BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF036C03

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008235994.1|  PREDICTED: probable endo-1,4-beta-xylanase C       169   2e-45   Prunus mume [ume]
ref|XP_007041880.1|  Glycosyl hydrolase family 10 protein isoform 1     167   1e-44   
emb|CDO96931.1|  unnamed protein product                                162   8e-43   Coffea canephora [robusta coffee]
ref|XP_011001983.1|  PREDICTED: endo-1,4-beta-xylanase A-like iso...    159   6e-42   Populus euphratica
ref|XP_011013611.1|  PREDICTED: endo-1,4-beta-xylanase A-like           159   6e-42   Populus euphratica
ref|XP_011001984.1|  PREDICTED: endo-1,4-beta-xylanase A-like iso...    159   7e-42   Populus euphratica
gb|KHG02946.1|  Endo-1,4-beta-xylanase A                                158   9e-42   Gossypium arboreum [tree cotton]
ref|XP_006486857.1|  PREDICTED: uncharacterized protein LOC102613106    158   1e-41   
ref|XP_010246856.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    157   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_006422632.1|  hypothetical protein CICLE_v10028121mg             157   3e-41   
ref|XP_009628223.1|  PREDICTED: uncharacterized protein LOC104118...    156   5e-41   Nicotiana tomentosiformis
gb|KDO68006.1|  hypothetical protein CISIN_1g035723mg                   155   7e-41   Citrus sinensis [apfelsine]
ref|XP_008349367.1|  PREDICTED: probable endo-1,4-beta-xylanase C       155   1e-40   
ref|XP_009349686.1|  PREDICTED: probable endo-1,4-beta-xylanase C       154   2e-40   
ref|XP_009761411.1|  PREDICTED: uncharacterized protein LOC104213...    153   9e-40   Nicotiana sylvestris
ref|XP_002306176.2|  hypothetical protein POPTR_0004s17900g             152   1e-39   
ref|XP_011457932.1|  PREDICTED: uncharacterized protein LOC101305...    151   2e-39   Fragaria vesca subsp. vesca
ref|XP_010090320.1|  Endo-1,4-beta-xylanase A                           150   6e-39   
gb|KHN20002.1|  Endo-1,4-beta-xylanase A                                150   7e-39   Glycine soja [wild soybean]
ref|XP_006581102.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    150   7e-39   Glycine max [soybeans]
ref|XP_011092888.1|  PREDICTED: uncharacterized protein LOC105172...    149   2e-38   Sesamum indicum [beniseed]
ref|XP_010646993.1|  PREDICTED: probable endo-1,4-beta-xylanase C       149   2e-38   Vitis vinifera
emb|CBI37893.3|  unnamed protein product                                149   3e-38   Vitis vinifera
ref|XP_009615209.1|  PREDICTED: endo-1,4-beta-xylanase A-like           148   4e-38   Nicotiana tomentosiformis
ref|XP_009340235.1|  PREDICTED: probable endo-1,4-beta-xylanase C       147   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_008372900.1|  PREDICTED: probable endo-1,4-beta-xylanase C       147   7e-38   
ref|XP_006343478.1|  PREDICTED: uncharacterized protein LOC102583591    145   6e-37   
ref|XP_004250707.1|  PREDICTED: uncharacterized protein LOC101263...    144   9e-37   Solanum lycopersicum
ref|XP_007137357.1|  hypothetical protein PHAVU_009G120500g             143   3e-36   Phaseolus vulgaris [French bean]
ref|XP_008457673.1|  PREDICTED: uncharacterized protein LOC103497316    143   3e-36   Cucumis melo [Oriental melon]
ref|XP_010431807.1|  PREDICTED: uncharacterized protein LOC104716145    142   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010531544.1|  PREDICTED: uncharacterized protein LOC104807819    140   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_006411655.1|  hypothetical protein EUTSA_v10024805mg             140   3e-35   Eutrema salsugineum [saltwater cress]
ref|XP_011092889.1|  PREDICTED: endo-1,4-beta-xylanase 1 isoform X2     140   3e-35   
ref|XP_006577900.1|  PREDICTED: uncharacterized protein LOC100793558    139   5e-35   Glycine max [soybeans]
gb|EYU40424.1|  hypothetical protein MIMGU_mgv1a020606mg                139   5e-35   Erythranthe guttata [common monkey flower]
ref|XP_010436963.1|  PREDICTED: uncharacterized protein LOC104720...    139   5e-35   Camelina sativa [gold-of-pleasure]
gb|KGN61918.1|  hypothetical protein Csa_2G264620                       139   6e-35   Cucumis sativus [cucumbers]
ref|XP_004231450.1|  PREDICTED: endo-1,4-beta-xylanase UM03411 is...    138   1e-34   
ref|XP_010446374.1|  PREDICTED: uncharacterized protein LOC104729170    138   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009109536.1|  PREDICTED: uncharacterized protein LOC103835171    137   2e-34   Brassica rapa
emb|CDX90288.1|  BnaA08g16960D                                          137   3e-34   
ref|XP_004169878.1|  PREDICTED: endo-1,4-beta-xylanase C-like           135   1e-33   
ref|XP_004147070.1|  PREDICTED: endo-1,4-beta-xylanase C-like           135   1e-33   
emb|CDY12095.1|  BnaC03g60110D                                          134   3e-33   Brassica napus [oilseed rape]
ref|XP_006283441.1|  hypothetical protein CARUB_v10004489mg             133   9e-33   Capsella rubella
ref|XP_004500734.1|  PREDICTED: probable endo-1,4-beta-xylanase C...    132   1e-32   Cicer arietinum [garbanzo]
ref|XP_002866813.1|  glycosyl hydrolase family 10 protein               132   2e-32   
ref|XP_006422633.1|  hypothetical protein CICLE_v10030219mg             132   2e-32   
ref|XP_010690392.1|  PREDICTED: endo-1,4-beta-xylanase 5 isoform X1     131   5e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011088586.1|  PREDICTED: uncharacterized protein LOC105169...    131   5e-32   
ref|XP_010315367.1|  PREDICTED: endo-1,4-beta-xylanase UM03411 is...    130   6e-32   
ref|XP_007201160.1|  hypothetical protein PRUPE_ppa004290mg             130   9e-32   
ref|XP_009799022.1|  PREDICTED: endo-1,4-beta-xylanase A-like           128   4e-31   Nicotiana sylvestris
ref|NP_195577.2|  glycosyl hydrolase family 10 protein                  128   5e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781049.1|  PREDICTED: endo-1,4-beta-xylanase-like             128   6e-31   
gb|AHH32689.1|  xylanase 3                                              126   1e-30   Phoenix dactylifera
gb|AES74285.2|  glycosyl hydrolase family 10 protein                    126   2e-30   Medicago truncatula
ref|XP_008788407.1|  PREDICTED: endo-1,4-beta-xylanase A-like           126   3e-30   Phoenix dactylifera
ref|XP_010066269.1|  PREDICTED: uncharacterized protein LOC104453...    126   3e-30   Eucalyptus grandis [rose gum]
ref|XP_009761414.1|  PREDICTED: uncharacterized protein LOC104213...    124   1e-29   Nicotiana sylvestris
ref|XP_009628229.1|  PREDICTED: uncharacterized protein LOC104118...    124   1e-29   Nicotiana tomentosiformis
ref|XP_009628227.1|  PREDICTED: uncharacterized protein LOC104118...    124   1e-29   
ref|XP_010920164.1|  PREDICTED: uncharacterized protein LOC105044067    124   2e-29   Elaeis guineensis
ref|XP_009628228.1|  PREDICTED: uncharacterized protein LOC104118...    124   2e-29   Nicotiana tomentosiformis
ref|XP_009400614.1|  PREDICTED: uncharacterized protein LOC103984779    123   3e-29   
ref|XP_002446197.1|  hypothetical protein SORBIDRAFT_06g003350          123   3e-29   Sorghum bicolor [broomcorn]
ref|XP_003604034.1|  Endo-1,4-beta-xylanase A                           122   8e-29   
ref|XP_010934099.1|  PREDICTED: endo-1,4-beta-xylanase-like             122   9e-29   
ref|XP_009761415.1|  PREDICTED: uncharacterized protein LOC104213...    121   1e-28   Nicotiana sylvestris
emb|CDO96932.1|  unnamed protein product                                121   2e-28   Coffea canephora [robusta coffee]
gb|EPS72309.1|  hypothetical protein M569_02449                         120   3e-28   Genlisea aurea
ref|XP_006851910.1|  hypothetical protein AMTR_s00041p00160040          119   1e-27   
ref|XP_003558355.1|  PREDICTED: uncharacterized protein LOC100841372    118   3e-27   Brachypodium distachyon [annual false brome]
gb|KJB71892.1|  hypothetical protein B456_011G146100                    113   4e-27   Gossypium raimondii
gb|EEC74851.1|  hypothetical protein OsI_10717                          117   8e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_008661494.1|  PREDICTED: uncharacterized protein LOC100216...    117   8e-27   
ref|NP_001152556.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    116   1e-26   
ref|XP_006649724.1|  PREDICTED: uncharacterized protein LOC102701898    115   2e-26   Oryza brachyantha
gb|ABF94920.1|  Glycosyl hydrolase family 10 protein, expressed         115   3e-26   Oryza sativa Japonica Group [Japonica rice]
gb|ABF94921.1|  Glycosyl hydrolase family 10 protein, expressed         115   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652135.1|  PREDICTED: uncharacterized protein LOC102708887    115   4e-26   Oryza brachyantha
ref|XP_003581580.1|  PREDICTED: uncharacterized protein LOC100828464    114   4e-26   Brachypodium distachyon [annual false brome]
ref|XP_011088587.1|  PREDICTED: uncharacterized protein LOC105169...    112   4e-25   Sesamum indicum [beniseed]
ref|XP_002468186.1|  hypothetical protein SORBIDRAFT_01g041310          111   5e-25   Sorghum bicolor [broomcorn]
ref|NP_001140909.1|  uncharacterized protein LOC100272986 precursor     111   9e-25   Zea mays [maize]
ref|XP_004969072.1|  PREDICTED: uncharacterized protein LOC101763135    110   2e-24   Setaria italica
gb|EMT25110.1|  Endo-1,4-beta-xylanase Z                                109   3e-24   
ref|XP_004985034.1|  PREDICTED: uncharacterized protein LOC101776078    109   4e-24   Setaria italica
gb|EMS68876.1|  Endo-1,4-beta-xylanase Z                                105   6e-23   Triticum urartu
gb|EMT22806.1|  Endo-1,4-beta-xylanase Z                                105   8e-23   
gb|KJB28128.1|  hypothetical protein B456_005G028800                  99.0    1e-21   Gossypium raimondii
ref|XP_010436964.1|  PREDICTED: uncharacterized protein LOC104720...    102   1e-21   
ref|XP_010315368.1|  PREDICTED: probable endo-1,4-beta-xylanase C...  95.9    2e-19   
ref|XP_006359674.1|  PREDICTED: probable endo-1,4-beta-xylanase C...  95.5    2e-19   
ref|XP_011001985.1|  PREDICTED: endo-1,4-beta-xylanase F1-like is...  95.1    3e-19   Populus euphratica
gb|KEH36384.1|  glycosyl hydrolase family 10 protein                  90.1    2e-17   Medicago truncatula
gb|KJB74235.1|  hypothetical protein B456_011G281800                  85.1    5e-17   Gossypium raimondii
gb|KJB74236.1|  hypothetical protein B456_011G281800                  85.1    6e-17   Gossypium raimondii
ref|XP_010327543.1|  PREDICTED: endo-1,4-beta-xylanase A-like         85.9    5e-16   
ref|XP_002534153.1|  Endo-1,4-beta-xylanase A precursor, putative     82.8    5e-15   
ref|XP_011457934.1|  PREDICTED: uncharacterized protein LOC101305...  80.9    3e-14   Fragaria vesca subsp. vesca
gb|ABF94922.1|  Glycosyl hydrolase family 10 protein, expressed       77.8    3e-13   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA44351.1|  TPA: putative glycosyl hydrolase family 10 protein   71.2    1e-12   
gb|EMS66498.1|  Endo-1,4-beta-xylanase Z                              75.9    2e-12   Triticum urartu
tpg|DAA44350.1|  TPA: putative glycosyl hydrolase family 10 protein   73.2    1e-11   
ref|XP_011088588.1|  PREDICTED: probable endo-1,4-beta-xylanase C...  71.6    3e-11   Sesamum indicum [beniseed]
ref|XP_010690393.1|  PREDICTED: probable endo-1,4-beta-xylanase C...  71.6    3e-11   
ref|XP_006367794.1|  PREDICTED: uncharacterized protein LOC102602944  71.2    4e-11   
ref|XP_009622124.1|  PREDICTED: LOW QUALITY PROTEIN: probable end...  69.7    1e-10   Nicotiana tomentosiformis
ref|XP_002980942.1|  hypothetical protein SELMODRAFT_420481           68.2    6e-10   
gb|KJB15754.1|  hypothetical protein B456_002G1956001                 65.9    6e-10   Gossypium raimondii
gb|KJB32237.1|  hypothetical protein B456_005G231100                  66.6    2e-09   Gossypium raimondii
gb|KJB32236.1|  hypothetical protein B456_005G231100                  66.6    2e-09   Gossypium raimondii
ref|XP_004169732.1|  PREDICTED: endo-1,4-beta-xylanase Z-like         64.7    7e-09   
ref|XP_011001986.1|  PREDICTED: endo-1,4-beta-xylanase F1-like is...  64.3    8e-09   Populus euphratica
ref|NP_001055146.1|  Os05g0305000                                     60.8    1e-08   
gb|KEH36385.1|  glycosyl hydrolase family 10 protein                  63.2    2e-08   Medicago truncatula
emb|CDY49599.1|  BnaAnng10280D                                        62.8    2e-08   Brassica napus [oilseed rape]
ref|XP_010673245.1|  PREDICTED: uncharacterized protein LOC104889668  62.0    5e-08   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW63584.1|  hypothetical protein EUGRSUZ_G01206                   60.8    1e-07   Eucalyptus grandis [rose gum]
ref|XP_008455522.1|  PREDICTED: uncharacterized protein LOC103495673  60.1    2e-07   Cucumis melo [Oriental melon]
gb|EEE63172.1|  hypothetical protein OsJ_17981                        59.7    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHG30568.1|  Endo-1,4-beta-xylanase A                              59.7    3e-07   Gossypium arboreum [tree cotton]
gb|EEC78941.1|  hypothetical protein OsI_19385                        59.7    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002989316.1|  hypothetical protein SELMODRAFT_129690           59.7    3e-07   
ref|XP_004137084.1|  PREDICTED: endo-1,4-beta-xylanase Z-like         59.3    3e-07   Cucumis sativus [cucumbers]
gb|KFK30010.1|  hypothetical protein AALP_AA7G206100                  59.3    4e-07   Arabis alpina [alpine rockcress]
gb|KGN43847.1|  hypothetical protein Csa_7G071360                     59.3    4e-07   Cucumis sativus [cucumbers]
ref|XP_010065886.1|  PREDICTED: uncharacterized protein LOC104453...  59.3    4e-07   
gb|ACN26473.1|  unknown                                               58.9    5e-07   Zea mays [maize]
ref|XP_004230568.2|  PREDICTED: uncharacterized protein LOC101251...  58.9    6e-07   Solanum lycopersicum
ref|XP_010315117.1|  PREDICTED: uncharacterized protein LOC101251...  58.5    6e-07   Solanum lycopersicum
ref|XP_010065888.1|  PREDICTED: uncharacterized protein LOC104453...  58.5    7e-07   Eucalyptus grandis [rose gum]
ref|XP_010547943.1|  PREDICTED: uncharacterized protein LOC104819...  58.5    7e-07   Tarenaya hassleriana [spider flower]
ref|XP_010315121.1|  PREDICTED: uncharacterized protein LOC101251...  58.2    8e-07   Solanum lycopersicum
ref|XP_010315116.1|  PREDICTED: uncharacterized protein LOC101251...  58.2    1e-06   Solanum lycopersicum
ref|XP_010315118.1|  PREDICTED: uncharacterized protein LOC101251...  58.2    1e-06   Solanum lycopersicum
ref|XP_004987121.1|  PREDICTED: uncharacterized protein LOC101757850  57.8    1e-06   Setaria italica
emb|CDY28323.1|  BnaC03g66360D                                        57.0    2e-06   Brassica napus [oilseed rape]
ref|XP_011013779.1|  PREDICTED: uncharacterized protein LOC105117...  57.0    2e-06   Populus euphratica
ref|NP_001055145.1|  Os05g0304900                                     56.6    3e-06   
ref|XP_011013781.1|  PREDICTED: uncharacterized protein LOC105117...  56.6    3e-06   Populus euphratica
ref|XP_009102314.1|  PREDICTED: uncharacterized protein LOC103828470  56.6    3e-06   Brassica rapa
ref|XP_011002036.1|  PREDICTED: uncharacterized protein LOC105109...  56.6    3e-06   Populus euphratica
ref|XP_011088131.1|  PREDICTED: uncharacterized protein LOC105169440  56.2    4e-06   
ref|XP_011002043.1|  PREDICTED: uncharacterized protein LOC105109...  56.2    4e-06   Populus euphratica
ref|XP_010065891.1|  PREDICTED: uncharacterized protein LOC104453...  56.2    4e-06   
gb|KCW63591.1|  hypothetical protein EUGRSUZ_G01217                   55.8    5e-06   Eucalyptus grandis [rose gum]
ref|XP_009774985.1|  PREDICTED: uncharacterized protein LOC104224...  55.8    5e-06   Nicotiana sylvestris
ref|XP_010683117.1|  PREDICTED: uncharacterized protein LOC104897858  55.8    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009774984.1|  PREDICTED: uncharacterized protein LOC104224...  55.8    6e-06   Nicotiana sylvestris
ref|XP_010065884.1|  PREDICTED: uncharacterized protein LOC104453...  55.8    6e-06   Eucalyptus grandis [rose gum]
ref|XP_011088132.1|  PREDICTED: uncharacterized protein LOC105169441  55.8    6e-06   Sesamum indicum [beniseed]
ref|XP_010065889.1|  PREDICTED: uncharacterized protein LOC104453...  55.8    6e-06   Eucalyptus grandis [rose gum]
ref|XP_008454401.1|  PREDICTED: uncharacterized protein LOC103494817  55.5    6e-06   Cucumis melo [Oriental melon]
ref|XP_010065890.1|  PREDICTED: uncharacterized protein LOC104453...  55.8    6e-06   Eucalyptus grandis [rose gum]
ref|XP_002867154.1|  glycosyl hydrolase family 10 protein             55.5    8e-06   Arabidopsis lyrata subsp. lyrata
gb|EEC74704.1|  hypothetical protein OsI_10420                        55.5    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010313152.1|  PREDICTED: uncharacterized protein LOC101264695  55.5    8e-06   
ref|XP_010065885.1|  PREDICTED: uncharacterized protein LOC104453...  55.5    8e-06   
ref|NP_001049300.1|  Os03g0201800                                     55.1    9e-06   
gb|ABF94508.1|  Glycosyl hydrolase family 10 protein, expressed       55.1    9e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010065894.1|  PREDICTED: uncharacterized protein LOC104453082  55.1    9e-06   
ref|XP_010065892.1|  PREDICTED: uncharacterized protein LOC104453081  55.1    1e-05   Eucalyptus grandis [rose gum]
ref|XP_003592519.1|  Endo-1,4-beta-xylanase A                         55.1    1e-05   Medicago truncatula
ref|XP_008648082.1|  PREDICTED: xylanase1 isoform X1                  54.7    1e-05   
ref|XP_010488907.1|  PREDICTED: uncharacterized protein LOC104766677  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010324022.1|  PREDICTED: uncharacterized protein LOC104648447  52.0    1e-05   Solanum lycopersicum
ref|XP_010496773.1|  PREDICTED: uncharacterized protein LOC104773...  54.7    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_009613540.1|  PREDICTED: uncharacterized protein LOC104106...  54.3    2e-05   Nicotiana tomentosiformis
gb|KFK39976.1|  hypothetical protein AALP_AA3G313800                  54.3    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010496774.1|  PREDICTED: uncharacterized protein LOC104773...  54.3    2e-05   
ref|XP_002465686.1|  hypothetical protein SORBIDRAFT_01g043730        53.9    2e-05   Sorghum bicolor [broomcorn]
ref|XP_010647914.1|  PREDICTED: uncharacterized protein LOC100248080  53.9    2e-05   Vitis vinifera
ref|XP_010228324.1|  PREDICTED: uncharacterized protein LOC100828321  53.9    2e-05   Brachypodium distachyon [annual false brome]
ref|XP_010068352.1|  PREDICTED: uncharacterized protein LOC104455228  53.9    3e-05   
emb|CBI22450.3|  unnamed protein product                              53.9    3e-05   Vitis vinifera
ref|XP_010068360.1|  PREDICTED: uncharacterized protein LOC104455238  53.9    3e-05   
ref|XP_010447187.1|  PREDICTED: uncharacterized protein LOC104729865  53.5    3e-05   
ref|XP_009613527.1|  PREDICTED: uncharacterized protein LOC104106...  53.5    3e-05   Nicotiana tomentosiformis
ref|XP_006299800.1|  hypothetical protein CARUB_v10015996mg           53.5    4e-05   Capsella rubella
ref|XP_006661710.1|  PREDICTED: uncharacterized protein LOC102721021  53.1    4e-05   
gb|EYU18454.1|  hypothetical protein MIMGU_mgv1a021702mg              53.1    4e-05   Erythranthe guttata [common monkey flower]
ref|XP_002885933.1|  endo-1,4-beta-xylanase/ hydrolase, hydrolyzi...  52.8    5e-05   Arabidopsis lyrata subsp. lyrata
gb|KFK30013.1|  hypothetical protein AALP_AA7G206400                  52.8    6e-05   Arabis alpina [alpine rockcress]
ref|XP_006422816.1|  hypothetical protein CICLE_v10028089mg           52.8    6e-05   Citrus clementina [clementine]
gb|AAN10199.1|  endoxylanase                                          52.8    7e-05   Carica papaya [mamon]
ref|XP_009375672.1|  PREDICTED: endo-1,4-beta-xylanase 2-like         52.4    7e-05   Pyrus x bretschneideri [bai li]
ref|XP_006283361.1|  hypothetical protein CARUB_v10004408mg           52.4    7e-05   Capsella rubella
ref|XP_006651142.1|  PREDICTED: uncharacterized protein LOC102719572  52.4    8e-05   
ref|NP_179076.3|  putative glycosyl hydrolase family 10 protein       52.4    8e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042652.1|  Glycosyl hydrolase family 10 protein             52.4    9e-05   
ref|XP_002313181.1|  hypothetical protein POPTR_0009s09090g           52.0    1e-04   
ref|XP_009406807.1|  PREDICTED: endo-1,4-beta-xylanase A-like         52.0    1e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU39075.1|  hypothetical protein MIMGU_mgv1a0048872mg             50.4    1e-04   Erythranthe guttata [common monkey flower]
emb|CAN61987.1|  hypothetical protein VITISV_034671                   50.1    1e-04   Vitis vinifera
ref|XP_006651141.1|  PREDICTED: uncharacterized protein LOC102719284  51.6    1e-04   Oryza brachyantha
ref|NP_001064415.1|  Os10g0351700                                     51.6    2e-04   
gb|EEC66792.1|  hypothetical protein OsI_33191                        51.6    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010447188.1|  PREDICTED: uncharacterized protein LOC104729...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010447189.1|  PREDICTED: uncharacterized protein LOC104729...  51.2    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002867151.1|  glycosyl hydrolase family 10 protein             51.2    2e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010065883.1|  PREDICTED: uncharacterized protein LOC104453076  51.2    2e-04   
ref|XP_009406772.1|  PREDICTED: endo-1,4-beta-xylanase C-like         50.8    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008652268.1|  PREDICTED: uncharacterized protein LOC103632224  50.8    2e-04   Zea mays [maize]
emb|CDY49377.1|  BnaA03g50660D                                        50.8    2e-04   Brassica napus [oilseed rape]
ref|XP_002867155.1|  glycosyl hydrolase family 10 protein             50.8    3e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_002264837.3|  PREDICTED: uncharacterized protein LOC100266982  50.8    3e-04   
ref|NP_001130600.1|  putative glycosyl hydrolase family 10 protein    50.8    3e-04   
ref|XP_010444979.1|  PREDICTED: uncharacterized protein LOC104727585  50.4    3e-04   
gb|AFW89320.1|  putative glycosyl hydrolase family 10 protein         50.4    3e-04   
ref|XP_010447190.1|  PREDICTED: uncharacterized protein LOC104729...  50.4    4e-04   Camelina sativa [gold-of-pleasure]
ref|NP_680761.1|  glycosyl hydrolase family protein                   50.4    4e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDO97285.1|  unnamed protein product                              50.4    4e-04   Coffea canephora [robusta coffee]
gb|KHG22781.1|  Sulfhydryl oxidase 1                                  48.9    4e-04   Gossypium arboreum [tree cotton]
emb|CDY28324.1|  BnaC03g66350D                                        50.1    4e-04   Brassica napus [oilseed rape]
dbj|BAD95434.1|  hypothetical protein                                 46.2    5e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KCW63590.1|  hypothetical protein EUGRSUZ_G01215                   49.7    6e-04   Eucalyptus grandis [rose gum]
gb|EYU39074.1|  hypothetical protein MIMGU_mgv1a019481mg              49.7    6e-04   Erythranthe guttata [common monkey flower]
emb|CDX72430.1|  BnaC07g44520D                                        49.7    6e-04   
gb|KEH27913.1|  glycosyl hydrolase family 10 protein                  49.7    6e-04   Medicago truncatula
ref|XP_006412306.1|  hypothetical protein EUTSA_v10024995mg           49.7    7e-04   
ref|XP_006591552.1|  PREDICTED: uncharacterized protein LOC100775814  49.7    7e-04   Glycine max [soybeans]
ref|XP_010095699.1|  putative endo-1,4-beta-xylanase C                49.7    7e-04   
gb|KDP44501.1|  hypothetical protein JCGZ_16334                       49.7    7e-04   Jatropha curcas
gb|KHG22780.1|  ndx-1: Putative nudix hydrolase 1                     48.1    9e-04   Gossypium arboreum [tree cotton]
gb|EYU38257.1|  hypothetical protein MIMGU_mgv1a004760mg              49.3    9e-04   Erythranthe guttata [common monkey flower]
gb|EEE58525.1|  hypothetical protein OsJ_09814                        49.3    9e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658022.1|  PREDICTED: putative glycosyl hydrolase famil...  49.3    0.001   
ref|NP_001241765.1|  1,4-beta-xylanase precursor                      49.3    0.001   



