLL+LIQM+L+QG         SK  
Sbjct  11   QRSVGDNEFAVQPS-QYNPLDEPSPLGLRLRKSPSLLELIQMKLAQGSASAAGATESKNL  69

Query  465  GNPGKKEQKANS--STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEV  638
             +  KKE KAN+   T +KLKASNFPAS+L+IG WEYKSRYEGDLVAKCYFAKHKLVWEV
Sbjct  70   NSGVKKECKANAPLGTVDKLKASNFPASLLRIGGWEYKSRYEGDLVAKCYFAKHKLVWEV  129

Query  639  LDGGLK  656
            L GGLK
Sbjct  130  LKGGLK  135



>gb|KEH28578.1| hypothetical protein MTR_4g007710 [Medicago truncatula]
Length=525

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +3

Query  348  VQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSE-KLKA  524
            + YNPL+EPSPLGL L+KSPSLLDLIQM+LSQ   SK     G     A ++ ++ KLKA
Sbjct  55   ISYNPLDEPSPLGLRLKKSPSLLDLIQMKLSQTYESKKKDQKGSASASAAAAAADSKLKA  114

Query  525  SNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            SNFPA++LKIG+WEYKSRYEGDLVAKCYFAKHKLVWEVLDG LK
Sbjct  115  SNFPATVLKIGTWEYKSRYEGDLVAKCYFAKHKLVWEVLDGCLK  158



>ref|XP_009399571.1| PREDICTED: uncharacterized protein LOC103983938 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399572.1| PREDICTED: uncharacterized protein LOC103983938 [Musa acuminata 
subsp. malaccensis]
Length=517

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 97/144 (67%), Gaps = 24/144 (17%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGPLNKRSK +S    Q             + YN LEEP PLGL LRKSPSL DLIQMRL
Sbjct  37   HGPLNKRSKDASYPNQQA------------MYYNVLEEPGPLGLRLRKSPSLADLIQMRL  84

Query  438  SQGKM-----------SKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYE  584
            SQ K            S+ G N   K   A+SS++ K+KASNFPA++L+IG+WE  SRYE
Sbjct  85   SQAKSGGTSCATSLGSSEVGDNKELKSSAASSSSN-KIKASNFPATLLRIGTWERVSRYE  143

Query  585  GDLVAKCYFAKHKLVWEVLDGGLK  656
            GDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  144  GDLVAKCYFAKHKLVWEVLEGGLK  167



>gb|KCW70846.1| hypothetical protein EUGRSUZ_F03986 [Eucalyptus grandis]
Length=480

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
             P +KR +L  PLQ+ +  G   F  PP V YNPL EPSPLGL L+KS S ++L+QM+L+
Sbjct  30   APSDKRPRLGFPLQNDLVSG-DIFGIPPAV-YNPLSEPSPLGLRLKKSESFVELVQMKLT  87

Query  441  QGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
            +   SK+  + G K  K  ++  +KLKASNF AS+LKIG+WEY+SRYEGDLV KCYFAKH
Sbjct  88   EEHTSKSSTS-GNKTHKGVAT--DKLKASNFIASVLKIGTWEYRSRYEGDLVGKCYFAKH  144

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDG LK
Sbjct  145  KLVWEVLDGALK  156



>ref|XP_010063614.1| PREDICTED: uncharacterized protein LOC104450653 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70847.1| hypothetical protein EUGRSUZ_F03986 [Eucalyptus grandis]
Length=506

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 97/132 (73%), Gaps = 5/132 (4%)
 Frame = +3

Query  261  GPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLS  440
             P +KR +L  PLQ+ +  G   F  PP V YNPL EPSPLGL L+KS S ++L+QM+L+
Sbjct  30   APSDKRPRLGFPLQNDLVSG-DIFGIPPAV-YNPLSEPSPLGLRLKKSESFVELVQMKLT  87

Query  441  QGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKH  620
            +   SK+  + G K  K  ++  +KLKASNF AS+LKIG+WEY+SRYEGDLV KCYFAKH
Sbjct  88   EEHTSKSSTS-GNKTHKGVAT--DKLKASNFIASVLKIGTWEYRSRYEGDLVGKCYFAKH  144

Query  621  KLVWEVLDGGLK  656
            KLVWEVLDG LK
Sbjct  145  KLVWEVLDGALK  156



>ref|XP_008790126.1| PREDICTED: uncharacterized protein LOC103707426 isoform X2 [Phoenix 
dactylifera]
Length=490

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 91/143 (64%), Gaps = 22/143 (15%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGP +K+S+ +S L  Q G+  +   EP  +               RKSPSLLDLIQMRL
Sbjct  13   HGPFSKKSRNAS-LPQQQGMPYNILDEPSPLGLRL-----------RKSPSLLDLIQMRL  60

Query  438  SQ---GKMS----KAGGNPGKKEQ---KANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            SQ   G MS        + GKK      A S T++KLKASNFPA +L+IG+WE +S+YEG
Sbjct  61   SQVNSGTMSCILASENADSGKKIDFKFDAVSGTTDKLKASNFPAILLRIGTWERESKYEG  120

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAK YFAKHKLVWEVL+GGLK
Sbjct  121  DLVAKIYFAKHKLVWEVLEGGLK  143



>gb|KFK41360.1| hypothetical protein AALP_AA2G119900 [Arabis alpina]
Length=443

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 110/170 (65%), Gaps = 30/170 (18%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVS  326
            MV +MK   M PE  ++    +PVKLE+  D   EE HGPLNKRSKL      + G  +S
Sbjct  1    MVEMMKPRYMLPE--FKPASKLPVKLEIVEDFLEEE-HGPLNKRSKL-----WRNGTNMS  52

Query  327  DFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSST  506
                P   +++ L+EPSPLGLSL+KSPS  DLIQMRLSQ                    T
Sbjct  53   -LMTP--TKFSLLDEPSPLGLSLKKSPSFQDLIQMRLSQ-------------------RT  90

Query  507  SEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             EKLKASNFPA++++IG WEYKSRYEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  91   VEKLKASNFPATVIRIGQWEYKSRYEGDLVAKCYFAKHKLVWEVLQQGLK  140



>gb|EEE69217.1| hypothetical protein OsJ_28438 [Oryza sativa Japonica Group]
Length=526

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 92/131 (70%), Gaps = 9/131 (7%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            P +KRS+L+  LQH    G S        Q+  L+EPSPLGL L+KSPSL+DLIQM+L Q
Sbjct  32   PFHKRSRLA--LQHWSTDGGS-VSNQQSSQHGFLDEPSPLGLRLKKSPSLVDLIQMKLVQ  88

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
                   G     +    +S SEKLKASNFP S+L+IGSWE+ SRYEGDLVAKCYFAKHK
Sbjct  89   A------GKAKDVQHSGTASASEKLKASNFPGSVLRIGSWEWVSRYEGDLVAKCYFAKHK  142