>ref|XP_008235994.1| PREDICTED: probable endo-1,4-beta-xylanase C [Prunus mume]
Length=556

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 104/144 (72%), Gaps = 7/144 (5%)
 Frame = +3

Query  186  LPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIG--  359
            L FFFL  G     S+++++GPLYDS+AYTECK  PE ALY GGI+  +       +G  
Sbjct  10   LMFFFLLRG----SSVASFDGPLYDSTAYTECKMQPEAALYGGGIINDQASGVEGSLGNS  65

Query  360  -LNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQ  536
                 GVY+P+F+L +LT GTIYCFSSWV+IE A SAL+ ASL TEK   DC+GTV+AK 
Sbjct  66   ATTSSGVYSPSFILHNLTQGTIYCFSSWVKIEGAGSALIRASLKTEKETYDCIGTVLAKH  125

Query  537  GCWSFIKGGFVLTSPSNLSLLYFQ  608
            GCWSF+KGGFVL SPS LS+L+FQ
Sbjct  126  GCWSFLKGGFVLNSPSQLSMLFFQ  149



>ref|XP_007041880.1| Glycosyl hydrolase family 10 protein isoform 1 [Theobroma cacao]
 gb|EOX97711.1| Glycosyl hydrolase family 10 protein isoform 1 [Theobroma cacao]
Length=564

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 107/156 (69%), Gaps = 4/156 (3%)
 Frame = +3

Query  153  FCSMKMKNTATLPFFFLFLGYFINPSLS---TYEGPLYDSSAYTECKQHPEEALYSGGIL  323
            F +++  N    P F  +L +F   S+S   +Y+GP YD +AYTECK  PEE LY GGIL
Sbjct  2    FYTLQCGNMKHSPIFGGYLAFFFLLSISLAASYDGPAYDFTAYTECKAQPEEPLYQGGIL  61

Query  324  GGKVP-ESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKG  500
              + P   R +I     G YTP F+L++LT G++YCFS+WVRI+ A+SAL+ ASL TE  
Sbjct  62   KDQQPVMKRSIISETATGFYTPAFVLKNLTQGSVYCFSTWVRIQGANSALIRASLKTENR  121

Query  501  EPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
              DC+GTV AK GCWSF+KGGF+L SPSNL+LL FQ
Sbjct  122  TYDCIGTVSAKSGCWSFLKGGFILDSPSNLALLLFQ  157



>emb|CDO96931.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 120/194 (62%), Gaps = 9/194 (5%)
 Frame = +3

Query  45   CFSCDSITGQFALAHNHTLTHSSIKKQDSTPFF*CSFCSMKMKNTATLPF-----FFLFL  209
            CFSC  + G   L  N  ++   I   +S+P    SF   K K   T+        FL L
Sbjct  59   CFSCQFLAGH-QLESNRFVSFFPIMP-NSSPNNASSFLG-KEKTWETMGRPSSICLFLIL  115

Query  210  GYFINPSL-STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTP  386
            G F   SL S ++GP YDSSAYTECK H EE LY+GGIL  + PE   VIG  G  VY+P
Sbjct  116  GLFSGLSLASAFDGPPYDSSAYTECKPHAEEPLYNGGILEDQQPEYTWVIGAKGNPVYSP  175

Query  387  TFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
             F LQ+L   T YCFS+WV+I +A S L+ A+L+TE    +C GTVVA+ GCWSF+KGGF
Sbjct  176  AFRLQNLAQDTFYCFSTWVKINDAGSVLIRATLVTETTTQNCTGTVVAEGGCWSFLKGGF  235

Query  567  VLTSPSNLSLLYFQ  608
            VLT+PS+ S+LY Q
Sbjct  236  VLTAPSSSSILYLQ  249



>ref|XP_011001983.1| PREDICTED: endo-1,4-beta-xylanase A-like isoform X1 [Populus 
euphratica]
Length=563

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +3

Query  150  SFCSMKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGG  329
            +F S K  + A +  F +FL  F+  S   Y+GPLYD +AYTECK  PE+ LY+GGI   
Sbjct  5    AFLSKKSMHKAPILGFSVFLIPFLAFS---YDGPLYDFTAYTECKSVPEKPLYNGGIFKD  61

Query  330  KVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEP-  506
            + P ++  I  +  G YTP  +LQ+L   T+YCFS WV+I+ ADS L+TASLMT      
Sbjct  62   QAPLTQHRISTSSDGSYTPALILQNLAQNTMYCFSIWVKIQGADSTLVTASLMTNNNSTN  121

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DCVGTV+AK GCWSF+KGGF+L SPS++S+LYFQ
Sbjct  122  DCVGTVLAKSGCWSFLKGGFILDSPSSVSILYFQ  155



>ref|XP_011013611.1| PREDICTED: endo-1,4-beta-xylanase A-like [Populus euphratica]
Length=563

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +3

Query  150  SFCSMKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGG  329
            +F S K  + A +  F +FL  F+  S   Y+GPLYD +AYTECK  PE+ LY+GGI   
Sbjct  5    AFLSKKSMHKAPILGFSVFLIPFLAFS---YDGPLYDFTAYTECKSVPEKPLYNGGIFKD  61

Query  330  KVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEP-  506
            + P ++  I  +  G YTP  +LQ+L   T+YCFS WV+I+ ADS L+TASLMT      
Sbjct  62   QAPLTQHRISTSSDGSYTPALILQNLAQNTMYCFSIWVKIQGADSTLVTASLMTNNNSTN  121

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DCVGTV+AK GCWSF+KGGF+L SPS++S+LYFQ
Sbjct  122  DCVGTVLAKSGCWSFLKGGFILDSPSSVSILYFQ  155



>ref|XP_011001984.1| PREDICTED: endo-1,4-beta-xylanase A-like isoform X2 [Populus 
euphratica]
Length=560

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 4/154 (3%)
 Frame = +3

Query  150  SFCSMKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGG  329
            +F S K  + A +  F +FL  F+  S   Y+GPLYD +AYTECK  PE+ LY+GGI   
Sbjct  2    AFLSKKSMHKAPILGFSVFLIPFLAFS---YDGPLYDFTAYTECKSVPEKPLYNGGIFKD  58

Query  330  KVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEP-  506
            + P ++  I  +  G YTP  +LQ+L   T+YCFS WV+I+ ADS L+TASLMT      
Sbjct  59   QAPLTQHRISTSSDGSYTPALILQNLAQNTMYCFSIWVKIQGADSTLVTASLMTNNNSTN  118

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DCVGTV+AK GCWSF+KGGF+L SPS++S+LYFQ
Sbjct  119  DCVGTVLAKSGCWSFLKGGFILDSPSSVSILYFQ  152



>gb|KHG02946.1| Endo-1,4-beta-xylanase A [Gossypium arboreum]
Length=542

 Score =   158 bits (400),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 1/123 (1%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESR-QVIGLNGKGVYTPTFLLQDLTAGT  419
            +GPLYD SAYTECK  PEE LY GGIL  + P  +  +IG    G YTP FLL++LT G 
Sbjct  13   DGPLYDFSAYTECKAQPEEPLYQGGILKDEPPIMKPAIIGKTATGFYTPAFLLKNLTLGN  72

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            +YCFS+W++I+ A+SAL+ ASL TE    +C+GTV+AK GCWSF+KGGFVL SPSNL+LL
Sbjct  73   LYCFSTWIKIQGANSALIRASLKTENRTYNCIGTVLAKNGCWSFLKGGFVLDSPSNLALL  132

Query  600  YFQ  608
             FQ
Sbjct  133  LFQ  135



>ref|XP_006486857.1| PREDICTED: uncharacterized protein LOC102613106 [Citrus sinensis]
Length=556

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 104/150 (69%), Gaps = 4/150 (3%)
 Frame = +3

Query  168  MKNTATLPFF---FLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVP  338
            MK T T   F   F+ LG  +  S    +GPLYD +AYTECK+ PE+ LY+GG+L  ++P
Sbjct  1    MKYTLTSAGFLVCFVLLGASLAASYGA-DGPLYDFTAYTECKELPEQPLYNGGLLKNQLP  59

Query  339  ESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVG  518
            E+   I     G YTP F+L +LT GTIYCFS W++IE A+SA + ASL TE    +CVG
Sbjct  60   ENFSSIAHFSTGFYTPAFILHNLTPGTIYCFSIWLKIEGANSAHVRASLKTENSVYNCVG  119

Query  519  TVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +  AKQGCWSF+KGGFVL SPSNLS+L+FQ
Sbjct  120  SAAAKQGCWSFLKGGFVLDSPSNLSILFFQ  149



>ref|XP_010246856.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X1 [Nelumbo 
nucifera]
Length=557

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = +3

Query  162  MKMKNTATLPFFFLF--LGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKV  335
            M+  +++ L FF LF  + +F+ PS   Y+GPLYD SAYTECK HPE  LY+GGIL    
Sbjct  1    MRDLSSSFLCFFRLFCCICFFL-PSAIPYDGPLYDHSAYTECKTHPEGPLYNGGILKDYA  59

Query  336  PESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCV  515
             +  + +   G G+YTP F+L++LT GT YC S WV+I   DSAL+ A L T+     CV
Sbjct  60   RDIGRHLDNPGTGIYTPAFVLRNLTQGTKYCLSVWVKINGVDSALIRARLSTQNETYKCV  119

Query  516  GTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            GTV+A+ GCWSF+KGGFVL SPS LS+L+FQ
Sbjct  120  GTVIAQSGCWSFLKGGFVLDSPSELSILFFQ  150



>ref|XP_006422632.1| hypothetical protein CICLE_v10028121mg [Citrus clementina]
 gb|ESR35872.1| hypothetical protein CICLE_v10028121mg [Citrus clementina]
Length=556

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = +3

Query  228  SLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            + S  +GPLYD +AYTECK+ PE+ LY+GG+L    PE+   I     G YTP F+L +L
Sbjct  23   NFSFADGPLYDFTAYTECKELPEQPLYNGGMLKNHPPENFSSIAHFSTGFYTPAFILHNL  82

Query  408  TAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
            T GTIYCFS W++IE A+SA + ASL TE    +CVG+  AKQGCWSF+KGGFVL SPSN
Sbjct  83   TPGTIYCFSIWLKIEGANSAHVRASLKTENSVYNCVGSAAAKQGCWSFLKGGFVLDSPSN  142

Query  588  LSLLYFQ  608
            LS+L+FQ
Sbjct  143  LSILFFQ  149



>ref|XP_009628223.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628225.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628226.1| PREDICTED: uncharacterized protein LOC104118640 isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = +3

Query  162  MKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPE  341
            M+  +   L FF+  L   + P +S Y+GPLYDSSA+TECK +PE+ LY GGIL  K PE
Sbjct  4    MRGHSIFCLSFFYWVLSVSVPPLVSPYDGPLYDSSAFTECKLYPEKPLYGGGILKDKFPE  63

Query  342  SRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGT  521
             +     +GK V+ P F LQDLT GTIY FS+W++I+NADS+L+TAS+  +  E  CVGT
Sbjct  64   FQGFTVADGKNVHLPVFRLQDLTPGTIYSFSTWIKIKNADSSLITASVGDKDSEELCVGT  123

Query  522  VVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            V AK GCWSF+KGGFV  S  NLS +Y +
Sbjct  124  VDAKPGCWSFLKGGFV-ASKLNLSSIYLK  151



>gb|KDO68006.1| hypothetical protein CISIN_1g035723mg, partial [Citrus sinensis]
Length=528

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = +3

Query  246  GPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            GPLYD +AYTECK+ PE+ LY+GG+L    PE+   I     G YTP F+L +LT GTIY
Sbjct  1    GPLYDFTAYTECKELPEQPLYNGGMLKNHPPENFSSIAHFSTGFYTPAFILHNLTPGTIY  60

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
            CFS W++IE A+SA + ASL TE    +CVG+  AKQGCWSF+KGGFVL SPSNLS+L+F
Sbjct  61   CFSIWLKIEGANSAHVRASLKTENSVYNCVGSAAAKQGCWSFLKGGFVLDSPSNLSILFF  120

Query  606  Q  608
            Q
Sbjct  121  Q  121



>ref|XP_008349367.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=529

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 6/124 (5%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAG  416
            ++EGPLYDS+AYTECK  PEE LY GGI+  ++  S         GVY+ +F+L +LT G
Sbjct  5    SFEGPLYDSTAYTECKLQPEEPLYGGGIIVDRLGNSA------SSGVYSTSFILHNLTQG  58

Query  417  TIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            TIYCFSSWV+IE A SAL+ ASL TE     CVGTV+AK GCWSF+KGGFVL SPS LS 
Sbjct  59   TIYCFSSWVKIEGAGSALIRASLKTENETNKCVGTVLAKHGCWSFLKGGFVLNSPSQLST  118

Query  597  LYFQ  608
            L+FQ
Sbjct  119  LFFQ  122



>ref|XP_009349686.1| PREDICTED: probable endo-1,4-beta-xylanase C [Pyrus x bretschneideri]
Length=533

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 92/124 (74%), Gaps = 6/124 (5%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAG  416
            ++EGPLYDS+AYTECK  P+E LY GGI+  ++  S         GVY+ +F+L +LT G
Sbjct  9    SFEGPLYDSTAYTECKLQPDEPLYGGGIIVDRLGNSA------SSGVYSTSFILHNLTQG  62

Query  417  TIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            TIYCFSSWV+IE A SAL+ ASL TE    +CVGTV+AK GCWSF+KGGFVL SPS LS 
Sbjct  63   TIYCFSSWVKIEGAGSALIRASLKTENETHNCVGTVLAKHGCWSFLKGGFVLNSPSQLST  122

Query  597  LYFQ  608
            L+FQ
Sbjct  123  LFFQ  126



>ref|XP_009761411.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009761412.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009761413.1| PREDICTED: uncharacterized protein LOC104213578 isoform X1 [Nicotiana 
sylvestris]
Length=557

 Score =   153 bits (386),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = +3

Query  162  MKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPE  341
            M+  +   L FF+  L   + P +S Y+GPLYDS A+TECK +PE+ LY GGIL  K PE
Sbjct  4    MRGHSIICLSFFYWVLSVSVPPLVSPYDGPLYDSCAFTECKLYPEKPLYGGGILKDKFPE  63

Query  342  SRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGT  521
             +     + K V+ P F LQD+T GTIY FS+W++++NADSAL+T S+  +  E  CVGT
Sbjct  64   FQGFTAPDEKTVHLPVFRLQDITPGTIYSFSTWIKLKNADSALITVSVGDKDSEELCVGT  123

Query  522  VVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            V AK GCWSF+KGGFV  S  NLS +YF+
Sbjct  124  VDAKPGCWSFLKGGFV-ASKLNLSSIYFK  151



>ref|XP_002306176.2| hypothetical protein POPTR_0004s17900g [Populus trichocarpa]
 gb|EEE86687.2| hypothetical protein POPTR_0004s17900g [Populus trichocarpa]
Length=543

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTI  422
            +GPLYD +AYTECK  PE+ LY+GGI   + P ++  I  +  G YTP  +LQ+L   T+
Sbjct  13   DGPLYDFTAYTECKSVPEKPLYNGGIFKDQAPLTQHRISTSSDGSYTPALILQNLAQNTM  72

Query  423  YCFSSWVRIENADSALLTASLMTEKGEP-DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            YCFS WV+I+ ADS L+TASLM       DCVGTV+AK GCWSF+KGGF+L SPS++S+L
Sbjct  73   YCFSIWVKIQGADSTLVTASLMANNNSTYDCVGTVLAKSGCWSFLKGGFILDSPSSVSIL  132