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  143  LVWEVLDGGLK  153



>dbj|BAK07465.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=344

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 68/87 (78%), Gaps = 6/87 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +KSPSL+DLIQM+L Q   +K   + G       +S SEKLKASNFP SIL+IGSWE+ S
Sbjct  85   KKSPSLVDLIQMKLVQAGKAKDARHGG------TASASEKLKASNFPGSILRIGSWEWIS  138

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLV KCYFAKHKLVWEVLDGGLK
Sbjct  139  RYEGDLVVKCYFAKHKLVWEVLDGGLK  165



>ref|XP_004137649.1| PREDICTED: uncharacterized protein LOC101216149 [Cucumis sativus]
 ref|XP_004161411.1| PREDICTED: uncharacterized protein LOC101227277 [Cucumis sativus]
 gb|KGN58644.1| hypothetical protein Csa_3G710230 [Cucumis sativus]
Length=516

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 73/89 (82%), Gaps = 4/89 (4%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS--STSEKLKASNFPASILKIGSWEY  569
            +KSPSLLDLIQ +LSQ   +    +  KK+QK  +  +T++KLKASNFPA ILKIG+WEY
Sbjct  74   KKSPSLLDLIQAKLSQE--TAKLDSLSKKDQKGGNAFTTADKLKASNFPALILKIGTWEY  131

Query  570  KSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KSRYEGDLVAKCYFAKHKLVWE+LDG LK
Sbjct  132  KSRYEGDLVAKCYFAKHKLVWELLDGNLK  160



>ref|XP_002869363.1| hypothetical protein ARALYDRAFT_491676 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45622.1| hypothetical protein ARALYDRAFT_491676 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 102/152 (67%), Gaps = 27/152 (18%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H PL KRS+L SP      +  +        +YNPL+EPSPLGL+LRKSPSLL+LIQM +
Sbjct  40   HAPLTKRSRLWSPETSSSTMAPA--------KYNPLDEPSPLGLNLRKSPSLLELIQMTI  91

Query  438  SQ------GKMSKAG--GNPGKKEQKANSSTS-----------EKLKASNFPASILKIGS  560
            +        +  KAG  G+  KKE K+ ++ +           EKLKASNFPAS+LKIG 
Sbjct  92   THCGDRKAAQTLKAGALGSGLKKESKSIAAAASLGPTLAPGSIEKLKASNFPASLLKIGQ  151

Query  561  WEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            WEYKSRYEGDLVAKCYFAKHKLVWEVL+ GLK
Sbjct  152  WEYKSRYEGDLVAKCYFAKHKLVWEVLEQGLK  183



>gb|AAD03372.2| expressed protein [Arabidopsis thaliana]
Length=463

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 85/138 (62%), Gaps = 24/138 (17%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDF---REPPVVQYNpleepsplglslRKSPSLLDLIQ  428
            H PLNKRSKL S      G  VS F    EP  +  +            +KSPS  +LI+
Sbjct  34   HAPLNKRSKLWSN-----GTSVSKFSLLEEPSPLGLSL-----------KKSPSFQELIE  77

Query  429  MRLSQGKMSKAGGNPGKKEQKA--NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAK  602
            M+LSQ   S    N  KKE        T EKLKASNFPA+IL+IG WEYKSRYEGDLVAK
Sbjct  78   MKLSQ---SGDDSNSVKKESFGFGGVGTVEKLKASNFPATILRIGQWEYKSRYEGDLVAK  134

Query  603  CYFAKHKLVWEVLDGGLK  656
            CYFAKHKLVWEVL+ GLK
Sbjct  135  CYFAKHKLVWEVLEQGLK  152



>gb|KEH32610.1| hypothetical protein MTR_4g130310 [Medicago truncatula]
Length=495

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 84/137 (61%), Gaps = 26/137 (19%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVG-IGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMR  434
            H PLNKR K ++ + ++   +G+S                      LRKSPSLLDLIQM 
Sbjct  37   HAPLNKRHKATNDILNEPSPLGLS----------------------LRKSPSLLDLIQMT  74

Query  435  LSQGK---MSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            L Q      + A  N   K  K   ++ EKLKASNFPA+ LKIGSWEYKS+YEGDLVAKC
Sbjct  75   LCQENSVNANTANDNLNSKANKNGRASVEKLKASNFPATHLKIGSWEYKSKYEGDLVAKC  134

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAK KLVWEVL+G LK
Sbjct  135  YFAKQKLVWEVLEGELK  151



>ref|XP_003610264.1| hypothetical protein MTR_4g130310 [Medicago truncatula]
 gb|AES92461.1| hypothetical protein MTR_4g130310 [Medicago truncatula]
 gb|AFK36705.1| unknown [Medicago truncatula]
Length=496

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 84/137 (61%), Gaps = 26/137 (19%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVG-IGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMR  434
            H PLNKR K ++ + ++   +G+S                      LRKSPSLLDLIQM 
Sbjct  37   HAPLNKRHKATNDILNEPSPLGLS----------------------LRKSPSLLDLIQMT  74

Query  435  LSQGK---MSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            L Q      + A  N   K  K   ++ EKLKASNFPA+ LKIGSWEYKS+YEGDLVAKC
Sbjct  75   LCQENSVNANTANDNLNSKANKNGRASVEKLKASNFPATHLKIGSWEYKSKYEGDLVAKC  134

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAK KLVWEVL+G LK
Sbjct  135  YFAKQKLVWEVLEGELK  151



>ref|XP_004954197.1| PREDICTED: uncharacterized protein LOC101774512 isoform X2 [Setaria 
italica]
Length=348

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 73/96 (76%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSK--------AGGNPGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQM+LSQ K ++            P KK+ K+ + T+ E++KASNF A++L
Sbjct  64   RKSPSLLDLIQMKLSQAKSAREQFDVHNSTSDTPRKKDVKSGAPTAGERMKASNFHANVL  123

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIG+WEY SRYEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  124  KIGNWEYISRYEGDLVAKCYFAKHKLVWEVLHDGLK  159



>gb|EMS63081.1| hypothetical protein TRIUR3_18987 [Triticum urartu]
Length=530

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 68/87 (78%), Gaps = 6/87 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +KSPSL+DLIQM+L Q   +K   + G       +S SEKLKASNFP SIL+IGSWE+ S
Sbjct  80   KKSPSLVDLIQMKLVQAGKAKDARHGG------TASASEKLKASNFPGSILRIGSWEWVS  133

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLV KCYFAKHKLVWEVLDGGLK
Sbjct  134  RYEGDLVVKCYFAKHKLVWEVLDGGLK  160



>ref|XP_009418539.1| PREDICTED: uncharacterized protein LOC103998710 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=479

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 10/114 (9%)
 Frame = +3

Query  345  VVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAG---GNPGKKEQKANSSTS--  509
            V+Q N L EPSPLGL LRKSPSL+DLIQMRLSQ   +       +   + +K N + S  
Sbjct  6    VIQNNLLNEPSPLGLRLRKSPSLVDLIQMRLSQANAAANSCILNDENLENEKKNDTRSTI  65

Query  510  -----EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
                 EKLKASNFPAS+L+IG+WEY SRYEGDLVAKCYFAK KLVWE+L+GGLK
Sbjct  66   ALANTEKLKASNFPASLLRIGTWEYVSRYEGDLVAKCYFAKRKLVWEILEGGLK  119



>ref|XP_006664800.1| PREDICTED: uncharacterized protein LOC102717582 [Oryza brachyantha]
Length=511

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 66/87 (76%), Gaps = 6/87 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +KSPSL+DLIQM+L Q       G     +     S SEKLKASNFP S+LKIGSWE+ S
Sbjct  66   KKSPSLVDLIQMKLVQA------GKAKDVQHGGTVSASEKLKASNFPGSLLKIGSWEWVS  119

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  120  RYEGDLVAKCYFAKHKLVWEVLDGGLK  146



>ref|XP_003577010.1| PREDICTED: uncharacterized protein LOC100845837 [Brachypodium 
distachyon]
Length=524

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 68/87 (78%), Gaps = 6/87 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +KSPSL+DLIQM+L Q   +K   + G       +S SEKLKASNFP SIL+IGSWE+ S
Sbjct  79   KKSPSLVDLIQMKLLQAGKAKESLHCG------TASASEKLKASNFPGSILRIGSWEWVS  132

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLV KCYFAKHKLVWEVLDGGLK
Sbjct  133  RYEGDLVVKCYFAKHKLVWEVLDGGLK  159



>ref|XP_002878722.1| hypothetical protein ARALYDRAFT_481267 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54981.1| hypothetical protein ARALYDRAFT_481267 [Arabidopsis lyrata subsp. 
lyrata]
Length=457

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 86/140 (61%), Gaps = 28/140 (20%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDF---REPPVVQYNpleepsplglslRKSPSLLDLIQ  428
            H PLNKRSK+ S      G  VS F    EP  +  +            +KSPS  +LIQ
Sbjct  28   HAPLNKRSKIWS----NNGTSVSKFSLLEEPSPLGLSL-----------KKSPSFQELIQ  72

Query  429  MRLSQGKMSKAGGNPGKKEQKANSS----TSEKLKASNFPASILKIGSWEYKSRYEGDLV  596
            M+LSQ       G+  K  +K +      T EKLKASNFPA++L+IG WEYKSRYEGDLV
Sbjct  73   MKLSQS------GDDTKSVKKESFGFGIGTVEKLKASNFPATVLRIGQWEYKSRYEGDLV  126

Query  597  AKCYFAKHKLVWEVLDGGLK  656
            AKCYFAKHKLVWEVL+ GLK
Sbjct  127  AKCYFAKHKLVWEVLEQGLK  146



>ref|XP_010544349.1| PREDICTED: uncharacterized protein LOC104816994 [Tarenaya hassleriana]
Length=448

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 68/87 (78%), Gaps = 11/87 (13%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +KSPS LD I+MRLSQ   SK      KKE       ++KLKASNFPAS++KIG+WEYKS
Sbjct  63   KKSPSFLDFIKMRLSQQNSSKR-----KKE------AADKLKASNFPASLVKIGTWEYKS  111

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLV KCYFAKHKLVWE+LDGGLK
Sbjct  112  RYEGDLVGKCYFAKHKLVWEMLDGGLK  138



>ref|XP_004954196.1| PREDICTED: uncharacterized protein LOC101774512 isoform X1 [Setaria 
italica]
Length=504

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 73/96 (76%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSK--------AGGNPGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQM+LSQ K ++            P KK+ K+ + T+ E++KASNF A++L
Sbjct  64   RKSPSLLDLIQMKLSQAKSAREQFDVHNSTSDTPRKKDVKSGAPTAGERMKASNFHANVL  123

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIG+WEY SRYEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  124  KIGNWEYISRYEGDLVAKCYFAKHKLVWEVLHDGLK  159



>gb|EMT03088.1| hypothetical protein F775_10227 [Aegilops tauschii]
Length=658

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 68/87 (78%), Gaps = 6/87 (7%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            +KSPSL+DLIQM+L Q   +K   + G       +S SEKLKASNFP S+L+IGSWE+ S
Sbjct  74   KKSPSLVDLIQMKLVQAGKAKDAQHGG------TASASEKLKASNFPGSVLRIGSWEWVS  127

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            RYEGDLV KCYFAKHKLVWEVLDGGLK
Sbjct  128  RYEGDLVVKCYFAKHKLVWEVLDGGLK  154



>ref|XP_010235910.1| PREDICTED: uncharacterized protein LOC100824406 isoform X2 [Brachypodium 
distachyon]
Length=465

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS---KAGGN-----PGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQ  LS+ K +    A GN     P KKE +  + T+ E+LKASNFPA+ L
Sbjct  26   RKSPSLLDLIQTSLSKAKSAPGQSATGNSISGPPIKKESRTGALTAGERLKASNFPATFL  85

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIG+WEY S YEGDLVAKCY+AKHK+VWEV+D GLK
Sbjct  86   KIGAWEYTSEYEGDLVAKCYYAKHKIVWEVMDCGLK  121



>ref|XP_010235911.1| PREDICTED: uncharacterized protein LOC100824406 isoform X3 [Brachypodium 
distachyon]
Length=386

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS---KAGGN-----PGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQ  LS+ K +    A GN     P KKE +  + T+ E+LKASNFPA+ L
Sbjct  45   RKSPSLLDLIQTSLSKAKSAPGQSATGNSISGPPIKKESRTGALTAGERLKASNFPATFL  104

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIG+WEY S YEGDLVAKCY+AKHK+VWEV+D GLK
Sbjct  105  KIGAWEYTSEYEGDLVAKCYYAKHKIVWEVMDCGLK  140



>gb|EEC84117.1| hypothetical protein OsI_30449 [Oryza sativa Indica Group]
Length=526

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 91/131 (69%), Gaps = 9/131 (7%)
 Frame = +3

Query  264  PLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQ  443
            P +KRS+L+  LQH    G S        Q+  L+EPSPLGL L+KSPSL+DLIQM+L Q
Sbjct  32   PFHKRSRLA--LQHWSTDGGS-VSNQQSSQHGFLDEPSPLGLRLKKSPSLVDLIQMKLVQ  88

Query  444  GKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHK  623
                   G     +    +S SEKLKASNF  S+L+IGSWE+ SRYEGDLVAKCYFAKHK
Sbjct  89   A------GKAKDVQHSGTASASEKLKASNFSGSVLRIGSWEWVSRYEGDLVAKCYFAKHK  142

Query  624  LVWEVLDGGLK  656
            LVWEVLDGGLK
Sbjct  143  LVWEVLDGGLK  153



>ref|XP_004507763.1| PREDICTED: uncharacterized protein LOC101495701 isoform X1 [Cicer 
arietinum]
 ref|XP_004507764.1| PREDICTED: uncharacterized protein LOC101495701 isoform X2 [Cicer 
arietinum]
Length=544

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 109/160 (68%), Gaps = 11/160 (7%)
 Frame = +3

Query  210  VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplgl  389
            VP+ ++ E++D +EEEH PLNKR K+SS    Q  +          ++ + L+EPSPLGL
Sbjct  21   VPMTVKFEIEDSIEEEHAPLNKRCKISSSSHQQWSVSNDASLSSSALENSILDEPSPLGL  80