Query  600  YFQ  608
            YFQ
Sbjct  133  YFQ  135



>ref|XP_011457932.1| PREDICTED: uncharacterized protein LOC101305915 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=556

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +3

Query  222  NPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQ  401
            +P + +++GPLYDS+AYTECK+ PE+ LY GGI+   V E   V+  +  GVY+P FLL+
Sbjct  22   SPFVFSFDGPLYDSTAYTECKRQPEKPLYGGGII---VDEPSAVVDRDKGGVYSPAFLLK  78

Query  402  DLTA-GTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTS  578
            +LT  GTIY FSSWV++ +A SA++ ASL  E     C+GTV+AK+GCWSF+KGGFVL S
Sbjct  79   NLTGNGTIYSFSSWVKLRSAGSAMIQASLKAEDETYSCIGTVLAKRGCWSFLKGGFVLDS  138

Query  579  PSNLSLLYFQ  608
            PSNLS+L+FQ
Sbjct  139  PSNLSILFFQ  148



>ref|XP_010090320.1| Endo-1,4-beta-xylanase A [Morus notabilis]
 gb|EXB39290.1| Endo-1,4-beta-xylanase A [Morus notabilis]
Length=548

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 6/130 (5%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPES----RQVIGLNG--KGVYTPTFLL  398
            T +GPLYD +AYTECK  PE  LYSGGIL GK P S       +G +G   GVY+P FLL
Sbjct  12   TADGPLYDFTAYTECKAKPEGPLYSGGILKGKRPASVDGSDTGLGDSGASSGVYSPAFLL  71

Query  399  QDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTS  578
            ++L+  T+YCFSSWV++E A  AL+ ASL TE     C+GTV+A+ GCWSFIKGGF L S
Sbjct  72   RNLSQTTVYCFSSWVKMEGARPALIRASLKTENETYGCIGTVLARPGCWSFIKGGFTLNS  131

Query  579  PSNLSLLYFQ  608
            PSNLS+LYF+
Sbjct  132  PSNLSILYFE  141



>gb|KHN20002.1| Endo-1,4-beta-xylanase A [Glycine soja]
Length=551

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 100/152 (66%), Gaps = 13/152 (9%)
 Frame = +3

Query  153  FCSMKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGK  332
            FCS+       + FFFL     ++P    Y+GPLYDS+AYTECK+ PEE LY GG+   +
Sbjct  6    FCSL-------IVFFFLIGASLVSP---LYDGPLYDSTAYTECKEKPEEPLYGGGLFKTE  55

Query  333  VPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDC  512
                R  I  N    Y P+ +L +LT GTIY FS+WVR++++ SA++  +L TEK   DC
Sbjct  56   QHSRRGSIANNS---YVPSLVLYNLTQGTIYSFSAWVRVKDSSSAMIRTTLETEKETHDC  112

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +GTV AK  CWSF+KGGFVL  PSNLS+++FQ
Sbjct  113  IGTVSAKHRCWSFLKGGFVLNWPSNLSIIFFQ  144



>ref|XP_006581102.1| PREDICTED: probable endo-1,4-beta-xylanase C-like [Glycine max]
Length=551

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 100/152 (66%), Gaps = 13/152 (9%)
 Frame = +3

Query  153  FCSMKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGK  332
            FCS+       + FFFL     ++P    Y+GPLYDS+AYTECK+ PEE LY GG+   +
Sbjct  6    FCSL-------IVFFFLIGASLVSP---LYDGPLYDSTAYTECKEKPEEPLYGGGLFKTE  55

Query  333  VPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDC  512
                R  I  N    Y P+ +L +LT GTIY FS+WVR++++ SA++  +L TEK   DC
Sbjct  56   QHSRRGSIANNS---YVPSLVLYNLTQGTIYSFSAWVRVKDSSSAMIRTTLETEKETHDC  112

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +GTV AK  CWSF+KGGFVL  PSNLS+++FQ
Sbjct  113  IGTVSAKHRCWSFLKGGFVLNWPSNLSIIFFQ  144



>ref|XP_011092888.1| PREDICTED: uncharacterized protein LOC105172963 isoform X1 [Sesamum 
indicum]
Length=554

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = +3

Query  213  YFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTF  392
            +F +P +S+Y+GPLYDSSAYTECK  PEE LY+GG+L  + P   QVI  NG  +++ +F
Sbjct  16   FFTSPFVSSYDGPLYDSSAYTECKLQPEEPLYNGGMLKNQEPNIEQVILDNGDRLHSLSF  75

Query  393  LLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVL  572
             L +L   T YCFS W++  +ADSAL+  SL+TE+    C+GTV+AKQGCWSF+KGGFVL
Sbjct  76   PLTNLNQRTKYCFSIWIKTNDADSALIRTSLVTEETTIKCIGTVIAKQGCWSFLKGGFVL  135

Query  573  TSPSNLSLLYFQ  608
            +S SN S LY Q
Sbjct  136  SSSSNSSKLYIQ  147



>ref|XP_010646993.1| PREDICTED: probable endo-1,4-beta-xylanase C [Vitis vinifera]
 ref|XP_002277675.2| PREDICTED: probable endo-1,4-beta-xylanase C [Vitis vinifera]
Length=550

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 94/128 (73%), Gaps = 3/128 (2%)
 Frame = +3

Query  225  PSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQD  404
            P  + Y+GPLYD SAYT+CK   E  LY+GGIL G   +  +V+     GVY+P F+L++
Sbjct  19   PLAAPYDGPLYDFSAYTQCKTRAEGPLYNGGILKGARWDIPRVLA---DGVYSPAFVLRN  75

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            LT GT YCFSSWV+I+ ADSA + ASLM+EK   +CVGTV A++GCWSF+KGGFVL  P 
Sbjct  76   LTTGTKYCFSSWVKIKGADSAPIRASLMSEKKTINCVGTVTARRGCWSFLKGGFVLDEPL  135

Query  585  NLSLLYFQ  608
            + SLL+FQ
Sbjct  136  DYSLLFFQ  143



>emb|CBI37893.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 105/156 (67%), Gaps = 8/156 (5%)
 Frame = +3

Query  156  CSMKMKNTATLPFFFLFLGY-----FINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGI  320
            CS+    + + P +F +L       F +   +T +GPLYD SAYT+CK   E  LY+GGI
Sbjct  66   CSLWYHLSLSHPHWFQYLMLMGVFSFFDLVSNTADGPLYDFSAYTQCKTRAEGPLYNGGI  125

Query  321  LGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKG  500
            L G   +  +V+     GVY+P F+L++LT GT YCFSSWV+I+ ADSA + ASLM+EK 
Sbjct  126  LKGARWDIPRVLA---DGVYSPAFVLRNLTTGTKYCFSSWVKIKGADSAPIRASLMSEKK  182

Query  501  EPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
              +CVGTV A++GCWSF+KGGFVL  P + SLL+FQ
Sbjct  183  TINCVGTVTARRGCWSFLKGGFVLDEPLDYSLLFFQ  218



>ref|XP_009615209.1| PREDICTED: endo-1,4-beta-xylanase A-like [Nicotiana tomentosiformis]
Length=561

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKG  374
             F F+ +  +      +GP+YDSSA+TEC+  PE  LY+GGIL  K+PE + V  +NG  
Sbjct  15   LFPFIFFATSSQAKHDDGPVYDSSAWTECQTDPEAPLYNGGILVNKLPEYKPVKDINGDM  74

Query  375  VYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            V +PTF LQ+L+ G+ Y FSSWVR++NADSAL++A++  E     C+G+V+AK+GCWSF+
Sbjct  75   VNSPTFTLQNLSPGSFYSFSSWVRVKNADSALISATIKVENTFAKCIGSVIAKKGCWSFL  134

Query  555  KGGFVLTSPSNLSLLYFQ  608
            KGGF   SPS  S + FQ
Sbjct  135  KGGFRWDSPSTSSQMDFQ  152



>ref|XP_009340235.1| PREDICTED: probable endo-1,4-beta-xylanase C [Pyrus x bretschneideri]
Length=550

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAG  416
            +++GPLYD +AYTECK  PEE LY GGI+  ++  S         GVY+P+F+L +LT G
Sbjct  26   SFDGPLYDPTAYTECKLQPEEPLYGGGIIVDQLGTSA------SSGVYSPSFVLHNLTQG  79

Query  417  TIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            TIYCFSSWV+IE   S L+ ASL TE    +CVGTV+AK  CWSF+KGGFVL SPS LS+
Sbjct  80   TIYCFSSWVKIEGTGSGLIRASLRTENEIYNCVGTVLAKDRCWSFLKGGFVLNSPSQLSI  139

Query  597  LYFQ  608
            L+FQ
Sbjct  140  LFFQ  143



>ref|XP_008372900.1| PREDICTED: probable endo-1,4-beta-xylanase C [Malus domestica]
Length=550

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAG  416
            +++GPLYD +AYTECK  PEE LY GGI+  ++  +         GVY+P+F+L +LT G
Sbjct  26   SFDGPLYDPTAYTECKLQPEEPLYGGGIIVDQLGTTA------SSGVYSPSFILHNLTQG  79

Query  417  TIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            TIYCFSSWV+IE   S L+ A L TE    +CVGT +AK GCWSF+KGGFVLTSPS LS+
Sbjct  80   TIYCFSSWVKIEGEGSGLIRAXLQTENEIYNCVGTALAKHGCWSFLKGGFVLTSPSQLSI  139

Query  597  LYFQ  608
            L+FQ
Sbjct  140  LFFQ  143



>ref|XP_006343478.1| PREDICTED: uncharacterized protein LOC102583591 [Solanum tuberosum]
Length=543

 Score =   145 bits (365),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 94/127 (74%), Gaps = 1/127 (1%)
 Frame = +3

Query  228  SLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            S+S Y+GPLYDSSA++ECKQ+PE  LY GGIL  K+PE +     +G  V  P F LQD+
Sbjct  12   SVSPYDGPLYDSSAFSECKQYPENPLYGGGILKDKLPEFQLFTREDGITVNLPIFKLQDI  71

Query  408  TAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
            T GTIY FS+W++I+NADSA++TAS+  +  +  CVGTV AK GCWSF+KGGFV +S  N
Sbjct  72   TPGTIYSFSTWIKIKNADSAVITASVGDKDSDELCVGTVDAKAGCWSFLKGGFVASS-LN  130

Query  588  LSLLYFQ  608
            +S +Y +
Sbjct  131  ISSIYLK  137



>ref|XP_004250707.1| PREDICTED: uncharacterized protein LOC101263970 isoform X1 [Solanum 
lycopersicum]
Length=549

 Score =   144 bits (364),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 103/148 (70%), Gaps = 7/148 (5%)
 Frame = +3

Query  165  KMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPES  344
            +M++ A     FL+    ++P    Y+GPLYDSSA++ECKQ+PE+ LY+GGIL   +PE 
Sbjct  3    RMRSHAMFSLSFLYWMLSVSP----YDGPLYDSSAFSECKQYPEKPLYAGGILKDNLPEF  58

Query  345  RQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTV  524
             +  G+    V  P F LQD+T GTIY FS+W++I+NADSA++TAS+  +  +  CVGTV
Sbjct  59   TRADGITT--VNLPIFKLQDITPGTIYSFSTWIKIKNADSAVITASVGDQDSDELCVGTV  116

Query  525  VAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             AK GCWSF+KGGFV +S  N+S +Y +
Sbjct  117  DAKPGCWSFLKGGFVASS-LNISSIYLK  143



>ref|XP_007137357.1| hypothetical protein PHAVU_009G120500g [Phaseolus vulgaris]
 gb|ESW09351.1| hypothetical protein PHAVU_009G120500g [Phaseolus vulgaris]
Length=559

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 100/152 (66%), Gaps = 14/152 (9%)
 Frame = +3

Query  186  LPFFFLFLGYFINP-SLST--YEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVI  356
            +PF+ L L   + P SL +  Y+GPLYD +A+TECK+ PEE LY GG+L     + R   
Sbjct  4    IPFYVLILSLLLIPTSLVSPLYDGPLYDFTAHTECKEKPEEPLYGGGVLKS---QQRSPP  60

Query  357  GLNGK--------GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDC  512
            GL             Y P+ LL +LT GTIY FS+WVR++ + S ++ A+L TEK   DC
Sbjct  61   GLQDNIASSYVVNNTYVPSLLLYNLTQGTIYTFSAWVRVKGSSSGMIRATLETEKETYDC  120

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +GTV AK GCWSF+KGGFVLTS SNLS+++FQ
Sbjct  121  IGTVSAKLGCWSFLKGGFVLTSSSNLSVIFFQ  152



>ref|XP_008457673.1| PREDICTED: uncharacterized protein LOC103497316 [Cucumis melo]
Length=556

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 99/151 (66%), Gaps = 6/151 (4%)
 Frame = +3

Query  168  MKNTATLPFFFLFLGYFINPSL----STYEGPLYDSSAYTECKQHPEEALYSGGILGGKV  335
            M+N      F LF+ +  +P L     +Y+GPLYD +A+TECK  PE+ LY+GGIL  + 
Sbjct  1    MRNFHPFSTFLLFV-FLFHPLLLVLVDSYDGPLYDYTAHTECKLRPEKPLYNGGILKNQA  59

Query  336  PESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCV  515
              S Q IG     +Y+P FLL +LTA T Y FSSWV++  A S+++ ASL  E    +C+
Sbjct  60   L-SVQAIGDTSNAIYSPAFLLHNLTAKTYYSFSSWVKLGGAVSSVVRASLRIENETYNCI  118

Query  516  GTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            GTV+AK GCWSF+KGGF +  PSN S+L+FQ
Sbjct  119  GTVLAKHGCWSFLKGGFFMNLPSNFSILFFQ  149



>ref|XP_010431807.1| PREDICTED: uncharacterized protein LOC104716145 [Camelina sativa]
Length=556

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 2/127 (2%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGV-YTPTFLLQDLT  410
            S+Y+GP YDS+AYTECK   E+ LY+GG+L  K P       L G G  YTP ++L +LT
Sbjct  21   SSYDGPFYDSTAYTECKAEAEKPLYNGGMLKDKRPSVSGRDTLTGVGARYTPAYILHNLT  80

Query  411  AGTIYCFSSWVRIE-NADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
              TIYCFS WV+IE  A SA + A L T+    +CVG+V AK GCWSF+KGGF+L SPSN
Sbjct  81   QNTIYCFSIWVKIEAGAASARVRARLRTDNTTLNCVGSVSAKHGCWSFLKGGFLLNSPSN  140

Query  588  LSLLYFQ  608
            LS+L+F+
Sbjct  141  LSILFFE  147



>ref|XP_010531544.1| PREDICTED: uncharacterized protein LOC104807819 [Tarenaya hassleriana]
Length=559

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 9/142 (6%)
 Frame = +3

Query  198  FLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGV  377
            F ++ + + P  ++YEGP YDS+AYTECK  PE ALY+GGIL  +      V G +    
Sbjct  13   FFWVLFLLFPLAASYEGPFYDSTAYTECKLEPERALYNGGILKDEAYGVALVEGAH----  68

Query  378  YTPTFLLQDLTAGTIYCFSSWVRIENADSAL-----LTASLMTEKGEPDCVGTVVAKQGC  542
            YTP FLLQ+LT   IYCFS WV++E   S+      + A L T+    DC+G+V A++GC
Sbjct  69   YTPAFLLQNLTQHIIYCFSIWVKMEGGGSSAGAAQHVRAMLRTDDETFDCIGSVSARRGC  128

Query  543  WSFIKGGFVLTSPSNLSLLYFQ  608
            WSF+KGGFVL SPSNLS+L+FQ
Sbjct  129  WSFLKGGFVLHSPSNLSILFFQ  150



>ref|XP_006411655.1| hypothetical protein EUTSA_v10024805mg [Eutrema salsugineum]
 gb|ESQ53108.1| hypothetical protein EUTSA_v10024805mg [Eutrema salsugineum]
Length=561

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 96/152 (63%), Gaps = 5/152 (3%)
 Frame = +3

Query  162  MKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPE  341
            M+  + + L F+ +FL      + + Y+GP YDS+AYTEC+  PE+ LY+GGIL  K P 
Sbjct  1    MRHSSMSGLVFWTIFL--LTASTQAYYDGPFYDSTAYTECRAEPEKPLYNGGILKDKEPS  58

Query  342  SRQVIGLNGKGV-YTPTFLLQDLTAGTIYCFSSWVRIEN--ADSALLTASLMTEKGEPDC  512
                  L   G  YTP ++L +LT  TIYCFS WV+IE   A SA + A L TE     C
Sbjct  59   VSGTDTLRSVGTRYTPAYILHNLTQNTIYCFSIWVKIEEGGAASARVRARLRTENATLSC  118

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            VG+V AK GCWSF+KGGF+  SPS LS+L+F+
Sbjct  119  VGSVSAKNGCWSFLKGGFLAHSPSQLSILFFE  150



>ref|XP_011092889.1| PREDICTED: endo-1,4-beta-xylanase 1 isoform X2 [Sesamum indicum]
Length=532

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTI  422
            +GPLYDSSAYTECK  PEE LY+GG+L  + P   QVI  NG  +++ +F L +L   T 
Sbjct  4    DGPLYDSSAYTECKLQPEEPLYNGGMLKNQEPNIEQVILDNGDRLHSLSFPLTNLNQRTK  63

Query  423  YCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            YCFS W++  +ADSAL+  SL+TE+    C+GTV+AKQGCWSF+KGGFVL+S SN S LY
Sbjct  64   YCFSIWIKTNDADSALIRTSLVTEETTIKCIGTVIAKQGCWSFLKGGFVLSSSSNSSKLY  123

Query  603  FQ  608
             Q
Sbjct  124  IQ  125



>ref|XP_006577900.1| PREDICTED: uncharacterized protein LOC100793558 [Glycine max]
 gb|KHN33681.1| Endo-1,4-beta-xylanase A [Glycine soja]
Length=557

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 98/158 (62%), Gaps = 19/158 (12%)
 Frame = +3

Query  153  FCSMKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG--  326
            FCS+       + FFFL     ++P    Y+GPLYDS+AY ECK+ PEE LY GG+    
Sbjct  6    FCSL-------IVFFFLIGASLVSP---LYDGPLYDSTAYAECKEKPEEPLYGGGLFNTR  55

Query  327  ----GKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTE  494
                G +  S   +  N    Y P+ +L +LT GTIY FS+WVR++ + SA++  +L TE
Sbjct  56   RGVEGTIDSSISNVANNS---YVPSLVLYNLTQGTIYSFSAWVRVKGSSSAMVRTTLETE  112

Query  495  KGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            K   DC+GTV AK  CWSF+KGGFVL   SNLS+++FQ
Sbjct  113  KETHDCIGTVSAKHECWSFLKGGFVLNWSSNLSMIFFQ  150



>gb|EYU40424.1| hypothetical protein MIMGU_mgv1a020606mg, partial [Erythranthe 
guttata]
Length=520

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 8/121 (7%)
 Frame = +3

Query  246  GPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            GPLYDSSAYTECK  PE+ LY+GGIL   +        +N   + +P+F+LQ+L   T Y
Sbjct  1    GPLYDSSAYTECKLQPEKPLYNGGILNNPL--------VNRDRINSPSFVLQNLQNATKY  52

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
            CFS W++I   + AL+ AS++TE     C+GTV+AK+GCWSF+KGGFVL+SPSNLS LY 
Sbjct  53   CFSIWIKINEPEPALVRASVVTEATTLKCIGTVIAKEGCWSFLKGGFVLSSPSNLSTLYI  112

Query  606  Q  608
            Q
Sbjct  113  Q  113



>ref|XP_010436963.1| PREDICTED: uncharacterized protein LOC104720780 isoform X1 [Camelina 
sativa]
Length=556

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 89/127 (70%), Gaps = 2/127 (2%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGV-YTPTFLLQDLT  410
            S+Y+GP YDS+AYTECK   E+ LY+GG+L  + P       L   G  YTP ++LQ+LT
Sbjct  21   SSYDGPFYDSTAYTECKAEAEKPLYNGGMLKDERPSVSGRDTLTDVGARYTPAYILQNLT  80

Query  411  AGTIYCFSSWVRIE-NADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
              TIYCFS WV+IE  A SA + A L T+    +CVG+V AK GCWSF+KGGF+L SPSN
Sbjct  81   QNTIYCFSIWVKIEAGAASARVRARLRTDNTTLNCVGSVSAKHGCWSFLKGGFLLNSPSN  140

Query  588  LSLLYFQ  608
            LS+L+F+
Sbjct  141  LSILFFE  147



>gb|KGN61918.1| hypothetical protein Csa_2G264620 [Cucumis sativus]
Length=556

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +3

Query  231  LSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLT  410
            + +Y+GPLYD +A+TECK  PE+ LY+GGIL  +   S Q IG +   +Y+P FLL +LT
Sbjct  25   VHSYDGPLYDYTAHTECKLRPEKPLYNGGILKNQAL-SIQSIGDSSNAIYSPAFLLHNLT  83