Query  390  slRKSPSLLDLIQMRLSQGKMSKAGG------NPG-KKEQKANSST----SEKLKASNFP  536
             L+KS S LDLI+  LS+G  S          N G KKE +  ++     +EKLKASNFP
Sbjct  81   RLKKSHSFLDLIETMLSKGNNSDIANTKSDHLNSGLKKETRGAAAAASGSNEKLKASNFP  140

Query  537  ASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            A++L+IGSWEYKS+YEGDLVAKCYFAKHKLVWEVL+G LK
Sbjct  141  ATLLRIGSWEYKSKYEGDLVAKCYFAKHKLVWEVLEGELK  180



>ref|XP_010235909.1| PREDICTED: uncharacterized protein LOC100824406 isoform X1 [Brachypodium 
distachyon]
Length=484

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 72/96 (75%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS---KAGGN-----PGKKEQKANSSTS-EKLKASNFPASIL  548
            RKSPSLLDLIQ  LS+ K +    A GN     P KKE +  + T+ E+LKASNFPA+ L
Sbjct  45   RKSPSLLDLIQTSLSKAKSAPGQSATGNSISGPPIKKESRTGALTAGERLKASNFPATFL  104

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIG+WEY S YEGDLVAKCY+AKHK+VWEV+D GLK
Sbjct  105  KIGAWEYTSEYEGDLVAKCYYAKHKIVWEVMDCGLK  140



>ref|XP_008443832.1| PREDICTED: uncharacterized protein LOC103487331 isoform X3 [Cucumis 
melo]
Length=536

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 10/97 (10%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGK-------KEQKANSS---TSEKLKASNFPASI  545
            RKSPSLLDLIQM+LSQG  S A G+          K +  +++   T+EKLKASNFPAS+
Sbjct  74   RKSPSLLDLIQMKLSQGSSSTAAGSSNAETFDFVVKSESQDATVPGTNEKLKASNFPASL  133

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            LKIG WEYKSR+EGDLVAKCY+AKHKLVWE+L+GGLK
Sbjct  134  LKIGRWEYKSRHEGDLVAKCYYAKHKLVWEILEGGLK  170



>emb|CDP21215.1| unnamed protein product [Coffea canephora]
Length=118

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 3/78 (4%)
 Frame = +3

Query  429  MRLSQGKMSKAGGNPGKKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAK  602
            MRLSQ    K G +  KKE K  A S +SEKLKASNFPA+IL+IG+WEYKSRYEGDLVAK
Sbjct  1    MRLSQANSPK-GASSSKKELKGAAASGSSEKLKASNFPATILRIGTWEYKSRYEGDLVAK  59

Query  603  CYFAKHKLVWEVLDGGLK  656
            CYFAKHKLV EVLDGGLK
Sbjct  60   CYFAKHKLVREVLDGGLK  77



>ref|XP_008443830.1| PREDICTED: uncharacterized protein LOC103487331 isoform X1 [Cucumis 
melo]
Length=549

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 10/97 (10%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGK-------KEQKANSS---TSEKLKASNFPASI  545
            RKSPSLLDLIQM+LSQG  S A G+          K +  +++   T+EKLKASNFPAS+
Sbjct  74   RKSPSLLDLIQMKLSQGSSSTAAGSSNAETFDFVVKSESQDATVPGTNEKLKASNFPASL  133

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            LKIG WEYKSR+EGDLVAKCY+AKHKLVWE+L+GGLK
Sbjct  134  LKIGRWEYKSRHEGDLVAKCYYAKHKLVWEILEGGLK  170



>ref|XP_008443831.1| PREDICTED: uncharacterized protein LOC103487331 isoform X2 [Cucumis 
melo]
Length=548

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 10/97 (10%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGK-------KEQKANSS---TSEKLKASNFPASI  545
            RKSPSLLDLIQM+LSQG  S A G+          K +  +++   T+EKLKASNFPAS+
Sbjct  73   RKSPSLLDLIQMKLSQGSSSTAAGSSNAETFDFVVKSESQDATVPGTNEKLKASNFPASL  132

Query  546  LKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            LKIG WEYKSR+EGDLVAKCY+AKHKLVWE+L+GGLK
Sbjct  133  LKIGRWEYKSRHEGDLVAKCYYAKHKLVWEILEGGLK  169



>emb|CAN68794.1| hypothetical protein VITISV_016174 [Vitis vinifera]
Length=1017

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 112/188 (60%), Gaps = 26/188 (14%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSP--LQHQVGIG  320
            MV +M  G  + E   +  K VPVK EVE  D    +     KR KL S   L  + G  
Sbjct  492  MVEVMSCGGTSAEYGKRCRKMVPVKSEVEDWDEPGLKQA--QKRLKLDSSQGLNQETGA-  548

Query  321  VSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS  500
                  PP+ QYN L+EPSPLGL L+KSPS LDLIQMRL+QG   K G + GKK  K   
Sbjct  549  ---LHIPPL-QYNLLDEPSPLGLQLKKSPSFLDLIQMRLTQGNAPKLG-SVGKKVTKGTP  603

Query  501  --STSEKLKASNFPASILKIGSWE--------------YKSRYEGDLVAKCYFAKHKLVW  632
              S SEKLKASNF ASIL+IG WE              Y SRYEGDLVAKCYFAKHKLVW
Sbjct  604  VISASEKLKASNFAASILRIGKWESMIFDANWNYTGLQYVSRYEGDLVAKCYFAKHKLVW  663

Query  633  EVLDGGLK  656
            E+LDG LK
Sbjct  664  EILDGSLK  671



>ref|XP_002452969.1| hypothetical protein SORBIDRAFT_04g035713 [Sorghum bicolor]
 gb|EES05945.1| hypothetical protein SORBIDRAFT_04g035713 [Sorghum bicolor]
Length=154

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 65/88 (74%), Gaps = 10/88 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKA-GGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYK  572
            RKSPSLLDLIQ +LSQ K +K   G P         +  E+ KASNFPA++L+IGSWEY 
Sbjct  12   RKSPSLLDLIQTKLSQAKSAKVRSGAP---------TAGERPKASNFPANVLRIGSWEYI  62

Query  573  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            S YEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  63   SHYEGDLVAKCYFAKHKLVWEVLHDGLK  90



>ref|XP_006649126.1| PREDICTED: uncharacterized protein LOC102706173 [Oryza brachyantha]
Length=495

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 8/88 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS-STSEKLKASNFPASILKIGSWEYK  572
            RKSPSLL+LIQMRL       A  N  K++ K  S +TSE++KAS+F A+ LKIG+WEYK
Sbjct  71   RKSPSLLELIQMRL-------AMENSNKRDIKPKSLATSERMKASSFVANFLKIGTWEYK  123

Query  573  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            S+YEGDLVAKCYFAKHKLVWE+LD GLK
Sbjct  124  SQYEGDLVAKCYFAKHKLVWEILDAGLK  151



>ref|XP_010905052.1| PREDICTED: uncharacterized protein LOC105032330 isoform X2 [Elaeis 
guineensis]
Length=511

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 85/143 (59%), Gaps = 22/143 (15%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGP +KRS+    L  Q G+      EP  +               RKSPSLLDLIQM+L
Sbjct  36   HGPFSKRSR-DDTLPQQQGMPYDILDEPSPLGLRL-----------RKSPSLLDLIQMKL  83

Query  438  SQ---GKMS----KAGGNPGKKEQ---KANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            SQ   G MS        + GKK      A S T++KLKASNFP  +L IG+WE  S+YEG
Sbjct  84   SQVNSGTMSCILASENTDNGKKIDFKFAAVSGTTDKLKASNFPVVLLTIGTWERVSKYEG  143

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAK YFAKHKLVWEVL+GGLK
Sbjct  144  DLVAKIYFAKHKLVWEVLEGGLK  166



>ref|XP_010905051.1| PREDICTED: uncharacterized protein LOC105032330 isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 95/143 (66%), Gaps = 10/143 (7%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            HGP +KRS+  +  Q Q      D      + Y+ L+EPSPLGL LRKSPSLLDLIQM+L
Sbjct  36   HGPFSKRSRDDTLPQQQGRESNFDMVLLQGMPYDILDEPSPLGLRLRKSPSLLDLIQMKL  95

Query  438  SQ---GKMS----KAGGNPGKKEQ---KANSSTSEKLKASNFPASILKIGSWEYKSRYEG  587
            SQ   G MS        + GKK      A S T++KLKASNFP  +L IG+WE  S+YEG
Sbjct  96   SQVNSGTMSCILASENTDNGKKIDFKFAAVSGTTDKLKASNFPVVLLTIGTWERVSKYEG  155

Query  588  DLVAKCYFAKHKLVWEVLDGGLK  656
            DLVAK YFAKHKLVWEVL+GGLK
Sbjct  156  DLVAKIYFAKHKLVWEVLEGGLK  178



>ref|XP_010472409.1| PREDICTED: uncharacterized protein LOC104752037 [Camelina sativa]
Length=457

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 91/135 (67%), Gaps = 15/135 (11%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H PL KR+KL S   ++ G+   +  E P          SPLGLSLRKSPS L+LIQMRL
Sbjct  28   HAPLYKRTKLWS---NRTGVSKFNLLEEP----------SPLGLSLRKSPSFLELIQMRL  74

Query  438  SQ-GKMSKAGGNPGKKEQKA-NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYF  611
            SQ G  + +  +  KKE       T EKLKASNF A++L+IG WEYK+ ++GDLVAKCYF
Sbjct  75   SQSGDDTTSETSRVKKESFGFGVGTVEKLKASNFHATVLRIGQWEYKAMHDGDLVAKCYF  134

Query  612  AKHKLVWEVLDGGLK  656
            AKHKLVWEVL+ GLK
Sbjct  135  AKHKLVWEVLEQGLK  149



>ref|XP_010417153.1| PREDICTED: uncharacterized protein LOC104702928 [Camelina sativa]
Length=447

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 95/137 (69%), Gaps = 17/137 (12%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            + PL KR+KL S      G GVS F        N LEEPSPLGLSLRKSPS L+LIQMR+
Sbjct  28   YAPLYKRTKLWSN-----GTGVSKF--------NLLEEPSPLGLSLRKSPSFLELIQMRI  74

Query  438  SQ-GKMSKAGGNPGKKEQKA---NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            SQ G  +K+  +  KKE         T EKLKASNF A++L+IG WEYK+ ++GDLVAKC
Sbjct  75   SQSGDDTKSETSCVKKESFGFGFGVGTVEKLKASNFHATVLRIGQWEYKAMHDGDLVAKC  134

Query  606  YFAKHKLVWEVLDGGLK  656
            YFAKHKLVWEVL+ GLK
Sbjct  135  YFAKHKLVWEVLEQGLK  151



>ref|XP_006585654.1| PREDICTED: uncharacterized protein LOC100808512 isoform X2 [Glycine 
max]
Length=604

 Score =   113 bits (282),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 93/135 (69%), Gaps = 8/135 (6%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL SP + Q G        PP   YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLESPPK-QCGSSDESLSIPPA-SYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQQE  88

Query  450  ------MSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYF  611
                     +  +       A ++   KLKASNFP +ILKIG+WEYKSRYEGDLVAKCYF
Sbjct  89   ESKKKDQKASSSSSSAAAAAAAAAADSKLKASNFPGTILKIGTWEYKSRYEGDLVAKCYF  148

Query  612  AKHKLVWEVLDGGLK  656
            AKHKLVWEVLDG LK
Sbjct  149  AKHKLVWEVLDGCLK  163



>ref|XP_006575319.1| PREDICTED: uncharacterized protein LOC100794550 isoform X1 [Glycine 
max]
Length=565

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 99/172 (58%), Gaps = 40/172 (23%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H PLNKR K SS  Q Q     S        QYN L+EPSPLGL LRKSPSLLDLI+M+L
Sbjct  31   HAPLNKRFKSSSTSQEQWNASNSASSSS-PSQYNILDEPSPLGLRLRKSPSLLDLIEMKL  89

Query  438  SQGKMSKAGGNPG-------KKEQK--ANSSTSEKLKASNFPASILKIGSWE--------  566
            SQG +  A            KKE +  A S + EKLKASNFPAS+L+IGSWE        
Sbjct  90   SQGNVIIANTQNENFLSSGLKKESRGAAASDSVEKLKASNFPASLLRIGSWEVYPRLLHV  149

Query  567  ----------------------YKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
                                  YKS++EGDLVAKCYFAKHKLVWEVL+G LK
Sbjct  150  TSILGKIIFHRVLLGLRFSLWQYKSKHEGDLVAKCYFAKHKLVWEVLEGELK  201



>ref|XP_010429365.1| PREDICTED: uncharacterized protein LOC104713849 [Camelina sativa]
Length=447

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 93/137 (68%), Gaps = 17/137 (12%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H PL KR+KL S      G GVS F        N LEEPSPLGLSLRKSPS L+L+QMRL
Sbjct  28   HAPLYKRAKLWSN-----GTGVSKF--------NLLEEPSPLGLSLRKSPSFLELVQMRL  74

Query  438  SQ-GKMSKAGGNPGKKEQKA---NSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKC  605
            SQ G  +K+  +  KKE         T EK KASNF A++L+IG WEYK+ ++GDLVAKC
Sbjct  75   SQSGDDTKSETSCVKKESFGFGFGVGTVEKFKASNFHATVLRIGQWEYKAMHDGDLVAKC  134

Query  606  YFAKHKLVWEVLDGGLK  656
            YFA HKLVWE+L+ GLK
Sbjct  135  YFATHKLVWELLEHGLK  151



>ref|XP_003531752.1| PREDICTED: uncharacterized protein LOC100808512 isoform X1 [Glycine 
max]
Length=603

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 92/135 (68%), Gaps = 9/135 (7%)
 Frame = +3

Query  270  NKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGK  449
            +KR KL SP   + G        PP   YNPL+EPSPLGL LRKSPSLLDLIQMRLSQ +
Sbjct  31   HKRPKLESP--PKCGSSDESLSIPPA-SYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQQE  87