Query  411  AGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNL  590
            A T Y FSSWV++  A S+++ ASL  E    +C+GTV+AK GCWSF+KGGF +  PSN 
Sbjct  84   ARTYYSFSSWVKLGGAVSSVVRASLRMENETYNCIGTVLAKHGCWSFLKGGFFMNLPSNF  143

Query  591  SLLYFQ  608
            S+L+FQ
Sbjct  144  SILFFQ  149



>ref|XP_004231450.1| PREDICTED: endo-1,4-beta-xylanase UM03411 isoform X1 [Solanum 
lycopersicum]
Length=550

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +3

Query  219  INPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLL  398
            I PS ++YE P+YD SAYTECK  PE+ALY+GGI+        +VI        +  F+L
Sbjct  17   ILPSFASYEEPIYDHSAYTECKSVPEDALYNGGIMKDYRTNENKVIR---SETNSYNFVL  73

Query  399  QDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTS  578
             +L+  TIY FSSW+RI +ADSA++ ASL T+ G   CVG V+A+ GCWSF+KGGFVL  
Sbjct  74   NNLSGDTIYSFSSWIRILDADSAVMKASLKTDDGTVKCVGNVIARAGCWSFLKGGFVLDL  133

Query  579  PSNLSLLYFQ  608
            PS+  LLY Q
Sbjct  134  PSSYGLLYLQ  143



>ref|XP_010446374.1| PREDICTED: uncharacterized protein LOC104729170 [Camelina sativa]
Length=561

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 98/152 (64%), Gaps = 5/152 (3%)
 Frame = +3

Query  168  MKNTATLPFFFLFLGYFI---NPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVP  338
            M++++   F F  L  F      + S+Y+GP YDS+AYTECK   E+ LY+GG+L  K P
Sbjct  1    MQHSSMYVFLFWALSLFTAFNTLASSSYDGPFYDSTAYTECKAEAEKPLYNGGMLKDKRP  60

Query  339  ESRQVIGLNG-KGVYTPTFLLQDLTAGTIYCFSSWVRIE-NADSALLTASLMTEKGEPDC  512
                   L G K  YTP ++L +LT  TIYCFS WV+I+  A SA + A L T+    +C
Sbjct  61   SVSGRDTLAGVKARYTPAYILHNLTQNTIYCFSIWVKIKAGATSARVRARLRTDNTTLNC  120

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            VG+V AK GCWSF+KGGF+L SPSN S+L+F+
Sbjct  121  VGSVSAKYGCWSFLKGGFLLNSPSNQSILFFE  152



>ref|XP_009109536.1| PREDICTED: uncharacterized protein LOC103835171 [Brassica rapa]
Length=564

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 101/154 (66%), Gaps = 8/154 (5%)
 Frame = +3

Query  168  MKNTATLPFFFL----FLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKV  335
            MK+++ + F F      L  FI  S S+ +GP YDS+AYTEC+  PE+ LY+GG+L G+ 
Sbjct  1    MKHSSIIGFIFCAIYSLLAAFILVS-SSNDGPFYDSTAYTECRAEPEKPLYNGGMLKGEE  59

Query  336  PESRQVIGLNGKGV-YTPTFLLQDLTAGTIYCFSSWVRIE--NADSALLTASLMTEKGEP  506
                    L   G  YTP ++L +LT  TIYCFS WV+IE  +A +A + A L ++    
Sbjct  60   ASGSGRDTLRSVGASYTPAYILHNLTQNTIYCFSIWVKIEAGSASTARVRAKLRSDNATL  119

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +CVG+V AKQGCWSF+KGGF+L SPS LS+L+F+
Sbjct  120  NCVGSVSAKQGCWSFLKGGFLLDSPSQLSILFFE  153



>emb|CDX90288.1| BnaA08g16960D [Brassica napus]
Length=564

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 101/154 (66%), Gaps = 8/154 (5%)
 Frame = +3

Query  168  MKNTATLPFFFL----FLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKV  335
            MK+++ + F F      L  FI  S S+ +GP YDS+AYTEC+  PE+ LY+GG+L G+ 
Sbjct  1    MKHSSIIGFIFCAIYSLLAAFILVS-SSNDGPFYDSTAYTECRAEPEKPLYNGGMLKGEE  59

Query  336  PESRQVIGLNGKGV-YTPTFLLQDLTAGTIYCFSSWVRIE--NADSALLTASLMTEKGEP  506
                    L   G  YTP ++L +LT  TIYCFS WV+IE  +A +A + A L ++    
Sbjct  60   ASVSGRDTLRSIGASYTPAYILHNLTQNTIYCFSIWVKIEAGSASTARVRAKLRSDNATL  119

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +CVG+V AKQGCWSF+KGGF+L SPS LS+L+F+
Sbjct  120  NCVGSVSAKQGCWSFLKGGFLLDSPSQLSILFFE  153



>ref|XP_004169878.1| PREDICTED: endo-1,4-beta-xylanase C-like, partial [Cucumis sativus]
Length=527

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +3

Query  246  GPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            GPLYD +A+TECK  PE+ LY+GGIL  +   S Q IG +   +Y+P FLL +LTA T Y
Sbjct  1    GPLYDYTAHTECKLRPEKPLYNGGILKNQAL-SIQSIGDSSNAIYSPAFLLHNLTARTYY  59

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
             FSSWV++  A S+++ ASL  E    +C+GTV+AK GCWSF+KGGF +  PSN S+L+F
Sbjct  60   SFSSWVKLGGAVSSVVRASLRMENETYNCIGTVLAKHGCWSFLKGGFFMNLPSNFSILFF  119

Query  606  Q  608
            Q
Sbjct  120  Q  120



>ref|XP_004147070.1| PREDICTED: endo-1,4-beta-xylanase C-like [Cucumis sativus]
Length=532

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +3

Query  246  GPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            GPLYD +A+TECK  PE+ LY+GGIL  +   S Q IG +   +Y+P FLL +LTA T Y
Sbjct  6    GPLYDYTAHTECKLRPEKPLYNGGILKNQAL-SIQSIGDSSNAIYSPAFLLHNLTARTYY  64

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
             FSSWV++  A S+++ ASL  E    +C+GTV+AK GCWSF+KGGF +  PSN S+L+F
Sbjct  65   SFSSWVKLGGAVSSVVRASLRMENETYNCIGTVLAKHGCWSFLKGGFFMNLPSNFSILFF  124

Query  606  Q  608
            Q
Sbjct  125  Q  125



>emb|CDY12095.1| BnaC03g60110D [Brassica napus]
Length=487

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 100/154 (65%), Gaps = 8/154 (5%)
 Frame = +3

Query  168  MKNTATLPFFFL----FLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKV  335
            MK+++ + F F      L  F+  S S+ +GP YDS+AYTEC+  PE+ LY+GG+L  K 
Sbjct  1    MKHSSIIAFIFSAIYSLLTAFVLAS-SSNDGPFYDSTAYTECRAEPEKPLYNGGMLNEKE  59

Query  336  PESRQVIGLNGKGV-YTPTFLLQDLTAGTIYCFSSWVRIE--NADSALLTASLMTEKGEP  506
                    L   G  YTP ++L +LT  TIYCFS WV+I+  +A +A + A L ++    
Sbjct  60   ASVSGGDTLRSVGASYTPAYILHNLTQNTIYCFSIWVKIKAGSASTARVRAKLRSDNATL  119

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +CVG+V AKQGCWSF+KGGF+L SPS LS+L+F+
Sbjct  120  NCVGSVSAKQGCWSFLKGGFLLDSPSQLSILFFE  153



>ref|XP_006283441.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
 gb|EOA16339.1| hypothetical protein CARUB_v10004489mg [Capsella rubella]
Length=560

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 4/151 (3%)
 Frame = +3

Query  168  MKNTATLPFFFLFLGYFINPSL--STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPE  341
            M++++     F  L      +L  S+ +G  YDS+AYTECK   E+ LY+GG+L  K P 
Sbjct  1    MQHSSMCALIFWALSLLAASTLASSSNDGSFYDSTAYTECKAEAEKPLYNGGMLKDKEPS  60

Query  342  SRQVIGLNGKGV-YTPTFLLQDLTAGTIYCFSSWVRIEN-ADSALLTASLMTEKGEPDCV  515
                  L G G  YTP ++L +LT  TIYCFS WV+IE+ A SA + A L  +    +CV
Sbjct  61   VLGRDTLTGVGARYTPAYILHNLTQNTIYCFSIWVKIESGAASARVRARLRADNTTLNCV  120

Query  516  GTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            G+V AK GCWSF+KGGF+L+SPSNLS+L F+
Sbjct  121  GSVSAKHGCWSFLKGGFLLSSPSNLSILIFE  151



>ref|XP_004500734.1| PREDICTED: probable endo-1,4-beta-xylanase C-like [Cicer arietinum]
Length=537

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 88/138 (64%), Gaps = 14/138 (10%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKG  374
             F  LG  ++   S Y+GPLYDS+AYTECK+ PE+ LY GG+          V+      
Sbjct  7    LFFLLG--VSLVTSFYDGPLYDSTAYTECKEQPEKPLYGGGVFHSTDIADGNVV------  58

Query  375  VYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
                     +LT  +IY FS+W+R++N+DSA++ ASL TE    +C+GTV  K+GCWSF+
Sbjct  59   ------FFYNLTHNSIYSFSAWLRVQNSDSAMIRASLETENETDNCIGTVSVKRGCWSFL  112

Query  555  KGGFVLTSPSNLSLLYFQ  608
            KGGFVL SPSNLS +YF+
Sbjct  113  KGGFVLNSPSNLSTIYFK  130



>ref|XP_002866813.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43072.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 2/124 (2%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGV-YTPTFLLQDLTAGT  419
            +GP YDS+AYTEC+   E+ LY+GG+L  + P       L G G  YTPT++L +LT  T
Sbjct  30   DGPFYDSTAYTECRAEAEKPLYNGGMLKDQKPSVSGRDSLTGIGARYTPTYILHNLTQNT  89

Query  420  IYCFSSWVRIE-NADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            IYCFS WV+IE  A SA + A L  +    +CVG+V AK GCWSF+KGGF+L SP N S+
Sbjct  90   IYCFSIWVKIEAGAASARVRARLRADNATLNCVGSVTAKHGCWSFLKGGFLLDSPCNQSI  149

Query  597  LYFQ  608
            L+F+
Sbjct  150  LFFE  153



>ref|XP_006422633.1| hypothetical protein CICLE_v10030219mg, partial [Citrus clementina]
 gb|ESR35873.1| hypothetical protein CICLE_v10030219mg, partial [Citrus clementina]
Length=496

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  249  PLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYC  428
            PLYD +AYTECK+ PE+ LY GG+L  +  ++   +  +    YTP F+L +LT GTIYC
Sbjct  2    PLYDFTAYTECKESPEKPLYDGGMLRKQSLKNPSWVAYSETSFYTPAFILHNLTQGTIYC  61

Query  429  FSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            FS WV+IE A+SA + ASL TE    DCVG+V AKQGCWSF+KGGFVL S SNLSLL+FQ
Sbjct  62   FSIWVKIEGANSADIRASLETENELYDCVGSVTAKQGCWSFLKGGFVLDSSSNLSLLFFQ  121



>ref|XP_010690392.1| PREDICTED: endo-1,4-beta-xylanase 5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 86/125 (69%), Gaps = 8/125 (6%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTA  413
            ++Y+GPLYDSSAYTECK HPE+ LY+GGIL       R+    +     +PTF+L +L +
Sbjct  19   NSYDGPLYDSSAYTECKVHPEDPLYNGGILQA----YRKFYISDAS---SPTFMLHNL-S  70

Query  414  GTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLS  593
               Y FS+WV IE   S L+ ASL TE     C+G+V+AKQGCWSF+KGGFVL  PS+ S
Sbjct  71   NAFYTFSAWVMIEGVGSTLVRASLRTEHATFSCIGSVIAKQGCWSFLKGGFVLDLPSDNS  130

Query  594  LLYFQ  608
            +LYFQ
Sbjct  131  ILYFQ  135



>ref|XP_011088586.1| PREDICTED: uncharacterized protein LOC105169775 isoform X1 [Sesamum 
indicum]
Length=558

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/131 (53%), Positives = 89/131 (68%), Gaps = 13/131 (10%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKG------VYTPTFLL  398
            T +GPLYD SAYTECK  PE+ LY GGI+        Q +G+  +       V +P F+L
Sbjct  27   TGDGPLYDYSAYTECKSAPEDPLYDGGII------KNQSLGVYNRPHPPRFPVNSPAFVL  80

Query  399  QDLTAGTIYCFSSWVRI-ENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLT  575
             +LT  TIYCFSSWV+I   A SA++ ASL T+    +C+GTV+AK+GCWSF+KGGFVL 
Sbjct  81   NNLTGNTIYCFSSWVKITAGAASAVIKASLTTDNVTFNCMGTVIAKRGCWSFLKGGFVLN  140

Query  576  SPSNLSLLYFQ  608
            SPS  +L+YFQ
Sbjct  141  SPSAYALIYFQ  151



>ref|XP_010315367.1| PREDICTED: endo-1,4-beta-xylanase UM03411 isoform X2 [Solanum 
lycopersicum]
Length=533

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTI  422
            E P+YD SAYTECK  PE+ALY+GGI+        +VI        +  F+L +L+  TI
Sbjct  8    EEPIYDHSAYTECKSVPEDALYNGGIMKDYRTNENKVIR---SETNSYNFVLNNLSGDTI  64

Query  423  YCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            Y FSSW+RI +ADSA++ ASL T+ G   CVG V+A+ GCWSF+KGGFVL  PS+  LLY
Sbjct  65   YSFSSWIRILDADSAVMKASLKTDDGTVKCVGNVIARAGCWSFLKGGFVLDLPSSYGLLY  124

Query  603  FQ  608
             Q
Sbjct  125  LQ  126



>ref|XP_007201160.1| hypothetical protein PRUPE_ppa004290mg [Prunus persica]
 gb|EMJ02359.1| hypothetical protein PRUPE_ppa004290mg [Prunus persica]
Length=518

 Score =   130 bits (326),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 3/110 (3%)
 Frame = +3

Query  288  HPEEALYSGGILGGKVPESRQVIG---LNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
             P  ALY GGI+  +   +   +G       GVY+P+F+L +L+ GTIYCFSSWV+IE A
Sbjct  2    QPGAALYGGGIINDQASGAEGSLGNSATTSSGVYSPSFILHNLSQGTIYCFSSWVKIEGA  61

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             SAL+ ASL TEK   DC+GTV+AK GCWSF+KGGFVL SPS LS+L+FQ
Sbjct  62   GSALIRASLKTEKETYDCIGTVLAKHGCWSFLKGGFVLNSPSQLSMLFFQ  111



>ref|XP_009799022.1| PREDICTED: endo-1,4-beta-xylanase A-like [Nicotiana sylvestris]
Length=557

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKG  374
             F F+ +  +      +GP+YDSSA+TEC+  PE  LY+GGIL  K+PE + V  +NG  
Sbjct  11   LFPFIFFATSSQAKHDDGPVYDSSAWTECQSDPEAPLYNGGILVNKLPEYKPVKDINGDM  70

Query  375  VYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            V +PTF L +L++G+ Y FSSWVR++N +SAL++A++  E     C+G+V+AK+GCWSF+
Sbjct  71   VNSPTFTLPNLSSGSFYSFSSWVRVKNVNSALISATIKVENTFAKCIGSVIAKKGCWSFL  130

Query  555  KGGFVLTSPSNLSLLYFQ  608
            KGGF   SPS  S + FQ
Sbjct  131  KGGFRWDSPSTSSQMDFQ  148



>ref|NP_195577.2| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 gb|AAO42885.1| At4g38650 [Arabidopsis thaliana]
 dbj|BAE99535.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86958.1| glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
Length=562

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 83/124 (67%), Gaps = 2/124 (2%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGV-YTPTFLLQDLTAGT  419
            +GP YDS+AYTEC+   E+ LY+GG+L  + P       L G G  YTPT++L +LT  T
Sbjct  30   DGPFYDSTAYTECRAEAEKPLYNGGMLKDQKPSVPGKDSLTGIGAHYTPTYILHNLTQNT  89

Query  420  IYCFSSWVRIE-NADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            IYCFS WV+IE  A SA + A L  +    +CVG+V AK GCWSF+KGGF+L SP   S+
Sbjct  90   IYCFSIWVKIEAGAASAHVRARLRADNATLNCVGSVTAKHGCWSFLKGGFLLDSPCKQSI  149

Query  597  LYFQ  608
            L+F+
Sbjct  150  LFFE  153



>ref|XP_008781049.1| PREDICTED: endo-1,4-beta-xylanase-like [Phoenix dactylifera]
Length=566

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 89/153 (58%), Gaps = 3/153 (2%)
 Frame = +3

Query  159  SMKMKNTATLPFFFLFLGYFINPS---LSTYEGPLYDSSAYTECKQHPEEALYSGGILGG  329
            SM+  +      F   L + I PS    ++YEGP YD SAYTECK  PE  LY+GGIL  
Sbjct  4    SMRALSHGFFALFLKLLPWLILPSHLLAASYEGPWYDFSAYTECKPDPEPPLYNGGILQS  63

Query  330  KVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPD  509
            +  E          G + P F+L +LT  T Y FS WV+I+  DSAL+ A L T+  +  
Sbjct  64   ENGEIPMAYDTTETGAHRPAFVLGNLTETTRYSFSCWVQIQGTDSALIRAVLATDDSKFR  123

Query  510  CVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            CVGT  A+ GCWSF+KGGF+L + S  S+L+ Q
Sbjct  124  CVGTTTAQNGCWSFLKGGFILDASSKTSVLFLQ  156



>gb|AHH32689.1| xylanase 3, partial [Phoenix dactylifera]
Length=460

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILG---GKVPESRQVIGLNGKGVYTPTFLLQD  404
            ++Y+GP YD  A TECK +PE  LY GGIL    GK+P +   +     GVY+P F+L +
Sbjct  21   ASYDGPRYDYYASTECKTYPEAPLYDGGILADRTGKIPMTYYKME---TGVYSPAFVLYN  77

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            LT  T Y FS WV+I+   S LL A L TE     CVGT  AK  CWSF+KGGFVL SPS
Sbjct  78   LTGTTRYTFSCWVKIKGTVSTLLKARLSTETSTSKCVGTASAKSSCWSFLKGGFVLDSPS  137

Query  585  NLSLLYFQ  608
              S+LYFQ
Sbjct  138  QTSILYFQ  145



>gb|AES74285.2| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=535

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 85/126 (67%), Gaps = 5/126 (4%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPT-FLLQDLT  410
            S+  GPLYD +AYT+CK+HPE+ LY GG+   K   +     +N   +  P+  +L +LT
Sbjct  7    SSSNGPLYDFTAYTQCKEHPEKPLYGGGVFNIKDKGN----AVNNTNINMPSSLVLYNLT  62

Query  411  AGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNL  590
              TIY FS WV++E +DS ++ A L TE    +C+GTV+AK+GCWSF+KGGF+L SPSN 
Sbjct  63   YDTIYSFSVWVKVEYSDSVMIKAKLETENETYNCIGTVLAKRGCWSFLKGGFLLNSPSNS  122

Query  591  SLLYFQ  608
            S ++F 
Sbjct  123  STIFFH  128



>ref|XP_008788407.1| PREDICTED: endo-1,4-beta-xylanase A-like [Phoenix dactylifera]
Length=553

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 81/128 (63%), Gaps = 6/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILG---GKVPESRQVIGLNGKGVYTPTFLLQD  404
            ++Y+GP YD  A TECK +PE  LY GGIL    GK+P +   +     GVY+P F+L +
Sbjct  21   ASYDGPRYDYYASTECKTYPEAPLYDGGILADRTGKIPMTYYKME---TGVYSPAFVLYN  77

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            LT  T Y FS WV+I+   S LL A L TE     CVGT  AK  CWSF+KGGFVL SPS
Sbjct  78   LTGTTRYTFSCWVKIKGTVSTLLKARLSTETSTSKCVGTASAKSSCWSFLKGGFVLDSPS  137

Query  585  NLSLLYFQ  608
              S+LYFQ
Sbjct  138  QTSILYFQ  145



>ref|XP_010066269.1| PREDICTED: uncharacterized protein LOC104453421 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64117.1| hypothetical protein EUGRSUZ_G01773 [Eucalyptus grandis]
Length=549

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 93/150 (62%), Gaps = 11/150 (7%)
 Frame = +3

Query  168  MKNTATLPFFFLFLGYFINPSLS-TYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPES  344
            MK+ +    F +F     +P ++ + + P YD +AYT+CK+ PE+ LY+GGIL     E 
Sbjct  1    MKDASAFISFLVFFLLLCSPWIAASLDDPQYDHTAYTKCKEEPEKPLYNGGIL-----EP  55