Query  450  ------MSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYF  611
                     +  +       A ++   KLKASNFP +ILKIG+WEYKSRYEGDLVAKCYF
Sbjct  88   ESKKKDQKASSSSSSAAAAAAAAAADSKLKASNFPGTILKIGTWEYKSRYEGDLVAKCYF  147

Query  612  AKHKLVWEVLDGGLK  656
            AKHKLVWEVLDG LK
Sbjct  148  AKHKLVWEVLDGCLK  162



>ref|XP_008679230.1| PREDICTED: uncharacterized protein LOC103654180 [Zea mays]
Length=488

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (72%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS--------KAGGNPGKKEQKANSSTS-EKLKASNFPASIL  548
            RKS SL+DLIQ +L Q K +             P KKE ++ + T+ E++KASNFPA++L
Sbjct  70   RKSRSLVDLIQCKLFQDKSAHEQFDGHNNVSDTPMKKEVRSGAPTAGERMKASNFPANVL  129

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +IGSWEY S YEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  130  RIGSWEYISHYEGDLVAKCYFAKHKLVWEVLHNGLK  165



>gb|EYU37144.1| hypothetical protein MIMGU_mgv1a006661mg [Erythranthe guttata]
Length=436

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 9/85 (11%)
 Frame = +3

Query  429  MRLSQGKMSKAGGNPG-------KKEQKAN--SSTSEKLKASNFPASILKIGSWEYKSRY  581
            MRLSQG  +     P        KKE K +  SS ++KLKASNFPAS+L+IGSWEY S+Y
Sbjct  1    MRLSQGGSASVSMTPSEIADSGIKKEVKGSTASSANDKLKASNFPASLLRIGSWEYVSKY  60

Query  582  EGDLVAKCYFAKHKLVWEVLDGGLK  656
            EGDLVAKCYFAKHKLVWEVL+GGLK
Sbjct  61   EGDLVAKCYFAKHKLVWEVLEGGLK  85



>gb|AFW64169.1| hypothetical protein ZEAMMB73_443308 [Zea mays]
Length=596

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (72%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS--------KAGGNPGKKEQKANSSTS-EKLKASNFPASIL  548
            RKS SL+DLIQ +L Q K +             P KKE ++ + T+ E++KASNFPA++L
Sbjct  178  RKSRSLVDLIQCKLFQDKSAHEQFDGHNNVSDTPMKKEVRSGAPTAGERMKASNFPANVL  237

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +IGSWEY S YEGDLVAKCYFAKHKLVWEVL  GLK
Sbjct  238  RIGSWEYISHYEGDLVAKCYFAKHKLVWEVLHNGLK  273



>gb|EAY87838.1| hypothetical protein OsI_09259 [Oryza sativa Indica Group]
Length=492

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 8/88 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS-STSEKLKASNFPASILKIGSWEYK  572
            RKSPSLL+LIQM+L       A  N  K++ K+ S   SE++KASNF A  LKIG+WE  
Sbjct  74   RKSPSLLELIQMKL-------AMENTKKEDIKSRSLIASERVKASNFAADFLKIGTWECT  126

Query  573  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            S+YEGDLVAKCYFAKHKLVWEVLD GLK
Sbjct  127  SQYEGDLVAKCYFAKHKLVWEVLDAGLK  154



>ref|NP_001173180.1| Os02g0793800 [Oryza sativa Japonica Group]
 gb|EAZ24916.1| hypothetical protein OsJ_08696 [Oryza sativa Japonica Group]
 dbj|BAH91909.1| Os02g0793800 [Oryza sativa Japonica Group]
Length=492

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 8/88 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS-STSEKLKASNFPASILKIGSWEYK  572
            RKSPSLL+LIQM+L       A  N  K++ K+ S   SE++KASNF A  LKIG+WE  
Sbjct  74   RKSPSLLELIQMKL-------AMENTKKEDIKSRSLIASERVKASNFAADFLKIGTWECT  126

Query  573  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            S+YEGDLVAKCYFAKHKLVWEVLD GLK
Sbjct  127  SQYEGDLVAKCYFAKHKLVWEVLDAGLK  154



>ref|XP_006294201.1| hypothetical protein CARUB_v10023197mg [Capsella rubella]
 gb|EOA27099.1| hypothetical protein CARUB_v10023197mg [Capsella rubella]
Length=451

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 106/160 (66%), Gaps = 16/160 (10%)
 Frame = +3

Query  183  ELDWQRGKAVPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNp  362
            E+  +R    PVKLE+  D   EE + PL+KR+KL S      G GVS F        N 
Sbjct  3    EMMMRRASKFPVKLEIAEDSLEEE-YSPLHKRAKLWSN-----GTGVSKF--------NL  48

Query  363  leepsplglslRKSPSLLDLIQMRLSQ-GKMSKAGGNPGKKEQKA-NSSTSEKLKASNFP  536
            LEEPSPLGLSLRKSPSL +LIQMRLSQ G  + +     K+E       T EK KASNF 
Sbjct  49   LEEPSPLGLSLRKSPSLQELIQMRLSQTGDDTNSETGCVKRESFGFGVGTVEKHKASNFH  108

Query  537  ASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            A++L+IG WEYK++ +GDL+AKCYFAKHKLVWEVL+ GLK
Sbjct  109  ATVLRIGQWEYKAKNDGDLMAKCYFAKHKLVWEVLEQGLK  148



>dbj|BAD19195.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD19663.1| hypothetical protein [Oryza sativa Japonica Group]
Length=523

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 8/88 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANS-STSEKLKASNFPASILKIGSWEYK  572
            RKSPSLL+LIQM+L       A  N  K++ K+ S   SE++KASNF A  LKIG+WE  
Sbjct  105  RKSPSLLELIQMKL-------AMENTKKEDIKSRSLIASERVKASNFAADFLKIGTWECT  157

Query  573  SRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            S+YEGDLVAKCYFAKHKLVWEVLD GLK
Sbjct  158  SQYEGDLVAKCYFAKHKLVWEVLDAGLK  185



>gb|EPS64940.1| hypothetical protein M569_09843, partial [Genlisea aurea]
Length=259

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (71%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS-------KAGGNPGKKEQKA--NSSTSEKLKASNFPASIL  548
            RKSPSLL+LIQMRLS G  S           + GK+  K    S  SEK+KASNF A+ L
Sbjct  22   RKSPSLLELIQMRLSNGSSSSCSVTTSNGSESLGKRNVKGIQPSIASEKMKASNFNATSL  81

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +IGSWEY S+YEGDL+ KCYFAKHKLVWE+LDG LK
Sbjct  82   RIGSWEYVSKYEGDLLVKCYFAKHKLVWEILDGILK  117



>ref|XP_010063615.1| PREDICTED: uncharacterized protein LOC104450653 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010063616.1| PREDICTED: uncharacterized protein LOC104450653 isoform X2 [Eucalyptus 
grandis]
Length=423

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 3/76 (4%)
 Frame = +3

Query  429  MRLSQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCY  608
            M+L++   SK+  + G K  K  ++  +KLKASNF AS+LKIG+WEY+SRYEGDLV KCY
Sbjct  1    MKLTEEHTSKSSTS-GNKTHKGVAT--DKLKASNFIASVLKIGTWEYRSRYEGDLVGKCY  57

Query  609  FAKHKLVWEVLDGGLK  656
            FAKHKLVWEVLDG LK
Sbjct  58   FAKHKLVWEVLDGALK  73



>ref|XP_011087483.1| PREDICTED: uncharacterized protein LOC105168950 isoform X2 [Sesamum 
indicum]
Length=337

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 11/98 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK----------MSKAGGNPGKKEQKANSS-TSEKLKASNFPAS  542
            RK+PS L+L+Q  LS+GK          +S+    P +K   + S   SEKLKASNFPA+
Sbjct  64   RKTPSFLNLVQRCLSKGKQPDFSSRNNHVSRHDHKPRRKTDDSGSQPMSEKLKASNFPAT  123

Query  543  ILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +KIG+W+  +R+EGDLVAK Y+AK KLVWEVLDG LK
Sbjct  124  FIKIGTWQRMTRHEGDLVAKLYYAKRKLVWEVLDGALK  161



>gb|KHN17516.1| hypothetical protein glysoja_005713 [Glycine soja]
Length=476

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 9/85 (11%)
 Frame = +3

Query  429  MRLSQGKMSKAGGNPG-------KKEQK--ANSSTSEKLKASNFPASILKIGSWEYKSRY  581
            M+LSQG +  A            KKE +  A S + EKLKASNFPAS+L+IGSWEYKS++
Sbjct  1    MKLSQGNVIIANTQDENFISSGLKKESRGAAASGSVEKLKASNFPASLLRIGSWEYKSKH  60

Query  582  EGDLVAKCYFAKHKLVWEVLDGGLK  656
            EGDLVAKCYFAK KLVWEV++G LK
Sbjct  61   EGDLVAKCYFAKQKLVWEVIEGELK  85



>ref|XP_011087482.1| PREDICTED: uncharacterized protein LOC105168950 isoform X1 [Sesamum 
indicum]
Length=453

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 11/98 (11%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGK----------MSKAGGNPGKKEQKANSS-TSEKLKASNFPAS  542
            RK+PS L+L+Q  LS+GK          +S+    P +K   + S   SEKLKASNFPA+
Sbjct  64   RKTPSFLNLVQRCLSKGKQPDFSSRNNHVSRHDHKPRRKTDDSGSQPMSEKLKASNFPAT  123

Query  543  ILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +KIG+W+  +R+EGDLVAK Y+AK KLVWEVLDG LK
Sbjct  124  FIKIGTWQRMTRHEGDLVAKLYYAKRKLVWEVLDGALK  161



>emb|CAC84497.1| hypothetical protein [Pinus pinaster]
Length=197

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +3

Query  492  ANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            A  +  +KLKASNFP S L+IG+WE  SRYEGDLVAKCYFAKHKLVWEVLDGGLK
Sbjct  9    AAQNNPDKLKASNFPVSNLRIGTWECISRYEGDLVAKCYFAKHKLVWEVLDGGLK  63



>gb|EMT18992.1| hypothetical protein F775_00285 [Aegilops tauschii]
Length=458

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 66/108 (61%), Gaps = 23/108 (21%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTSE---------------------  512
            +KSPS +DLI M LS+   +K   N  K+     +ST E                     
Sbjct  144  KKSPSFVDLICMCLSKENSTKE--NSTKEISTKENSTKEISTKGRSAMKDIVSKPPLKKD  201

Query  513  KLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             +KASNFPA+ LKIG+WEY S+YEGDLVAKCY+AKHKLVWEVL+ GLK
Sbjct  202  VVKASNFPANFLKIGNWEYTSQYEGDLVAKCYYAKHKLVWEVLNDGLK  249



>ref|XP_003610267.1| hypothetical protein MTR_4g130340 [Medicago truncatula]
Length=262

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  399  KSPSLLDLIQMRLSQGKMSKAG-GNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            KSPS LDLI+  L Q     A  GN   + +K + ++ EKL+ASNFPA+ LKIGSW+Y+ 
Sbjct  27   KSPSFLDLIETELFQRNPVNANTGNLNSEVKKKSQASVEKLQASNFPATRLKIGSWKYEP  86

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +YEGDLVAK  FAK K+VWEVL G LK
Sbjct  87   KYEGDLVAKFCFAKKKIVWEVLVGELK  113



>gb|AES92464.2| hypothetical protein MTR_4g130340 [Medicago truncatula]
Length=292

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query  399  KSPSLLDLIQMRLSQGKMSKAG-GNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKS  575
            KSPS LDLI+  L Q     A  GN   + +K + ++ EKL+ASNFPA+ LKIGSW+Y+ 
Sbjct  27   KSPSFLDLIETELFQRNPVNANTGNLNSEVKKKSQASVEKLQASNFPATRLKIGSWKYEP  86

Query  576  RYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +YEGDLVAK  FAK K+VWEVL G LK
Sbjct  87   KYEGDLVAKFCFAKKKIVWEVLVGELK  113



>ref|XP_001755863.1| predicted protein [Physcomitrella patens]
 gb|EDQ79148.1| predicted protein, partial [Physcomitrella patens]
Length=158

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +KLKASNFPAS LKIG+WE  SRYEGDLVAKCY+AK KLVWEVLD GLK
Sbjct  4    DKLKASNFPASTLKIGTWERASRYEGDLVAKCYYAKRKLVWEVLDSGLK  52



>ref|XP_001764908.1| predicted protein [Physcomitrella patens]
 gb|EDQ70350.1| predicted protein, partial [Physcomitrella patens]
Length=161

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            +KLKASNFPAS LKIG+WE  SRYEGDLVAKCY+AK KLVWEVLD GLK
Sbjct  1    DKLKASNFPASTLKIGTWERASRYEGDLVAKCYYAKRKLVWEVLDSGLK  49



>ref|XP_010313497.1| PREDICTED: uncharacterized protein LOC104644784 isoform X1 [Solanum 
lycopersicum]
Length=520

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 12/98 (12%)
 Frame = +3

Query  399  KSPSLLDLIQMRLSQGKMSK-AGGNPGKKEQKANSS-----------TSEKLKASNFPAS  542
            K+PS ++L++  LSQ KM K + G+  +  + +NSS            SEKLKASNFPA 
Sbjct  81   KTPSFVNLLESELSQVKMRKNSNGSTRRVGRPSNSSRNKTNIEDFASVSEKLKASNFPAM  140

Query  543  ILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             L IG WE  S++EGDL+AKCY+AK KLVWE+LDG LK
Sbjct  141  KLTIGGWERVSKHEGDLIAKCYYAKRKLVWELLDGPLK  178



>ref|XP_010248612.1| PREDICTED: uncharacterized protein LOC104591469 [Nelumbo nucifera]
 ref|XP_010248613.1| PREDICTED: uncharacterized protein LOC104591469 [Nelumbo nucifera]
Length=521