Query  345  RQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIE--NADSALLTASLMTEKGEPDCVG  518
             Q+         +P  LL +LTA T Y FSSWV+IE  ++DSAL+TASL T     DC+G
Sbjct  56   HQLPQFASS---SPALLLHNLTASTKYSFSSWVKIESSDSDSALVTASLRTNHETYDCIG  112

Query  519  TVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            TV AK GCWSF+KGGF L  PSN + L FQ
Sbjct  113  TVAAKSGCWSFLKGGFTLDLPSNSATLSFQ  142



>ref|XP_009761414.1| PREDICTED: uncharacterized protein LOC104213578 isoform X2 [Nicotiana 
sylvestris]
Length=530

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 79/113 (70%), Gaps = 1/113 (1%)
 Frame = +3

Query  270  YTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRI  449
            +T CK +PE+ LY GGIL  K PE +     + K V+ P F LQD+T GTIY FS+W+++
Sbjct  13   FTNCKLYPEKPLYGGGILKDKFPEFQGFTAPDEKTVHLPVFRLQDITPGTIYSFSTWIKL  72

Query  450  ENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +NADSAL+T S+  +  E  CVGTV AK GCWSF+KGGFV  S  NLS +YF+
Sbjct  73   KNADSALITVSVGDKDSEELCVGTVDAKPGCWSFLKGGFV-ASKLNLSSIYFK  124



>ref|XP_009628229.1| PREDICTED: uncharacterized protein LOC104118640 isoform X4 [Nicotiana 
tomentosiformis]
Length=519

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  279  CKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
            CK +PE+ LY GGIL  K PE +     +GK V+ P F LQDLT GTIY FS+W++I+NA
Sbjct  5    CKLYPEKPLYGGGILKDKFPEFQGFTVADGKNVHLPVFRLQDLTPGTIYSFSTWIKIKNA  64

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DS+L+TAS+  +  E  CVGTV AK GCWSF+KGGFV  S  NLS +Y +
Sbjct  65   DSSLITASVGDKDSEELCVGTVDAKPGCWSFLKGGFV-ASKLNLSSIYLK  113



>ref|XP_009628227.1| PREDICTED: uncharacterized protein LOC104118640 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  279  CKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
            CK +PE+ LY GGIL  K PE +     +GK V+ P F LQDLT GTIY FS+W++I+NA
Sbjct  31   CKLYPEKPLYGGGILKDKFPEFQGFTVADGKNVHLPVFRLQDLTPGTIYSFSTWIKIKNA  90

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DS+L+TAS+  +  E  CVGTV AK GCWSF+KGGFV  S  NLS +Y +
Sbjct  91   DSSLITASVGDKDSEELCVGTVDAKPGCWSFLKGGFV-ASKLNLSSIYLK  139



>ref|XP_010920164.1| PREDICTED: uncharacterized protein LOC105044067 [Elaeis guineensis]
Length=560

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 89/140 (64%), Gaps = 8/140 (6%)
 Frame = +3

Query  198  FLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG---GKVPESRQVIGLNG  368
            ++FL + + P  ++Y+GP YD  A TECK HPE  LY+GGIL    GK+P +   +    
Sbjct  18   WVFLQWHL-PFGASYDGPPYDYYATTECKTHPEAPLYNGGILADRTGKIPMTYHKM---E  73

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
             GVY+P F+L +LT  T Y FS WV+I+   S LL A L TE     C+GT +A   CWS
Sbjct  74   TGVYSPAFVLYNLTGTTRYSFSCWVQIKGTYSTLLKARLSTESS-TSCIGTALASSDCWS  132

Query  549  FIKGGFVLTSPSNLSLLYFQ  608
            F+KGGFVL SPS  S+LYFQ
Sbjct  133  FLKGGFVLDSPSQTSILYFQ  152



>ref|XP_009628228.1| PREDICTED: uncharacterized protein LOC104118640 isoform X3 [Nicotiana 
tomentosiformis]
Length=541

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  279  CKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
            CK +PE+ LY GGIL  K PE +     +GK V+ P F LQDLT GTIY FS+W++I+NA
Sbjct  27   CKLYPEKPLYGGGILKDKFPEFQGFTVADGKNVHLPVFRLQDLTPGTIYSFSTWIKIKNA  86

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DS+L+TAS+  +  E  CVGTV AK GCWSF+KGGFV  S  NLS +Y +
Sbjct  87   DSSLITASVGDKDSEELCVGTVDAKPGCWSFLKGGFV-ASKLNLSSIYLK  135



>ref|XP_009400614.1| PREDICTED: uncharacterized protein LOC103984779 [Musa acuminata 
subsp. malaccensis]
Length=570

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 6/125 (5%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTA  413
            EGP YD SAYTECK HPE  LY+GG+L    G++P +         GVY P FLL +LT 
Sbjct  43   EGPGYDYSAYTECKYHPEAPLYNGGVLVDRSGRIPVAYHK---TETGVYAPAFLLYNLTE  99

Query  414  GTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLS  593
             T Y FS WV+ +   SAL+ A+L  E    +C+GTV+A+ GCWSF+KGGFVL S S  S
Sbjct  100  TTRYSFSCWVKAKGTGSALVRATLSAEGSTLNCIGTVLARSGCWSFLKGGFVLDSFSRSS  159

Query  594  LLYFQ  608
            +LY Q
Sbjct  160  VLYLQ  164



>ref|XP_002446197.1| hypothetical protein SORBIDRAFT_06g003350 [Sorghum bicolor]
 gb|EES10525.1| hypothetical protein SORBIDRAFT_06g003350 [Sorghum bicolor]
Length=574

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 83/128 (65%), Gaps = 7/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            ++ +G  YD  AYTECK HPE ALY+GG+L    K+ + R       +G Y+P F+L ++
Sbjct  34   ASSDGVRYDYRAYTECKPHPEPALYNGGVLRWASKITDFRT----EDEGNYSPAFVLYNM  89

Query  408  TAGTIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            +A T Y FS WV+I+  DSA + A ++T E     C+GT + +  CWSF+KGGF+L SPS
Sbjct  90   SAATAYSFSCWVKIDGPDSAHVKAKILTLENAASQCIGTAIVRNDCWSFLKGGFILNSPS  149

Query  585  NLSLLYFQ  608
              S+LYFQ
Sbjct  150  QTSVLYFQ  157



>ref|XP_003604034.1| Endo-1,4-beta-xylanase A [Medicago truncatula]
Length=536

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 85/127 (67%), Gaps = 6/127 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTE-CKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPT-FLLQDL  407
            S+  GPLYD +AYT+ CK+HPE+ LY GG+   K   +     +N   +  P+  +L +L
Sbjct  7    SSSNGPLYDFTAYTQVCKEHPEKPLYGGGVFNIKDKGN----AVNNTNINMPSSLVLYNL  62

Query  408  TAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
            T  TIY FS WV++E +DS ++ A L TE    +C+GTV+AK+GCWSF+KGGF+L SPSN
Sbjct  63   TYDTIYSFSVWVKVEYSDSVMIKAKLETENETYNCIGTVLAKRGCWSFLKGGFLLNSPSN  122

Query  588  LSLLYFQ  608
             S ++F 
Sbjct  123  SSTIFFH  129



>ref|XP_010934099.1| PREDICTED: endo-1,4-beta-xylanase-like [Elaeis guineensis]
Length=564

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 81/127 (64%), Gaps = 5/127 (4%)
 Frame = +3

Query  237  TYEGPLYDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            +YEGP YD SAYTECK  PE  LY+GGIL    G++P +         G   PTF+L +L
Sbjct  30   SYEGPWYDFSAYTECKPDPEPPLYNGGILQTENGEIPMA--AYHTTETGAQLPTFVLGNL  87

Query  408  TAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
            T  T Y FS WV+I+  DSAL+ A L T+  +  CVGT +AK GCWSF+KGGF+L + S 
Sbjct  88   TETTRYSFSCWVQIQGTDSALVRAGLATDDSKFRCVGTTMAKNGCWSFLKGGFILDASSK  147

Query  588  LSLLYFQ  608
             S L+ Q
Sbjct  148  TSQLFLQ  154



>ref|XP_009761415.1| PREDICTED: uncharacterized protein LOC104213578 isoform X3 [Nicotiana 
sylvestris]
Length=516

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = +3

Query  279  CKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
            CK +PE+ LY GGIL  K PE +     + K V+ P F LQD+T GTIY FS+W++++NA
Sbjct  2    CKLYPEKPLYGGGILKDKFPEFQGFTAPDEKTVHLPVFRLQDITPGTIYSFSTWIKLKNA  61

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DSAL+T S+  +  E  CVGTV AK GCWSF+KGGFV  S  NLS +YF+
Sbjct  62   DSALITVSVGDKDSEELCVGTVDAKPGCWSFLKGGFV-ASKLNLSSIYFK  110



>emb|CDO96932.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 82/123 (67%), Gaps = 2/123 (2%)
 Frame = +3

Query  246  GPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQ-VIGLNGKGVYTPT-FLLQDLTAGT  419
            GP+YD SAYT CK  PE+ LY+GGI+  +V   R   + L+G    +P  F+  +L   T
Sbjct  50   GPVYDYSAYTACKSAPEDPLYNGGIIKDRVHGRRHHKLSLSGSRDNSPAAFVFYNLPGKT  109

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
             Y FSSW+++E+ADS+ + AS+ T+K    C GTV+AKQ CWSF+KGGFVL S SN + L
Sbjct  110  FYSFSSWLKVEDADSSSIQASVTTDKTTYQCAGTVIAKQDCWSFLKGGFVLDSTSNSTFL  169

Query  600  YFQ  608
            + Q
Sbjct  170  FLQ  172



>gb|EPS72309.1| hypothetical protein M569_02449, partial [Genlisea aurea]
Length=526

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 85/127 (67%), Gaps = 11/127 (9%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTA  413
            S+Y G LYDS+AYTEC+  PEE LY GGIL  + P  +Q   L        +F + +L A
Sbjct  1    SSYGGLLYDSTAYTECQNQPEEPLYGGGILRNRYPNVQQQQKL--------SFPIDNLEA  52

Query  414  GTIYCFSSWVRIENADSALLTASLMTE-KGEP--DCVGTVVAKQGCWSFIKGGFVLTSPS  584
            GT YCFS+WV+I N DS L+ A+++TE +GE    CVGTV+A +GCWSF+KGGFV +S  
Sbjct  53   GTKYCFSAWVKIRNVDSDLIRATIITEDEGETSLQCVGTVIANEGCWSFLKGGFVSSSSY  112

Query  585  NLSLLYF  605
            N S LY 
Sbjct  113  NSSELYL  119



>ref|XP_006851910.1| hypothetical protein AMTR_s00041p00160040 [Amborella trichopoda]
 gb|ERN13377.1| hypothetical protein AMTR_s00041p00160040 [Amborella trichopoda]
Length=547

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 8/122 (7%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTI  422
            +GP YDS+AYTECK +PE  LY+GGIL      +++V    G  VY+P ++L++LT G  
Sbjct  26   DGPRYDSTAYTECKLYPEAPLYNGGIL------AKEVSKHPGTQVYSPAYVLRNLTKGAK  79

Query  423  YCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            Y FS WVRI+ A +A + A L+T+     CVGTV A+ GCWSF+KGGFV T  +  S+L+
Sbjct  80   YTFSCWVRIKGAGTARVMARLLTDNSTDKCVGTVSAQSGCWSFLKGGFVATESN--SVLF  137

Query  603  FQ  608
             Q
Sbjct  138  LQ  139



>ref|XP_003558355.1| PREDICTED: uncharacterized protein LOC100841372 [Brachypodium 
distachyon]
Length=563

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD SAYT+C+  PE ALY+GGIL     +          GV +P F++ +L   T+Y FS
Sbjct  39   YDYSAYTDCRGQPEPALYNGGILKYGNSDDPTGYHTTETGVLSPAFVVYNLNKTTMYTFS  98

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            SWVR+E +DSAL+TA L  +     C+GTV+A+  CWSF+KGGFVL  P+  S+++FQ
Sbjct  99   SWVRLEGSDSALITARLAPDNSGTRCIGTVLARNDCWSFLKGGFVLDWPTQTSVIFFQ  156



>gb|KJB71892.1| hypothetical protein B456_011G146100 [Gossypium raimondii]
Length=226

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  351  VIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVA  530
            + G    G YTP FLL++LT G  YCFS+W++I+ A+SAL+ ASL TE    +C+G V+A
Sbjct  5    IFGETATGFYTPGFLLKNLTVGNFYCFSTWIKIQGANSALIRASLKTEYRTYNCIGIVLA  64

Query  531  KQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            K GCWSF+KGGFVL SPSNL+LL FQ
Sbjct  65   KNGCWSFLKGGFVLDSPSNLALLIFQ  90



>gb|EEC74851.1| hypothetical protein OsI_10717 [Oryza sativa Indica Group]
 gb|EEE58681.1| hypothetical protein OsJ_10107 [Oryza sativa Japonica Group]
Length=717

 Score =   117 bits (294),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD +AYT+C+  PE ALY+GGIL     +          GV++P F++ +L   T+Y FS
Sbjct  193  YDYTAYTDCRGQPEPALYNGGILRFGNSDDPTGYRTTETGVFSPAFVVYNLNKTTMYTFS  252

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            SWV++E A SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL  P+  S+++FQ
Sbjct  253  SWVKLEGASSALITARLALDNAGARCIGTVLARNDCWAFLKGGFVLDWPTQTSVIFFQ  310



>ref|XP_008661494.1| PREDICTED: uncharacterized protein LOC100216852 isoform X1 [Zea 
mays]
 gb|AFW57913.1| hypothetical protein ZEAMMB73_662182 [Zea mays]
Length=575

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 81/128 (63%), Gaps = 7/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            ++ +G  YD  AYTECK HPE ALY+GG+L    K+ + R       +G Y+P F+L ++
Sbjct  37   ASSDGAQYDYRAYTECKPHPEPALYNGGVLRWASKITDFR----TEDEGNYSPAFVLYNM  92

Query  408  TAGTIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            +A T Y FS WV+I+  +SA + A ++T E     CVGT +A+  CWSF+KGGF L S S
Sbjct  93   SAATAYSFSCWVKIDGPESAHVKAKILTVENAASQCVGTAIARNDCWSFLKGGFTLNSTS  152

Query  585  NLSLLYFQ  608
              S+LY Q
Sbjct  153  QTSVLYLQ  160



>ref|NP_001152556.1| hydrolase, hydrolyzing O-glycosyl compounds precursor [Zea mays]
 gb|ACG48190.1| hydrolase, hydrolyzing O-glycosyl compounds [Zea mays]
Length=571

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDLTAG  416
            +G  YD  AYTECK HPE ALY+GG+L    K+ + R       +G Y+P F+L +++A 
Sbjct  36   DGVQYDYRAYTECKPHPEPALYNGGVLRWASKITDFR----TEDEGNYSPAFVLYNMSAA  91

Query  417  TIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLS  593
            T Y FS WV+I+  +SA + A ++T E     CVGT +A+  CWSF+KGGF L S S  S
Sbjct  92   TAYSFSCWVKIDGPESAHVKAKILTVENAASQCVGTAIARNDCWSFLKGGFTLNSTSQTS  151

Query  594  LLYFQ  608
            +LY Q
Sbjct  152  VLYLQ  156



>ref|XP_006649724.1| PREDICTED: uncharacterized protein LOC102701898 [Oryza brachyantha]
Length=558

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 78/118 (66%), Gaps = 0/118 (0%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD +AYT+C+  PE ALY+GG+L     +          GV++P +++ +L   T+Y FS
Sbjct  34   YDYTAYTDCRGQPEPALYNGGVLRFGNSDDPTGYRTTETGVFSPAYVVYNLNKTTMYTFS  93

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            SWV++E A SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL SP+  S+++FQ
Sbjct  94   SWVKLEGASSALITARLAPDNAGARCIGTVLARNDCWAFLKGGFVLDSPTQTSVIFFQ  151



>gb|ABF94920.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=563

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD +AYT+C+  PE ALY+GGIL     +          GV++P F++ +L   T+Y FS
Sbjct  39   YDYTAYTDCRGQPEPALYNGGILRFGNSDDPTGYRTTETGVFSPAFVVYNLNKTTMYTFS  98

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            SWV++E A SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL  P+  S+++FQ
Sbjct  99   SWVKLEGASSALITARLALDNAGARCIGTVLARNDCWAFLKGGFVLDWPTQTSVIFFQ  156



>gb|ABF94921.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=558

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD +AYT+C+  PE ALY+GGIL     +          GV++P F++ +L   T+Y FS
Sbjct  34   YDYTAYTDCRGQPEPALYNGGILRFGNSDDPTGYRTTETGVFSPAFVVYNLNKTTMYTFS  93

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            SWV++E A SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL  P+  S+++FQ
Sbjct  94   SWVKLEGASSALITARLALDNAGARCIGTVLARNDCWAFLKGGFVLDWPTQTSVIFFQ  151



>ref|XP_006652135.1| PREDICTED: uncharacterized protein LOC102708887 [Oryza brachyantha]
Length=577

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 78/125 (62%), Gaps = 7/125 (6%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDLTAG  416
            +G  YD  AYTECK HPE ALY+GGIL    KV + R+       G Y+P F+L +++A 
Sbjct  45   DGVRYDYRAYTECKSHPEPALYNGGILRWANKVTDFRK----EDDGNYSPAFVLYNMSAA  100

Query  417  TIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLS  593
            T+Y FS WV+I+   +A + A ++T       C+GT + +  CWSF+KGGF L S S  S
Sbjct  101  TVYSFSCWVKIDGTSTAHVKAKILTLANAASQCLGTALVRNDCWSFLKGGFTLNSASETS  160

Query  594  LLYFQ  608
            +LYFQ
Sbjct  161  VLYFQ  165



>ref|XP_003581580.1| PREDICTED: uncharacterized protein LOC100828464 [Brachypodium 
distachyon]
Length=569

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 7/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            S+ +G  YD  AYTECK HPE ALY+GGIL    KV   R +     +G Y+P+F+L ++
Sbjct  36   SSSDGSRYDYRAYTECKPHPEPALYNGGILRWAKKVKNFRTL----DEGNYSPSFVLYNM  91

Query  408  TAGTIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            +A T+Y FS WVRIE   +A + A +++ +     C+GT + +  CWSF+KGGF L S S
Sbjct  92   SAATVYSFSCWVRIEGPATAHVKAKILSLDNAASQCLGTAMVRNDCWSFLKGGFSLGSAS  151

Query  585  NLSLLYFQ  608
              S+LYFQ
Sbjct  152  PTSVLYFQ  159



>ref|XP_011088587.1| PREDICTED: uncharacterized protein LOC105169775 isoform X2 [Sesamum 
indicum]
Length=556

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 78/118 (66%), Gaps = 13/118 (11%)
 Frame = +3

Query  276  ECKQHPEEALYSGGILGGKVPESRQVIGLNGKG------VYTPTFLLQDLTAGTIYCFSS  437
            ECK  PE+ LY GGI+        Q +G+  +       V +P F+L +LT  TIYCFSS
Sbjct  38   ECKSAPEDPLYDGGII------KNQSLGVYNRPHPPRFPVNSPAFVLNNLTGNTIYCFSS  91

Query  438  WVRI-ENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            WV+I   A SA++ ASL T+    +C+GTV+AK+GCWSF+KGGFVL SPS  +L+YFQ
Sbjct  92   WVKITAGAASAVIKASLTTDNVTFNCMGTVIAKRGCWSFLKGGFVLNSPSAYALIYFQ  149



>ref|XP_002468186.1| hypothetical protein SORBIDRAFT_01g041310 [Sorghum bicolor]
 gb|EER95184.1| hypothetical protein SORBIDRAFT_01g041310 [Sorghum bicolor]
Length=560

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 87/153 (57%), Gaps = 4/153 (3%)
 Frame = +3

Query  162  MKMKNTAT--LPFFFLFLGYFINPSLSTYEGP--LYDSSAYTECKQHPEEALYSGGILGG  329
            MKM   A   L F  L++       L+    P   YD SAYT+C+  PE ALY+GGIL  
Sbjct  1    MKMHRFALPGLGFLVLWMLLHCGSELAAAVPPDGWYDYSAYTDCRGQPEPALYNGGILKF  60

Query  330  KVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPD  509
               +          GV++P F++ +L   T+Y FS WV++E A SAL+TA L  +     
Sbjct  61   GNSDDSDGYRTTETGVFSPAFVVYNLNKTTMYTFSCWVKLEGAYSALITARLAPDNTGAR  120

Query  510  CVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            C+ TV+A+  CW+F+KGGFVL  P+  S+++FQ
Sbjct  121  CIATVLARSDCWAFVKGGFVLDWPTQTSVIFFQ  153



>ref|NP_001140909.1| uncharacterized protein LOC100272986 precursor [Zea mays]
 gb|ACF84937.1| unknown [Zea mays]
 tpg|DAA44349.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=560

 Score =   111 bits (277),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 78/122 (64%), Gaps = 7/122 (6%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTI  422
            YD SAYT+C+  PE ALY+GGIL     G  P+  +       GV++P F++ +L   T+
Sbjct  35   YDYSAYTDCRGQPEPALYNGGILKFGSSGGDPDGYRT---TETGVFSPAFVVYNLNKTTM  91

Query  423  YCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            Y FS WV++E A SAL+TA L  +     C+ TVVA+  CW+F+KGGFVL  P+  S+++
Sbjct  92   YTFSCWVKLEGAYSALITARLAPDNTGARCIATVVARSDCWAFVKGGFVLDWPTQTSVIF  151

Query  603  FQ  608
            FQ
Sbjct  152  FQ  153



>ref|XP_004969072.1| PREDICTED: uncharacterized protein LOC101763135 [Setaria italica]
Length=568

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            ++ +G  YD  AYTECK +PE ALY+GGIL    K+ + R       +G Y+P F+L ++
Sbjct  32   ASADGVRYDYRAYTECKPNPEPALYNGGILRWASKITDFRT----EDEGNYSPAFVLYNM  87

Query  408  TAGTIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            +A   Y FS WV+IE   +A + A ++T E     C+GT + +  CWSF+KGGF L S S
Sbjct  88   SAAIAYSFSCWVKIEGPATAHVKAKILTLENAASKCIGTALVRNDCWSFLKGGFALNSSS  147

Query  585  NLSLLYFQ  608
              S+LYFQ
Sbjct  148  QTSVLYFQ  155



>gb|EMT25110.1| Endo-1,4-beta-xylanase Z [Aegilops tauschii]
Length=562

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 7/128 (5%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            S+ +G  YD  AYTECK HPE ALY+GGIL    K+ + R       +G Y+P+F+L ++
Sbjct  19   SSADGLRYDYKAYTECKGHPEPALYNGGILRWAKKIKDFRTA----DEGNYSPSFVLYNM  74

Query  408  TAGTIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            +AG  Y FS WV+     +  + A +++ +     C+GT + +  CWSF+KGGF L SPS
Sbjct  75   SAGMAYSFSCWVKFNGPGTIHVKAKILSLDNAGSQCLGTALVRNDCWSFLKGGFTLNSPS  134

Query  585  NLSLLYFQ  608
              S+LYFQ
Sbjct  135  QTSVLYFQ  142



>ref|XP_004985034.1| PREDICTED: uncharacterized protein LOC101776078 [Setaria italica]
Length=560

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 75/118 (64%), Gaps = 0/118 (0%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD ++YT+C+  PE ALY+GGIL     +          GV++P F++ +L   T+Y FS
Sbjct  36   YDYTSYTDCRGQPEPALYNGGILKFGNSDDPDGYRTTETGVFSPAFVVYNLNKTTMYTFS  95

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             WV++E A +AL+TA L  +     C+ TV+A+  CW+F+KGGFVL  P+  S+++FQ
Sbjct  96   CWVKLEGASAALITARLAPDNSGARCIATVLARSDCWAFVKGGFVLDWPTQTSVIFFQ  153



>gb|EMS68876.1| Endo-1,4-beta-xylanase Z [Triticum urartu]
Length=496

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            YD +A+T+C+  PE A Y+GGIL    G  P   +       GV +P F++ +L   T+Y
Sbjct  56   YDYTAHTDCRGRPEPAQYNGGILKYGNGDDPNGYKTTE---TGVLSPAFVVYNLNKSTMY  112

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
             FS WV++E + SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL  P+  S+++F
Sbjct  113  TFSGWVKLEGSPSALITARLAPDNSGTRCIGTVLARSDCWAFLKGGFVLDWPTQTSVIFF  172

Query  606  Q  608
            Q
Sbjct  173  Q  173



>gb|EMT22806.1| Endo-1,4-beta-xylanase Z [Aegilops tauschii]
Length=552

 Score =   105 bits (262),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 76/121 (63%), Gaps = 6/121 (5%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            YD +A+T+C+  PE A Y+GGIL    G  P   +       GV +P F++ +L   T+Y
Sbjct  28   YDYTAHTDCRGRPEPAQYNGGILKYGNGDDPNGYKTTE---TGVLSPAFVVYNLNKSTMY  84

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
             FS WV++E + SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL  P+  S+++F
Sbjct  85   TFSGWVKLEGSPSALITARLAPDNSGTRCIGTVLARSDCWAFLKGGFVLDWPTQTSVIFF  144

Query  606  Q  608
            Q
Sbjct  145  Q  145



>gb|KJB28128.1| hypothetical protein B456_005G028800, partial [Gossypium raimondii]
Length=207

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 66/88 (75%), Gaps = 2/88 (2%)
 Frame = +3

Query  351  VIGLNGKGVYTPTFLLQDLTAG-TIY-CFSSWVRIENADSALLTASLMTEKGEPDCVGTV  524
            + G    G YTP FLL++LT   T++   ++W++I++A+SAL+ ASL TE    +C+GTV
Sbjct  5    IFGETATGFYTPGFLLKNLTDWLTLFGAITAWIKIQSANSALIRASLKTENRTYNCIGTV  64

Query  525  VAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +AK GCWSF+KGGFVL SPSNL+LL FQ
Sbjct  65   LAKNGCWSFLKGGFVLDSPSNLALLLFQ  92



>ref|XP_010436964.1| PREDICTED: uncharacterized protein LOC104720780 isoform X2 [Camelina 
sativa]
Length=508

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = +3

Query  378  YTPTFLLQDLTAGTIYCFSSWVRIE-NADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            YTP ++LQ+LT  TIYCFS WV+IE  A SA + A L T+    +CVG+V AK GCWSF+
Sbjct  22   YTPAYILQNLTQNTIYCFSIWVKIEAGAASARVRARLRTDNTTLNCVGSVSAKHGCWSFL  81

Query  555  KGGFVLTSPSNLSLLYFQ  608
            KGGF+L SPSNLS+L+F+
Sbjct  82   KGGFLLNSPSNLSILFFE  99



>ref|XP_010315368.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315369.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315370.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Solanum 
lycopersicum]
Length=500

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  387  TFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
             F+L +L+  TIY FSSW+RI +ADSA++ ASL T+ G   CVG V+A+ GCWSF+KGGF
Sbjct  20   NFVLNNLSGDTIYSFSSWIRILDADSAVMKASLKTDDGTVKCVGNVIARAGCWSFLKGGF  79

Query  567  VLTSPSNLSLLYFQ  608
            VL  PS+  LLY Q
Sbjct  80   VLDLPSSYGLLYLQ  93



>ref|XP_006359674.1| PREDICTED: probable endo-1,4-beta-xylanase C-like isoform X1 
[Solanum tuberosum]
 ref|XP_006359675.1| PREDICTED: probable endo-1,4-beta-xylanase C-like isoform X2 
[Solanum tuberosum]
Length=500

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  387  TFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
             F+L +L+  TIY FSSWVRI +ADSA++ ASL T  G   CVG V+A+ GCWSF+KGGF
Sbjct  20   NFVLNNLSGDTIYSFSSWVRILDADSAVIKASLKTANGTVKCVGNVIARPGCWSFLKGGF  79

Query  567  VLTSPSNLSLLYFQ  608
            VL  PS+ +LLY Q
Sbjct  80   VLDFPSSYALLYLQ  93



>ref|XP_011001985.1| PREDICTED: endo-1,4-beta-xylanase F1-like isoform X3 [Populus 
euphratica]
Length=472

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +3

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEP-DCVGTVVAKQGCWSFIKGGFVLTSPSNLSL  596
            +YCFS WV+I+ ADS L+TASLMT      DCVGTV+AK GCWSF+KGGF+L SPS++S+
Sbjct  1    MYCFSIWVKIQGADSTLVTASLMTNNNSTNDCVGTVLAKSGCWSFLKGGFILDSPSSVSI  60

Query  597  LYFQ  608
            LYFQ
Sbjct  61   LYFQ  64



>gb|KEH36384.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=484

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +3

Query  387  TFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
            + +L +LT  TIY FS WV++E +DS ++ A L TE    +C+GTV+AK+GCWSF+KGGF
Sbjct  4    SLVLYNLTYDTIYSFSVWVKVEYSDSVMIKAKLETENETYNCIGTVLAKRGCWSFLKGGF  63

Query  567  VLTSPSNLSLLYFQ  608
            +L SPSN S ++F 
Sbjct  64   LLNSPSNSSTIFFH  77



>gb|KJB74235.1| hypothetical protein B456_011G281800 [Gossypium raimondii]
Length=166

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
              ++W++I+ A+SAL+ ASL TE    +C+GTV+AK GCWSF+KGGFVL SPSNL+LL F
Sbjct  18   AITAWIKIQGANSALIRASLKTENRTYNCIGTVLAKNGCWSFLKGGFVLDSPSNLALLLF  77

Query  606  Q  608
            Q
Sbjct  78   Q  78



>gb|KJB74236.1| hypothetical protein B456_011G281800 [Gossypium raimondii]
Length=175

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  432  SSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            ++W++I+ A+SAL+ ASL TE    +C+GTV+AK GCWSF+KGGFVL SPSNL+LL FQ
Sbjct  20   TAWIKIQGANSALIRASLKTENRTYNCIGTVLAKNGCWSFLKGGFVLDSPSNLALLLFQ  78



>ref|XP_010327543.1| PREDICTED: endo-1,4-beta-xylanase A-like [Solanum lycopersicum]
Length=488

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  375  VYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            V +PT  L++L+ G+IY FSSWVR++N DSAL+TA++  +     C+G+V AK+GCWSF+
Sbjct  2    VDSPTLSLENLSQGSIYSFSSWVRVKNVDSALVTATVKPDNKYAKCIGSVKAKKGCWSFL  61

Query  555  KGGFVLTSPSNLSLLYFQ  608
            KGGF+  S    S + FQ
Sbjct  62   KGGFLWDSTFTSSEIDFQ  79



>ref|XP_002534153.1| Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
 gb|EEF28229.1| Endo-1,4-beta-xylanase A precursor, putative [Ricinus communis]
Length=473

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
            C + WVRI+ A+S L+TASL T+    +CVGTV A   CWSF+KGGF+L +PSNLS+LYF
Sbjct  6    CKTVWVRIQGAESGLVTASLTTDNERNNCVGTVFANTECWSFLKGGFILDAPSNLSILYF  65

Query  606  Q  608
            +
Sbjct  66   K  66



>ref|XP_011457934.1| PREDICTED: uncharacterized protein LOC101305915 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=541

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +3

Query  438  WVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            WV++ +A SA++ ASL  E     C+GTV+AK+GCWSF+KGGFVL SPSNLS+L+FQ
Sbjct  77   WVKLRSAGSAMIQASLKAEDETYSCIGTVLAKRGCWSFLKGGFVLDSPSNLSILFFQ  133



>gb|ABF94922.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=470

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = +3

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            +Y FSSWV++E A SAL+TA L  +     C+GTV+A+  CW+F+KGGFVL  P+  S++
Sbjct  1    MYTFSSWVKLEGASSALITARLALDNAGARCIGTVLARNDCWAFLKGGFVLDWPTQTSVI  60

Query  600  YFQ  608
            +FQ
Sbjct  61   FFQ  63



>tpg|DAA44351.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=95

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            +Y FS WV++E A SAL+TA L  +     C+ TVVA+  CW+F+KGGFVL  P+  S++
Sbjct  1    MYTFSCWVKLEGAYSALITARLAPDNTGARCIATVVARSDCWAFVKGGFVLDWPTQTSVI  60

Query  600  YFQ  608
            +FQ
Sbjct  61   FFQ  63



>gb|EMS66498.1| Endo-1,4-beta-xylanase Z [Triticum urartu]
Length=552

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 64/115 (56%), Gaps = 7/115 (6%)
 Frame = +3

Query  219  INPSLSTYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTF  392
            +N +L   +G  YD  AYTECK HPE ALY+GGIL    K+ + R       +G Y+P+F
Sbjct  40   LNFALRAADGVRYDYKAYTECKGHPEPALYNGGILRWAKKIKDFRTA----DEGNYSPSF  95

Query  393  LLQDLTAGTIYCFSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFI  554
            +L +++AG  Y FS WV+     +  + A +M+ +     C+GT +A     S +
Sbjct  96   VLYNMSAGMAYSFSCWVKFNGPGTIHVKAKIMSLDNAGSQCLGTALAATANASMV  150



>tpg|DAA44350.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=470

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            +Y FS WV++E A SAL+TA L  +     C+ TVVA+  CW+F+KGGFVL  P+  S++
Sbjct  1    MYTFSCWVKLEGAYSALITARLAPDNTGARCIATVVARSDCWAFVKGGFVLDWPTQTSVI  60

Query  600  YFQ  608
            +FQ
Sbjct  61   FFQ  63



>ref|XP_011088588.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X3 [Sesamum 
indicum]
Length=500

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +3

Query  438  WVRI-ENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            WV+I   A SA++ ASL T+    +C+GTV+AK+GCWSF+KGGFVL SPS  +L+YFQ
Sbjct  36   WVKITAGAASAVIKASLTTDNVTFNCMGTVIAKRGCWSFLKGGFVLNSPSAYALIYFQ  93



>ref|XP_010690393.1| PREDICTED: probable endo-1,4-beta-xylanase C isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=462

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  447  IENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            IE   S L+ ASL TE     C+G+V+AKQGCWSF+KGGFVL  PS+ S+LYFQ
Sbjct  2    IEGVGSTLVRASLRTEHATFSCIGSVIAKQGCWSFLKGGFVLDLPSDNSILYFQ  55



>ref|XP_006367794.1| PREDICTED: uncharacterized protein LOC102602944 [Solanum tuberosum]
Length=541

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = +3

Query  432  SSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            S WVR++N +SAL+TA++  +     C+G+V+AK+GCWSF+KGGF+  S SN S L FQ
Sbjct  74   SGWVRVKNVNSALVTATVKPDNKYAKCIGSVIAKKGCWSFLKGGFLWDSTSNSSELDFQ  132



>ref|XP_009622124.1| PREDICTED: LOW QUALITY PROTEIN: probable endo-1,4-beta-xylanase 
C [Nicotiana tomentosiformis]
Length=399

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 2/65 (3%)
 Frame = +3

Query  414  GTIYCFSSW--VRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSN  587
            G IY  S++  V+I +ADSA++ ASL T+ G   CVG V+A+ GCWSF+KGGFVL  PS+
Sbjct  25   GPIYDHSAYTEVQILDADSAVIKASLKTDNGTVKCVGNVIARPGCWSFLKGGFVLDFPSS  84

Query  588  LSLLY  602
             +L++
Sbjct  85   YALVF  89



>ref|XP_002980942.1| hypothetical protein SELMODRAFT_420481 [Selaginella moellendorffii]
 gb|EFJ18127.1| hypothetical protein SELMODRAFT_420481 [Selaginella moellendorffii]
Length=586

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 70/142 (49%), Gaps = 24/142 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESR--------------QVIGLN--------G  368
            YD +A++EC   P   LY+GG+L     ++               QV G N         
Sbjct  55   YDQTAFSECLAAPTSPLYNGGVLKNPAFDADLLGWSPFGGCTLKIQVQGRNKFLVATNRN  114

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIE--NADSALLTASLMTEKGEPDCVGTVVAKQGC  542
             G + P+  L +LT G+ Y  S+W+++   + D+A L  + +   G+    G+V A+  C
Sbjct  115  AGFHGPSQALANLTQGSKYTLSAWLQVNGGSDDTAPLVKATIKANGQYISAGSVAARNKC  174

Query  543  WSFIKGGFVLTSPSNLSLLYFQ  608
            W+F+KGGF+    ++ + LYF+
Sbjct  175  WTFLKGGFIPEFNASSATLYFE  196



>gb|KJB15754.1| hypothetical protein B456_002G1956001, partial [Gossypium raimondii]
Length=251

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +3

Query  246  GPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVI-GLNGKGVYTPTFLLQDLT  410
            GPLYD +AYTECK  PEE LY GGIL  + P  R  I G    G YTP FLL++LT
Sbjct  50   GPLYDFTAYTECKAQPEEPLYQGGILKDEPPIMRPAIFGKTATGFYTPAFLLKNLT  105



>gb|KJB32237.1| hypothetical protein B456_005G231100 [Gossypium raimondii]
Length=582

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 11/112 (10%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG------GKVPESRQVIGLNGKGVYTPTFLLQ--DLT  410
            YD SA  EC   P+ A Y GG++G      G    S   +G++  G++  T  L+   L 
Sbjct  27   YDYSATMECLAAPKRAQYGGGMIGFNQRTNGSTLSSE--LGVSNDGLHNTTLSLKTVKLE  84

Query  411  AGTIYCFSSWVRIEN-ADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGG  563
             G +Y FS+WV+I N ++S  +  +     GE    G  +AKQGCWS +KGG
Sbjct  85   KGNLYTFSAWVQISNGSESETVAVAFKASNGELVHGGETMAKQGCWSLLKGG  136



>gb|KJB32236.1| hypothetical protein B456_005G231100 [Gossypium raimondii]
Length=560

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 11/112 (10%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG------GKVPESRQVIGLNGKGVYTPTFLLQ--DLT  410
            YD SA  EC   P+ A Y GG++G      G    S   +G++  G++  T  L+   L 
Sbjct  27   YDYSATMECLAAPKRAQYGGGMIGFNQRTNGSTLSSE--LGVSNDGLHNTTLSLKTVKLE  84

Query  411  AGTIYCFSSWVRIEN-ADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGG  563
             G +Y FS+WV+I N ++S  +  +     GE    G  +AKQGCWS +KGG
Sbjct  85   KGNLYTFSAWVQISNGSESETVAVAFKASNGELVHGGETMAKQGCWSLLKGG  136



>ref|XP_004169732.1| PREDICTED: endo-1,4-beta-xylanase Z-like, partial [Cucumis sativus]
Length=575

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 71/163 (44%), Gaps = 32/163 (20%)
 Frame = +3

Query  186  LPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGIL--------------  323
            LPF  +F+G+  N          YD SA  EC  +PE A Y GGI+              
Sbjct  4    LPFLSIFVGFGTN-------ALTYDYSANIECLVNPESAQYKGGIIENPEMKDGLKGWFP  56

Query  324  -GGKVPESRQ-------VIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTA  479
             G    E R+       ++  +    Y        L +  IY FS+WV++ N   A + A
Sbjct  57   FGSAKIEHREESNGNVFIVAHSRNHSYDTFSQTLHLHSNIIYTFSAWVQV-NEGKADVAA  115

Query  480  SLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             + T +G  + V   VA+  CWSF KGG  +T P  +  LYF+
Sbjct  116  VIKTRRGY-EHVAVTVAQSNCWSFFKGGLTVTEPGPVE-LYFE  156



>ref|XP_011001986.1| PREDICTED: endo-1,4-beta-xylanase F1-like isoform X4 [Populus 
euphratica]
Length=450

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  507  DCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            DCVGTV+AK GCWSF+KGGF+L SPS++S+LYFQ
Sbjct  9    DCVGTVLAKSGCWSFLKGGFILDSPSSVSILYFQ  42



>ref|NP_001055146.1| Os05g0305000 [Oryza sativa Japonica Group]
 dbj|BAF17060.1| Os05g0305000 [Oryza sativa Japonica Group]
 gb|EAY97457.1| hypothetical protein OsI_19386 [Oryza sativa Indica Group]
 gb|EEE63173.1| hypothetical protein OsJ_17982 [Oryza sativa Japonica Group]
Length=128

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 7/73 (10%)
 Frame = +3

Query  222  NPSLSTYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFL  395
             P+ S+ +G  YD  AYTECK HPE ALY+GGIL    KV + R        G Y+P F+
Sbjct  41   RPAASS-DGVRYDYRAYTECKSHPEPALYNGGILRWANKVTDFR----TEDDGNYSPAFV  95

Query  396  LQDLTAGTIYCFS  434
            L +++A T+Y FS
Sbjct  96   LYNMSAATVYSFS  108



>gb|KEH36385.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=454

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +3

Query  468  LLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            ++ A L TE    +C+GTV+AK+GCWSF+KGGF+L SPSN S ++F 
Sbjct  1    MIKAKLETENETYNCIGTVLAKRGCWSFLKGGFLLNSPSNSSTIFFH  47



>emb|CDY49599.1| BnaAnng10280D [Brassica napus]
Length=354

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 72/150 (48%), Gaps = 14/150 (9%)
 Frame = +3

Query  162  MKMKNTATLPFF-FLFLGYFINPSLSTYEGPL-YDSSAYTECKQHPEEALYSG-GILGGK  332
            MK  N     F  F+ +  F+ P LS +  P  YD S  +EC     + + +G G    K
Sbjct  1    MKRFNNGVFHFVVFISILLFLGPGLSMH--PFSYDHSLKSECLMELPQTINTGEGFQELK  58

Query  333  VPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDC  512
            + E+    G NGK V        +L  G IY  S+WV++ N     +  +L  +      
Sbjct  59   IKEN----GENGKVVERV-----NLQKGGIYSISAWVKLRNEKERAVRITLRGKNVRYVD  109

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
             G V+AK+GCWS +KGGF++   + + +L+
Sbjct  110  GGQVIAKKGCWSLLKGGFIVNVSAPVDILF  139