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 78/133 (59%), Gaps = 13/133 (10%)
 Frame = +3

Query  258  HGPLNKRSKLSSPLQHQVGIGVSDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRL  437
            H   +KR KL +P +H   + + +   P             LGL+LRK+PS LDL++ +L
Sbjct  68   HDSRSKRLKLMAPAKHCSYLTIPENLSP-------------LGLTLRKTPSFLDLLESKL  114

Query  438  SQGKMSKAGGNPGKKEQKANSSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAK  617
                 S +       +  +    + K KASNF AS+LKIGSWE  SRY+G++VAKCY+AK
Sbjct  115  FCSSFSCSEKRTNPNDGASAPLINGKAKASNFSASLLKIGSWERVSRYDGEVVAKCYYAK  174

Query  618  HKLVWEVLDGGLK  656
             KLVWEVLDG LK
Sbjct  175  RKLVWEVLDGMLK  187



>ref|XP_006344846.1| PREDICTED: uncharacterized protein LOC102579073 [Solanum tuberosum]
Length=614

 Score = 92.0 bits (227),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 63/93 (68%), Gaps = 7/93 (8%)
 Frame = +3

Query  399  KSPSLLDLIQMRLSQGKMSKAG-----GNPGKKEQKAN--SSTSEKLKASNFPASILKIG  557
            K+PS ++L++ +LSQ KM   G     G P K  +     +  SE+LKA+NFPA  L IG
Sbjct  178  KTPSFVNLLESKLSQVKMKNNGSTRRVGRPSKSSRNMEDFAIVSERLKAANFPAIKLSIG  237

Query  558  SWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
             WE  S++EGDL+AKCY+AK KLVWE+LDG LK
Sbjct  238  VWERVSKHEGDLIAKCYYAKRKLVWELLDGPLK  270



>ref|XP_009617801.1| PREDICTED: uncharacterized protein LOC104110084 [Nicotiana tomentosiformis]
Length=564

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 67/112 (60%), Gaps = 25/112 (22%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKM----------------SKAGGNPGKKEQKAN---------S  500
            +K+PS L+LI+ +LS+GK                 S   GN     + AN         +
Sbjct  88   KKTPSFLNLIETQLSEGKKGSSSSSPPRQLGRPADSSRNGNQMNSSKNANRNRSKMEDFA  147

Query  501  STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            + SEKLKASNFPA  LKIG WE  SRYEGDL+AKCY+AK KLVWE+LDG LK
Sbjct  148  AVSEKLKASNFPAIKLKIGDWERVSRYEGDLIAKCYYAKRKLVWEILDGPLK  199



>ref|XP_009804610.1| PREDICTED: uncharacterized protein LOC104249811 [Nicotiana sylvestris]
Length=572

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 67/112 (60%), Gaps = 25/112 (22%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKM----------------SKAGGNPGKKEQKAN---------S  500
            +K+PS L+LI+ +LS+GK                 S   GN     + AN         +
Sbjct  95   KKTPSFLNLIETQLSEGKKGSSSSSPPRQLGRPAASSRNGNQMNSSKNANKNRSKMEDFA  154

Query  501  STSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            + SEKLKASNFPA  LKIG WE  SRYEGDL+AKCY+AK KLVWE+LDG LK
Sbjct  155  AVSEKLKASNFPAIKLKIGDWERVSRYEGDLIAKCYYAKRKLVWEILDGPLK  206



>ref|XP_010656631.1| PREDICTED: uncharacterized protein LOC100251901 isoform X2 [Vitis 
vinifera]
Length=495

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 98/150 (65%), Gaps = 14/150 (9%)
 Frame = +3

Query  147  MVFLMKTGEMAPELDWQRGKA-VPVKlevevddpleeeHGPLNKRSKLSSPLQHQVGIGV  323
            MV LMK+G + PE +    +  +PVKLE+E     E  HGP NKRSK S+  Q Q   G 
Sbjct  1    MVQLMKSGSLRPERETTPCRDKLPVKLEIEDSLEEE--HGPFNKRSKPSTSYQ-QWSTGN  57

Query  324  SDFREPPVVQYNpleepsplglslRKSPSLLDLIQMRLSQGKMSKAGG------NPGKKE  485
            + +  PP  QYNPL+EPSPLGL LRKSPSLLDLIQMRLSQG  S  G       NPG K+
Sbjct  58   NAYPIPPS-QYNPLDEPSPLGLRLRKSPSLLDLIQMRLSQGNPSNVGCAPNKGPNPGDKK  116

Query  486  Q--KANSST-SEKLKASNFPASILKIGSWE  566
               K N +  ++KLKASNFPAS+L+IG WE
Sbjct  117  DPGKGNMALGTDKLKASNFPASLLRIGRWE  146



>ref|XP_010264767.1| PREDICTED: uncharacterized protein LOC104602687 [Nelumbo nucifera]
Length=311

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 63/109 (58%), Gaps = 23/109 (21%)
 Frame = +3

Query  399  KSPSLLDLIQMRLSQGKMSKAGGNPGKKEQKANSSTS-----------------------  509
            K+ SLLDL+ M ++Q K          K   A S+T+                       
Sbjct  50   KTASLLDLVTMAVNQKKEPLRSKTVSAKCDSALSTTTLNITICSKDTRTITDQLVTQLVA  109

Query  510  EKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            EK+KASNFPAS ++IG+WE KS+Y+GDLVAKCY+ K KLVWEVL+ GLK
Sbjct  110  EKMKASNFPASFIRIGNWERKSKYKGDLVAKCYYGKRKLVWEVLENGLK  158



>ref|XP_010938291.1| PREDICTED: uncharacterized protein LOC105057391 [Elaeis guineensis]
 ref|XP_010938292.1| PREDICTED: uncharacterized protein LOC105057391 [Elaeis guineensis]
Length=558

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 9/96 (9%)
 Frame = +3

Query  396  RKSPSLLDLIQMRLSQGKMS-----KAGGNPGKKEQKANSSTSE----KLKASNFPASIL  548
            RK+PS LDL+QMRLSQ K++      +     K++ + +   ++    K KASNFPAS L
Sbjct  74   RKTPSFLDLLQMRLSQKKITPLNEPTSSTRIAKQKTRNDKCNTQPIPMKWKASNFPASKL  133

Query  549  KIGSWEYKSRYEGDLVAKCYFAKHKLVWEVLDGGLK  656
            KIGSWE KS  EGD+VAK Y+AK KLVWE+L+  LK
Sbjct  134  KIGSWERKSTNEGDIVAKFYYAKRKLVWEILEERLK  169



>emb|CDP21606.1| unnamed protein product, partial [Coffea canephora]
Length=241

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +3

Query  498  SSTSEKLKASNFPASILKIGSWEYKSRYEGDLVAKCYFAKHKLVWEV  638
            S + EKLKASNFPA+IL+IG+WEYKSRYE DLVAKCYFAKHKLVWE 
Sbjct  44   SGSFEKLKASNFPATILRIGTWEYKSRYERDLVAKCYFAKHKLVWET  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875