>ref|XP_010673245.1| PREDICTED: uncharacterized protein LOC104889668 [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 67/151 (44%), Gaps = 27/151 (18%)
 Frame = +3

Query  189  PFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGIL---------------  323
            PFF LFL      +  T +   YD SA TEC +   +A Y GGI+               
Sbjct  10   PFFLLFLA----NAGDTIQALTYDYSATTECLKDAWKAQYGGGIIQNPEFDNGIERWTNF  65

Query  324  -GGKVPE------SRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTAS  482
              G + E      ++ ++ +N             L  G +Y FS+W++I    S ++   
Sbjct  66   GHGNIKERITSNGNKYIVAINRTQPSDGLSQRVQLIKGKLYAFSAWIQISEG-SEIIAVK  124

Query  483  LMTEKGEPDCVGTVVAKQGCWSFIKGGFVLT  575
              +  G+    GTV+A+QGCWS +KGG V T
Sbjct  125  FRSPTGKFLHGGTVIAEQGCWSMLKGGIVAT  155



>gb|KCW63584.1| hypothetical protein EUGRSUZ_G01206 [Eucalyptus grandis]
Length=582

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 62/138 (45%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------------GGKVPES------RQVIGLNG  368
            YD+SA T+C   P   +Y GG++                 G + ES      R ++  N 
Sbjct  32   YDASATTQCLAQPGSTMYGGGVIVNPEFSNGTAGWAMFGKGVIEESISLSKNRFMVARNR  91

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            K           L  G  Y FS+W+++ N  S  ++       GE    G++VA+QGCWS
Sbjct  92   KRPMDSVSQKVQLEKGKFYAFSAWIQV-NEGSETVSVVFGVGDGEFVPGGSIVAEQGCWS  150

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG  + S S + +L+
Sbjct  151  LLKGGVAVNSSSTVDVLF  168



>ref|XP_008455522.1| PREDICTED: uncharacterized protein LOC103495673 [Cucumis melo]
Length=582

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 62/140 (44%), Gaps = 25/140 (18%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------LGGKVP------ESRQ-------VIGLNG  368
            YD SA TEC   PE A Y GGI         L G  P      E R+       ++    
Sbjct  27   YDYSANTECLVKPESAQYKGGIIENPELNDGLKGWFPFGSAKIEHREESNGNVFIVAHTR  86

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               Y        L +  IY FS+WV++ N   A + A + T++G  + V    A+  CWS
Sbjct  87   NHSYDTLSQTLHLHSNIIYTFSAWVQV-NEGKADVAAVIKTKRGY-EHVAATTAQSNCWS  144

Query  549  FIKGGFVLTSPSNLSLLYFQ  608
            F KGG  +T P  +  LYF+
Sbjct  145  FFKGGLTVTEPGPVE-LYFE  163



>gb|EEE63172.1| hypothetical protein OsJ_17981 [Oryza sativa Japonica Group]
Length=526

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  429  FSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
             SSWV+I+   +A + A ++T       C+GT + +  CWSF+KGGF L S S  S+LYF
Sbjct  54   LSSWVKIDGPTTAHVKAKILTLANAASQCLGTALVRNDCWSFLKGGFTLNSASETSVLYF  113

Query  606  Q  608
            Q
Sbjct  114  Q  114



>gb|KHG30568.1| Endo-1,4-beta-xylanase A [Gossypium arboreum]
Length=545

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 11/116 (9%)
 Frame = +3

Query  249  PLYDSSAYTECKQHPEEALYSGGILG------GKVPESRQVIGLNGKGVYTPTFLLQ--D  404
            P+     + +C   P+ A Y GG++G      G    S   +G++  G++     L+   
Sbjct  7    PMTILQQWRQCLATPKRAQYGGGMIGFNQRTNGSTLSSE--LGVSNDGLHNTILSLRTIK  64

Query  405  LTAGTIYCFSSWVRIEN-ADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
            L  G +Y FS+WV+I N ++S  +  +     GE    G  +AKQGCWS +KGG V
Sbjct  65   LEKGNLYTFSAWVQISNGSESETVAVAFKASNGELVHGGETMAKQGCWSLLKGGIV  120



>gb|EEC78941.1| hypothetical protein OsI_19385 [Oryza sativa Indica Group]
Length=526

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  429  FSSWVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYF  605
             SSWV+I+   +A + A ++T       C+GT + +  CWSF+KGGF L S S  S+LYF
Sbjct  54   LSSWVKIDGPTTAHVKAKILTLANAASQCLGTALVRNDCWSFLKGGFTLNSASETSVLYF  113

Query  606  Q  608
            Q
Sbjct  114  Q  114



>ref|XP_002989316.1| hypothetical protein SELMODRAFT_129690, partial [Selaginella 
moellendorffii]
 gb|EFJ09590.1| hypothetical protein SELMODRAFT_129690, partial [Selaginella 
moellendorffii]
Length=554

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 66/139 (47%), Gaps = 24/139 (17%)
 Frame = +3

Query  264  SAYTECKQHPEEALYSGGILGGKVPESR--------------QVIGLN--------GKGV  377
            S  T+C   P   LY+GG+L     ++               QV G N          G 
Sbjct  8    SVPTQCLAAPTSPLYNGGVLKNPAFDADLLGWSPFGGCTLKIQVQGRNKFLVATNRNAGF  67

Query  378  YTPTFLLQDLTAGTIYCFSSWVRIE--NADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
            + P+  L +LT G+ Y  S+W+++   + D+A L  + +   G+    G+V A+  CW+F
Sbjct  68   HGPSQALANLTQGSKYTLSAWLQVNGGSDDTAPLVKATIKANGQYISAGSVAARNKCWTF  127

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGGF+    ++ + LYF+
Sbjct  128  LKGGFIPEFNASSATLYFE  146



>ref|XP_004137084.1| PREDICTED: endo-1,4-beta-xylanase Z-like [Cucumis sativus]
Length=582

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 63/140 (45%), Gaps = 25/140 (18%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------LGGKVP------ESRQ-------VIGLNG  368
            YD SA  EC  +PE A Y GGI         L G  P      E R+       ++  + 
Sbjct  27   YDYSANIECLVNPESAQYMGGIIENPEMKDGLKGWFPFGSAKIEHREESNGNVFIVAHSR  86

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               Y        L +  IY FS+WV++ N   A + A + T +G  + V   VA+  CWS
Sbjct  87   NHSYDTFSQTLHLHSNIIYTFSAWVQV-NEGKADVAAVIKTRRGY-EHVAVTVAQSNCWS  144

Query  549  FIKGGFVLTSPSNLSLLYFQ  608
            F KGG  +T P  +  LYF+
Sbjct  145  FFKGGLTVTEPGPVE-LYFE  163



>gb|KFK30010.1| hypothetical protein AALP_AA7G206100 [Arabis alpina]
Length=596

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 3/108 (3%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            Y  S  TEC   P ++  + G+L        +S Q   ++  GV         L  G IY
Sbjct  31   YSHSLKTECVMKPPQSTETQGLLLLNRSVEDDSDQEWEIDANGVIREMSQKIQLLQGNIY  90

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
             FS+WV++   +   +     TE G     G V AKQGCWS +KGG V
Sbjct  91   SFSAWVKLREGNDKKVGVMFKTENGRLVHGGEVRAKQGCWSLLKGGIV  138



>gb|KGN43847.1| hypothetical protein Csa_7G071360 [Cucumis sativus]
Length=584

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 63/140 (45%), Gaps = 25/140 (18%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------LGGKVP------ESRQ-------VIGLNG  368
            YD SA  EC  +PE A Y GGI         L G  P      E R+       ++  + 
Sbjct  29   YDYSANIECLVNPESAQYMGGIIENPEMKDGLKGWFPFGSAKIEHREESNGNVFIVAHSR  88

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               Y        L +  IY FS+WV++ N   A + A + T +G  + V   VA+  CWS
Sbjct  89   NHSYDTFSQTLHLHSNIIYTFSAWVQV-NEGKADVAAVIKTRRGY-EHVAVTVAQSNCWS  146

Query  549  FIKGGFVLTSPSNLSLLYFQ  608
            F KGG  +T P  +  LYF+
Sbjct  147  FFKGGLTVTEPGPVE-LYFE  165



>ref|XP_010065886.1| PREDICTED: uncharacterized protein LOC104453078 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010065887.1| PREDICTED: uncharacterized protein LOC104453078 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63589.1| hypothetical protein EUGRSUZ_G01214 [Eucalyptus grandis]
Length=582

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 60/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL--------------------GGKVPESRQ--VIGLNG  368
            YD+ A T+C   P   +Y GG++                     G+V  S+   ++  N 
Sbjct  32   YDALATTQCLAEPGRTMYGGGVIVNPEFSNGTAGWAVFGKGVIEGRVSHSKNRFMVARNR  91

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            K           L  G  Y FS+W+++ N  S  ++       GE    G++VA+QGCWS
Sbjct  92   KRPMDSVSQKVRLEKGKFYAFSAWIQV-NEGSETVSVVFRVGDGEFAPGGSIVAEQGCWS  150

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S + +L+
Sbjct  151  LLKGGVAANSSSTVDVLF  168



>gb|ACN26473.1| unknown [Zea mays]
Length=535

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 6/70 (9%)
 Frame = +3

Query  234  STYEGPLYDSSAYTECKQHPEEALYSGGIL--GGKVPESRQVIGLNGKGVYTPTFLLQDL  407
            ++ +G  YD  AYTECK HPE ALY+GG+L    K+ + R       +G Y+P F+L ++
Sbjct  37   ASSDGAQYDYRAYTECKPHPEPALYNGGVLRWASKITDFR----TEDEGNYSPAFVLYNM  92

Query  408  TAGTIYCFSS  437
            +A T Y FSS
Sbjct  93   SAATAYSFSS  102



>ref|XP_004230568.2| PREDICTED: uncharacterized protein LOC101251335 isoform X2 [Solanum 
lycopersicum]
Length=596

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 77/174 (44%), Gaps = 27/174 (16%)
 Frame = +3

Query  150  SFCSMKMKNTATLPFFFLFL-GYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG  326
            SF    + N   + F  LFL GY ++ +   Y     D SA  EC + P +  Y GG++ 
Sbjct  20   SFYMTTLGNNGFILFCSLFLAGYLVHGATKPY-----DHSATIECHKQPFDPQYGGGLIA  74

Query  327  --------------GKVP-ESRQVIGLNGKGVY---TPTFLLQ--DLTAGTIYCFSSWVR  446
                          G V  E+R+  G      Y   TP  + Q   L  G  Y FS+WV+
Sbjct  75   NPGFDKGTEAWKMDGHVKIEARESGGNKFIVAYNRTTPYSVSQSFHLKKGLYYAFSAWVQ  134

Query  447  IENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +      ++     + +     VG+V+AK GCWS IKGG  +   ++ S L+FQ
Sbjct  135  LSEGSDTVVAMIYNSAQKTVITVGSVIAKSGCWSMIKGGLTVDHNAH-SELHFQ  187



>ref|XP_010315117.1| PREDICTED: uncharacterized protein LOC101251335 isoform X3 [Solanum 
lycopersicum]
Length=593

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 77/174 (44%), Gaps = 27/174 (16%)
 Frame = +3

Query  150  SFCSMKMKNTATLPFFFLFL-GYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG  326
            SF    + N   + F  LFL GY ++ +   Y     D SA  EC + P +  Y GG++ 
Sbjct  17   SFYMTTLGNNGFILFCSLFLAGYLVHGATKPY-----DHSATIECHKQPFDPQYGGGLIA  71

Query  327  --------------GKVP-ESRQVIGLNGKGVY---TPTFLLQ--DLTAGTIYCFSSWVR  446
                          G V  E+R+  G      Y   TP  + Q   L  G  Y FS+WV+
Sbjct  72   NPGFDKGTEAWKMDGHVKIEARESGGNKFIVAYNRTTPYSVSQSFHLKKGLYYAFSAWVQ  131

Query  447  IENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +      ++     + +     VG+V+AK GCWS IKGG  +   ++ S L+FQ
Sbjct  132  LSEGSDTVVAMIYNSAQKTVITVGSVIAKSGCWSMIKGGLTVDHNAH-SELHFQ  184



>ref|XP_010065888.1| PREDICTED: uncharacterized protein LOC104453078 isoform X2 [Eucalyptus 
grandis]
Length=579

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL--------------------GGKVPES--RQVIGLNG  368
            YD+ A T+C   P   +Y GG++                     G+V  S  R ++  N 
Sbjct  29   YDALATTQCLAEPGRTMYGGGVIVNPEFSNGTAGWAVFGKGVIEGRVSHSKNRFMVARNR  88

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            K           L  G  Y FS+W+++ N  S  ++       GE    G++VA+QGCWS
Sbjct  89   KRPMDSVSQKVRLEKGKFYAFSAWIQV-NEGSETVSVVFRVGDGEFAPGGSIVAEQGCWS  147

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S + +L+
Sbjct  148  LLKGGVAANSSSTVDVLF  165



>ref|XP_010547943.1| PREDICTED: uncharacterized protein LOC104819528 isoform X1 [Tarenaya 
hassleriana]
Length=571

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 53/118 (45%), Gaps = 2/118 (2%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGG--ILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYC  428
            YD  +  EC   P ++  + G  IL   V +      L+G G  +       +  G IY 
Sbjct  34   YDRYSEKECVTEPPKSSSNIGGLILNRDVEDDAGNRKLHGNGAISEIVHRVHVHQGHIYT  93

Query  429  FSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            FS+WVR    +S  + AS  TE G     G V A + CWS +KGG V      + LL+
Sbjct  94   FSAWVRTGKGESTRVEASFRTEDGGLIHGGEVAAGKACWSLLKGGIVANFSGPVDLLF  151



>ref|XP_010315121.1| PREDICTED: uncharacterized protein LOC101251335 isoform X5 [Solanum 
lycopersicum]
Length=574

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 23/159 (14%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG--------------GK  332
            F LF   F+   L       YD SA  EC + P +  Y GG++               G 
Sbjct  9    FILFCSLFLAGYLVHGATKPYDHSATIECHKQPFDPQYGGGLIANPGFDKGTEAWKMDGH  68

Query  333  VP-ESRQ------VIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMT  491
            V  E+R+      ++  N    Y+ +     L  G  Y FS+WV++      ++     +
Sbjct  69   VKIEARESGGNKFIVAYNRTTPYSVSQSFH-LKKGLYYAFSAWVQLSEGSDTVVAMIYNS  127

Query  492  EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             +     VG+V+AK GCWS IKGG  +   ++ S L+FQ
Sbjct  128  AQKTVITVGSVIAKSGCWSMIKGGLTVDHNAH-SELHFQ  165



>ref|XP_010315116.1| PREDICTED: uncharacterized protein LOC101251335 isoform X1 [Solanum 
lycopersicum]
Length=614

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 70/157 (45%), Gaps = 26/157 (17%)
 Frame = +3

Query  198  FLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG--------------GKV  335
            F  LGY ++ +   Y     D SA  EC + P +  Y GG++               G V
Sbjct  55   FTSLGYLVHGATKPY-----DHSATIECHKQPFDPQYGGGLIANPGFDKGTEAWKMDGHV  109

Query  336  P-ESRQVIGLNGKGVY---TPTFLLQ--DLTAGTIYCFSSWVRIENADSALLTASLMTEK  497
              E+R+  G      Y   TP  + Q   L  G  Y FS+WV++      ++     + +
Sbjct  110  KIEARESGGNKFIVAYNRTTPYSVSQSFHLKKGLYYAFSAWVQLSEGSDTVVAMIYNSAQ  169

Query  498  GEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
                 VG+V+AK GCWS IKGG  +   ++ S L+FQ
Sbjct  170  KTVITVGSVIAKSGCWSMIKGGLTVDHNAH-SELHFQ  205



>ref|XP_010315118.1| PREDICTED: uncharacterized protein LOC101251335 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010315119.1| PREDICTED: uncharacterized protein LOC101251335 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010315120.1| PREDICTED: uncharacterized protein LOC101251335 isoform X4 [Solanum 
lycopersicum]
Length=592

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 70/157 (45%), Gaps = 26/157 (17%)
 Frame = +3

Query  198  FLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG--------------GKV  335
            F  LGY ++ +   Y     D SA  EC + P +  Y GG++               G V
Sbjct  33   FTSLGYLVHGATKPY-----DHSATIECHKQPFDPQYGGGLIANPGFDKGTEAWKMDGHV  87

Query  336  P-ESRQVIGLNGKGVY---TPTFLLQ--DLTAGTIYCFSSWVRIENADSALLTASLMTEK  497
              E+R+  G      Y   TP  + Q   L  G  Y FS+WV++      ++     + +
Sbjct  88   KIEARESGGNKFIVAYNRTTPYSVSQSFHLKKGLYYAFSAWVQLSEGSDTVVAMIYNSAQ  147

Query  498  GEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
                 VG+V+AK GCWS IKGG  +   ++ S L+FQ
Sbjct  148  KTVITVGSVIAKSGCWSMIKGGLTVDHNAH-SELHFQ  183



>ref|XP_004987121.1| PREDICTED: uncharacterized protein LOC101757850 [Setaria italica]
Length=549

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 12/124 (10%)
 Frame = +3

Query  204  FLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG-GKVPESRQVIGLNGKGVY  380
            F G+ +  S S+ + P YD SA  EC + PE+ LY GGI+     P S       GK + 
Sbjct  17   FEGFLVT-SKSSVKVP-YDYSANIECIKEPEKPLYGGGIISDASYPSS-----AGGKKLP  69

Query  381  TPT---FLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             PT    L  DL     Y  S+W+++    +  +TA ++T  G+    G + A+ GCW+ 
Sbjct  70   CPTKGSVLKVDLKKDHHYALSAWLKLSKG-TGDITAVIVTPDGKFVTAGAIAAQSGCWTL  128

Query  552  IKGG  563
            +KGG
Sbjct  129  LKGG  132



>emb|CDY28323.1| BnaC03g66360D [Brassica napus]
Length=557

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 61/123 (50%), Gaps = 8/123 (7%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI-----LGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGT  419
            YD SA  EC ++P +  Y+GGI     L  +   ++ VI       Y        L  G 
Sbjct  25   YDYSATIECLENPNKPQYNGGIIVNPDLQNEFGGNKFVIARGRNQSYDSVSQKVYLEKGL  84

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            +Y FS+W+++   +S +   ++  + GE    G+V+A+  CWS +KGG  +   S  + L
Sbjct  85   LYTFSAWLQVSQGNSPV--RAVFKKNGEYKHAGSVIAESKCWSMLKGGLTVDE-SGPADL  141

Query  600  YFQ  608
            YF+
Sbjct  142  YFE  144



>ref|XP_011013779.1| PREDICTED: uncharacterized protein LOC105117724 isoform X1 [Populus 
euphratica]
Length=578

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 60/148 (41%), Gaps = 23/148 (16%)
 Frame = +3

Query  225  PSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG----------------GKVPE-----  341
            PS        YD SA TEC   P+ A Y GGI+                 G + E     
Sbjct  19   PSACRIHAFSYDYSATTECLIEPQRAQYEGGIIANPDFTHGVQGWTVFGQGAIKEGISKN  78

Query  342  -SRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVG  518
             +R ++  +          +  L  G +Y FS+WV+I N     +       +GE    G
Sbjct  79   GNRYIVAHSRSQPLDSISQMVQLEKGKLYSFSAWVQI-NGGRGNVAVVFKMSRGELVRGG  137

Query  519  TVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
             V+A  GCWS +KGG    + S + +L+
Sbjct  138  EVLATNGCWSLLKGGVFANTSSRVEILF  165



>ref|NP_001055145.1| Os05g0304900 [Oryza sativa Japonica Group]
 dbj|BAF17059.1| Os05g0304900 [Oryza sativa Japonica Group]
Length=480

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 1/58 (2%)
 Frame = +3

Query  438  WVRIENADSALLTASLMT-EKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            WV+I+   +A + A ++T       C+GT + +  CWSF+KGGF L S S  S+LYFQ
Sbjct  11   WVKIDGPTTAHVKAKILTLANAASQCLGTALVRNDCWSFLKGGFTLNSASETSVLYFQ  68



>ref|XP_011013781.1| PREDICTED: uncharacterized protein LOC105117724 isoform X2 [Populus 
euphratica]
Length=563

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG----------------GKVPE------SRQVIGLNG  368
            YD SA TEC   P+ A Y GGI+                 G + E      +R ++  + 
Sbjct  14   YDYSATTECLIEPQRAQYEGGIIANPDFTHGVQGWTVFGQGAIKEGISKNGNRYIVAHSR  73

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
                     +  L  G +Y FS+WV+I N     +       +GE    G V+A  GCWS
Sbjct  74   SQPLDSISQMVQLEKGKLYSFSAWVQI-NGGRGNVAVVFKMSRGELVRGGEVLATNGCWS  132

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    + S + +L+
Sbjct  133  LLKGGVFANTSSRVEILF  150



>ref|XP_009102314.1| PREDICTED: uncharacterized protein LOC103828470 [Brassica rapa]
Length=565

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 69/150 (46%), Gaps = 17/150 (11%)
 Frame = +3

Query  162  MKMKNTATLPFF-FLFLGYFINPSLSTYEGPL-YDSSAYTECKQHPEEALYSG-GILGGK  332
            MK  N     F  F+ +  F+ P LS +  P  YD S  +EC     + + +G G    K
Sbjct  1    MKRFNNGVFHFVVFISILLFLGPGLSMH--PFSYDHSLKSECLMELPQTINTGEGFQELK  58

Query  333  VPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDC  512
            + E       NGK V        +L  G IY  S+WV++ N     +  +L  +      
Sbjct  59   IIE-------NGKVVERV-----NLQKGGIYSISAWVKLRNEKERAVRITLRGKNVRYVD  106

Query  513  VGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
             G V+AK+GCWS +KGGF++   + + + +
Sbjct  107  GGQVIAKKGCWSLLKGGFIVNVSAPVDIFF  136



>ref|XP_011002036.1| PREDICTED: uncharacterized protein LOC105109135 isoform X1 [Populus 
euphratica]
Length=578

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 59/148 (40%), Gaps = 23/148 (16%)
 Frame = +3

Query  225  PSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG----------------GKVPE-----  341
            PS        YD SA TEC   P  A Y GGI+                 G + E     
Sbjct  19   PSACRIHAFSYDYSATTECLIEPHRAQYEGGIIANPDFTHGVQGWTVFGQGAIKEGISKN  78

Query  342  -SRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVG  518
             +R ++  +          +  L  G +Y FS+WV+I N     +       +GE    G
Sbjct  79   GNRYIVAQSRSQPLDSISQMVQLEKGKLYSFSAWVQI-NGGRGNVAVVFKMSRGELVRGG  137

Query  519  TVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
             V+A  GCWS +KGG    + S + +L+
Sbjct  138  EVLATNGCWSLLKGGVFANTSSRVEILF  165



>ref|XP_011088131.1| PREDICTED: uncharacterized protein LOC105169440 [Sesamum indicum]
Length=593

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 60/132 (45%), Gaps = 31/132 (23%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG----------------GKVPESRQVIGLNGKGVYTP  386
            YD SA  +C   P    Y GG++G                GKV   +   G N    Y  
Sbjct  30   YDYSASIQCLAEPLNPQYGGGLVGNPNFDSGLDEWSAFGGGKVVVRKSKNGNNYMAAYRR  89

Query  387  T----------FLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQ  536
                       +L +DL    +Y FS+W++++     +++A L   KG+   VG+V+AK 
Sbjct  90   ILPSDSFSHVFYLQKDL----LYTFSAWLQLDKGKD-IISAFLEIPKGQSIIVGSVIAKS  144

Query  537  GCWSFIKGGFVL  572
            GCWS +KGGF +
Sbjct  145  GCWSMLKGGFTV  156



>ref|XP_011002043.1| PREDICTED: uncharacterized protein LOC105109135 isoform X2 [Populus 
euphratica]
Length=563

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 57/138 (41%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG----------------GKVPE------SRQVIGLNG  368
            YD SA TEC   P  A Y GGI+                 G + E      +R ++  + 
Sbjct  14   YDYSATTECLIEPHRAQYEGGIIANPDFTHGVQGWTVFGQGAIKEGISKNGNRYIVAQSR  73

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
                     +  L  G +Y FS+WV+I N     +       +GE    G V+A  GCWS
Sbjct  74   SQPLDSISQMVQLEKGKLYSFSAWVQI-NGGRGNVAVVFKMSRGELVRGGEVLATNGCWS  132

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    + S + +L+
Sbjct  133  LLKGGVFANTSSRVEILF  150



>ref|XP_010065891.1| PREDICTED: uncharacterized protein LOC104453080 isoform X3 [Eucalyptus 
grandis]
Length=605

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------------LGGKVPESR------QVIGLNGK  371
            YDSSA T+C   P   +Y GG+               LG    E R      + +    +
Sbjct  56   YDSSATTQCLAEPGSLMYGGGVILNPEFIHGTSGWTVLGEGATEVRISHTNNRFMVARDR  115

Query  372  GVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               T +F  +  L  G  Y FS+WV+     S  +     T  G+    G+VVAKQGCWS
Sbjct  116  KRPTDSFSQKVQLEKGMFYAFSAWVQASQG-SETVAVVFRTRDGKFVRGGSVVAKQGCWS  174

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S   +L+
Sbjct  175  LLKGGIAANSSSPADVLF  192



>gb|KCW63591.1| hypothetical protein EUGRSUZ_G01217 [Eucalyptus grandis]
Length=558

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------------LGGKVPESR------QVIGLNGK  371
            YDSSA T+C   P   +Y GG+               LG    E R      + +    +
Sbjct  9    YDSSATTQCLAEPGSLMYGGGVILNPEFIHGTSGWTVLGEGATEVRISHTNNRFMVARDR  68

Query  372  GVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               T +F  +  L  G  Y FS+WV+     S  +     T  G+    G+VVAKQGCWS
Sbjct  69   KRPTDSFSQKVQLEKGMFYAFSAWVQASQG-SETVAVVFRTRDGKFVRGGSVVAKQGCWS  127

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S   +L+
Sbjct  128  LLKGGIAANSSSPADVLF  145



>ref|XP_009774985.1| PREDICTED: uncharacterized protein LOC104224952 isoform X2 [Nicotiana 
sylvestris]
Length=572

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 23/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG--------------GKVP-ESRQVIGLNGKGVY---  380
            YD SA  EC   P +  Y GG++               G V  E+R+  G      Y   
Sbjct  28   YDYSATIECLNQPLDPQYGGGLIANPSFDKGVEAWKVDGHVKIEARESGGNKFIVAYNRT  87

Query  381  TPTFLLQD--LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            TP  + Q   L  G  Y FS+WV++      ++     + +     VG+V+AK GCWS I
Sbjct  88   TPFSISQSFYLKEGVFYTFSAWVQLSEGSDIVVAMIYNSVENTVHVVGSVIAKSGCWSMI  147

Query  555  KGGFVLTSPSNL-SLLYFQ  608
            KGG  LT   N  S+L+FQ
Sbjct  148  KGG--LTVDQNAPSVLHFQ  164



>ref|XP_010683117.1| PREDICTED: uncharacterized protein LOC104897858 [Beta vulgaris 
subsp. vulgaris]
Length=589

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 64/152 (42%), Gaps = 36/152 (24%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG----------------  326
            F L+LG        T +   YD +A TEC +   +  Y GGI+                 
Sbjct  12   FLLYLG-------DTLQALTYDYTATTECLEEAWKVQYGGGIIQNPEFDNGVEGWTVFGQ  64

Query  327  GKVPESRQVIGLNGKGVYTPTFLLQ---------DLTAGTIYCFSSWVRIENADSALLTA  479
            G++ E    I  NG          Q          L  G +Y FS+W+++    S +++ 
Sbjct  65   GQIEER---ITKNGNKFIAALNRTQPSDGLSQRVQLIKGKLYAFSAWIQLSEG-SEIISV  120

Query  480  SLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLT  575
               +  GE    GTV+A+QGCWS +KGG V T
Sbjct  121  KFRSPSGEYLHGGTVIAEQGCWSMLKGGIVAT  152



>ref|XP_009774984.1| PREDICTED: uncharacterized protein LOC104224952 isoform X1 [Nicotiana 
sylvestris]
Length=589

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 23/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG--------------GKVP-ESRQVIGLNGKGVY---  380
            YD SA  EC   P +  Y GG++               G V  E+R+  G      Y   
Sbjct  45   YDYSATIECLNQPLDPQYGGGLIANPSFDKGVEAWKVDGHVKIEARESGGNKFIVAYNRT  104

Query  381  TPTFLLQD--LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            TP  + Q   L  G  Y FS+WV++      ++     + +     VG+V+AK GCWS I
Sbjct  105  TPFSISQSFYLKEGVFYTFSAWVQLSEGSDIVVAMIYNSVENTVHVVGSVIAKSGCWSMI  164

Query  555  KGGFVLTSPSNL-SLLYFQ  608
            KGG  LT   N  S+L+FQ
Sbjct  165  KGG--LTVDQNAPSVLHFQ  181



>ref|XP_010065884.1| PREDICTED: uncharacterized protein LOC104453077 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63588.1| hypothetical protein EUGRSUZ_G01213 [Eucalyptus grandis]
Length=582

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 61/138 (44%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------------GGKVPE------SRQVIGLNG  368
            YD+ A T+C   P   +Y GG++                 G + E      +R ++  N 
Sbjct  32   YDALATTQCLAEPGSTMYGGGVIVNPEFSNGTAGWAMFGKGVIEECISRSKNRFMVARNR  91

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            K           L  G  Y FS+W+++ N  S  ++       GE    G++VA+QGCWS
Sbjct  92   KRPMDSVSQKVRLEKGKFYAFSAWIQV-NEGSETVSVVFGVGDGEFVPGGSIVAEQGCWS  150

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S +++L+
Sbjct  151  LLKGGVAANSSSTVNVLF  168



>ref|XP_011088132.1| PREDICTED: uncharacterized protein LOC105169441 [Sesamum indicum]
Length=585

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 65/153 (42%), Gaps = 31/153 (20%)
 Frame = +3

Query  192  FFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGK  371
             F +F    I     T     YD SA  EC   P+   Y  G++G    +S    GLNG 
Sbjct  1    MFAVFCSILIAGCALTISAASYDYSASIECLAEPQHPQYKDGLVGDPEFDS----GLNGW  56

Query  372  GVY-------------------------TPTFLLQ-DLTAGTIYCFSSWVRIENADSALL  473
             V+                         + +F  +  L    +Y FS+W+R++     ++
Sbjct  57   NVFGSGKIAARTSETGNKYMVAYDRNLSSDSFSHKFSLQKDLLYTFSAWLRLDEG-KEIV  115

Query  474  TASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVL  572
            +A L    G+   VG+V+A+ GCWS +KGGF +
Sbjct  116  SAYLRIPNGQNRIVGSVLAESGCWSMLKGGFAV  148



>ref|XP_010065889.1| PREDICTED: uncharacterized protein LOC104453080 isoform X1 [Eucalyptus 
grandis]
Length=617

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------------LGGKVPESR------QVIGLNGK  371
            YDSSA T+C   P   +Y GG+               LG    E R      + +    +
Sbjct  68   YDSSATTQCLAEPGSLMYGGGVILNPEFIHGTSGWTVLGEGATEVRISHTNNRFMVARDR  127

Query  372  GVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               T +F  +  L  G  Y FS+WV+     S  +     T  G+    G+VVAKQGCWS
Sbjct  128  KRPTDSFSQKVQLEKGMFYAFSAWVQASQG-SETVAVVFRTRDGKFVRGGSVVAKQGCWS  186

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S   +L+
Sbjct  187  LLKGGIAANSSSPADVLF  204



>ref|XP_008454401.1| PREDICTED: uncharacterized protein LOC103494817 [Cucumis melo]
Length=582

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 62/153 (41%), Gaps = 29/153 (19%)
 Frame = +3

Query  186  LPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGIL--------------  323
            LP   +F G FI     T +G  YD SA T+C   P      GG++              
Sbjct  9    LPLILIFSGKFI----ITIQGVSYDYSATTQCLGKPRRVHDGGGMIVNSEFNNGIEGWKV  64

Query  324  --GGKVPE---------SRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSAL  470
              GGK+ E         +  ++  N          L  L    +Y FS+WVR+   ++ +
Sbjct  65   FGGGKIKEGWLKHGNLINTFIVAHNRTSPRDTFHQLLHLQQHYLYTFSAWVRLSEGNAPV  124

Query  471  LTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
                  ++ G+    G  +AK GCWS +KGG V
Sbjct  125  AVVFRNSKGGQILHGGETMAKHGCWSLLKGGIV  157



>ref|XP_010065890.1| PREDICTED: uncharacterized protein LOC104453080 isoform X2 [Eucalyptus 
grandis]
Length=614

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGI---------------LGGKVPESR------QVIGLNGK  371
            YDSSA T+C   P   +Y GG+               LG    E R      + +    +
Sbjct  65   YDSSATTQCLAEPGSLMYGGGVILNPEFIHGTSGWTVLGEGATEVRISHTNNRFMVARDR  124

Query  372  GVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               T +F  +  L  G  Y FS+WV+     S  +     T  G+    G+VVAKQGCWS
Sbjct  125  KRPTDSFSQKVQLEKGMFYAFSAWVQASQG-SETVAVVFRTRDGKFVRGGSVVAKQGCWS  183

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S   +L+
Sbjct  184  LLKGGIAANSSSPADVLF  201



>ref|XP_002867154.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43413.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 49/108 (45%), Gaps = 3/108 (3%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            +  S  TEC   P ++  + G+L        +S +   ++G G          L  G IY
Sbjct  31   HSHSLNTECVMKPPQSSETQGLLQFSRSVEADSGEEWKIDGNGAIREMAQRIQLHQGNIY  90

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
             FS+WV++   +   +     TE G     G V AKQGCW+ +KGG V
Sbjct  91   SFSAWVKLREGNDKKVGVVFRTENGRLVHGGEVRAKQGCWTLLKGGIV  138



>gb|EEC74704.1| hypothetical protein OsI_10420 [Oryza sativa Indica Group]
Length=557

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 8/129 (6%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPES----RQVIGL  362
            FFL +  F    + +   P YD SA  EC + PE+ LY GGIL     +     ++++  
Sbjct  10   FFLAIILFEGCLVRSQSVP-YDYSANIECVKEPEKPLYGGGILKETEAKGYASGKKLLSE  68

Query  363  NGKGV--YTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQ  536
            N K       + L  DL     Y  S W+++   +  +  A L+T  G+ +  G + AK 
Sbjct  69   NSKSAAPVKGSALKVDLKKDHHYALSVWLQLSKGEGDI-RAVLVTPDGKFNTAGMIAAKC  127

Query  537  GCWSFIKGG  563
            GCW+ +KGG
Sbjct  128  GCWTMLKGG  136



>ref|XP_010313152.1| PREDICTED: uncharacterized protein LOC101264695 [Solanum lycopersicum]
Length=1194

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 35/130 (27%), Positives = 56/130 (43%), Gaps = 22/130 (17%)
 Frame = +3

Query  243  EGPLYDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQVIGLNG---  368
            +G  Y+ +A  EC   P+   Y GG L               GG   E R+    N    
Sbjct  120  DGMTYNYNASIECLAEPQHVQYKGGTLINPKFDLGLHGWEGMGGAKIEIRRSFSRNNFMV  179

Query  369  ---KGVYTPTFLLQD-LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQ  536
               +  Y  TF  +  +  G  Y FS+WVR+       ++A+++T++     + +  A  
Sbjct  180  AYNRNEYNATFSQKIFMEKGYYYTFSAWVRVSEGTETTVSAAIITKENSKRVIASGNAYP  239

Query  537  GCWSFIKGGF  566
            GCW+ +KGGF
Sbjct  240  GCWTMLKGGF  249



>ref|XP_010065885.1| PREDICTED: uncharacterized protein LOC104453077 isoform X2 [Eucalyptus 
grandis]
Length=579

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 61/138 (44%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------------GGKVPE------SRQVIGLNG  368
            YD+ A T+C   P   +Y GG++                 G + E      +R ++  N 
Sbjct  29   YDALATTQCLAEPGSTMYGGGVIVNPEFSNGTAGWAMFGKGVIEECISRSKNRFMVARNR  88

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            K           L  G  Y FS+W+++ N  S  ++       GE    G++VA+QGCWS
Sbjct  89   KRPMDSVSQKVRLEKGKFYAFSAWIQV-NEGSETVSVVFGVGDGEFVPGGSIVAEQGCWS  147

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S +++L+
Sbjct  148  LLKGGVAANSSSTVNVLF  165



>ref|NP_001049300.1| Os03g0201800 [Oryza sativa Japonica Group]
 gb|ABF94507.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11214.1| Os03g0201800 [Oryza sativa Japonica Group]
 dbj|BAG97270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=582

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 8/129 (6%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPES----RQVIGL  362
            FFL +  F    + +   P YD SA  EC + PE+ LY GGIL     +     ++++  
Sbjct  10   FFLAIILFEGCLVRSQSVP-YDYSANIECVKEPEKPLYGGGILKETEAKGYASGKKLLSE  68

Query  363  NGKGV--YTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQ  536
            N K       + L  DL     Y  S W+++   +  +  A L+T  G+ +  G + AK 
Sbjct  69   NSKSAAPVKGSALKVDLKKDHHYALSVWLQLSKGEGDI-RAVLVTPDGKFNTAGMIAAKC  127

Query  537  GCWSFIKGG  563
            GCW+ +KGG
Sbjct  128  GCWTMLKGG  136



>gb|ABF94508.1| Glycosyl hydrolase family 10 protein, expressed [Oryza sativa 
Japonica Group]
Length=557

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 54/109 (50%), Gaps = 7/109 (6%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPES----RQVIGLNGKGV--YTPTFLLQDLTAG  416
            YD SA  EC + PE+ LY GGIL     +     ++++  N K       + L  DL   
Sbjct  29   YDYSANIECVKEPEKPLYGGGILKETEAKGYASGKKLLSENSKSAAPVKGSALKVDLKKD  88

Query  417  TIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGG  563
              Y  S W+++   +  +  A L+T  G+ +  G + AK GCW+ +KGG
Sbjct  89   HHYALSVWLQLSKGEGDI-RAVLVTPDGKFNTAGMIAAKCGCWTMLKGG  136



>ref|XP_010065894.1| PREDICTED: uncharacterized protein LOC104453082 [Eucalyptus grandis]
Length=603

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 60/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESR------QVIGLNGK  371
            YDS A T+C   P   +Y GG++               G    ESR      + +    +
Sbjct  54   YDSMATTQCLAEPGSLMYGGGVILNPEFIHGTSAWTVFGQGATESRISHTNNRFMVARDR  113

Query  372  GVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               + +F  +  L  G  Y FS+WV++      +  A   T  GE    G+VVA+QGCWS
Sbjct  114  KCPSDSFSQKVQLEKGMFYAFSAWVQVSRGSETVWVA-FRTGDGEFVRGGSVVAEQGCWS  172

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S   +L+
Sbjct  173  LLKGGIAANSSSPADVLF  190



>ref|XP_010065892.1| PREDICTED: uncharacterized protein LOC104453081 [Eucalyptus grandis]
Length=605

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 59/138 (43%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGG-ILGGKVPESRQVIGLNGKGVY-------TPTFLLQ---  401
            YDS A T+C   P   +Y GG IL  +         L G+G            F++    
Sbjct  56   YDSMATTQCLTEPGSLMYGGGVILNPEFIHGTSAWTLFGQGATELRISHTNNRFMVARDR  115

Query  402  -----------DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
                        L  G  Y FS+WV++    S  ++ +  T  GE    G+VVA+QGCWS
Sbjct  116  KRPSDSFSQKVQLEKGMFYAFSAWVQVSQG-SETVSVAFRTGDGEFVRGGSVVAEQGCWS  174

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S S   +L+
Sbjct  175  LLKGGIAANSSSTADVLF  192



>ref|XP_003592519.1| Endo-1,4-beta-xylanase A [Medicago truncatula]
 gb|AES62770.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=580

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 58/138 (42%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------GGKV------------PESRQVIGLNG  368
            YD SA T+C   P+ A Y GGI+          G +V             E+R ++  N 
Sbjct  31   YDYSATTQCVTEPKRAQYGGGIIVNPGFDHNIKGWRVFGNGTIEERISNDENRFIVASNR  90

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            +           L  G IY FS+W ++    S +++        E    G V+AK GCWS
Sbjct  91   RQTLDGFSQKVQLKKGMIYMFSAWFQLSEG-SDIVSVVFKRNGSELVHGGHVIAKHGCWS  149

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG V    S   +L+
Sbjct  150  LLKGGIVANFSSPAEILF  167



>ref|XP_008648082.1| PREDICTED: xylanase1 isoform X1 [Zea mays]
 tpg|DAA46845.1| TPA: xylanase1 [Zea mays]
Length=584

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/149 (26%), Positives = 62/149 (42%), Gaps = 32/149 (21%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGG---------------------KVPESRQVIGLNGK  371
            YD +A  EC   P + LY GGI+                       + P   +   ++G 
Sbjct  28   YDHTASIECLGDPMKPLYKGGIVQNSEFNSGLMGWSTHRNVKAGVSRSPSGNKFAVVHGA  87

Query  372  GVYTPT----------FLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGT  521
            G Y  +          +    + +   Y  S+W+++ N  SA + A + +  GE    G 
Sbjct  88   GSYVSSSGKLLPSHSVYQRIQMQSDRHYSLSAWLQVSNGTSAHVRAVIKSPNGERVIAGA  147

Query  522  VVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            +VA+ GCWS +KGG    S S  + +YF+
Sbjct  148  IVAQSGCWSMLKGGMTAYS-SGPAEIYFE  175



>ref|XP_010488907.1| PREDICTED: uncharacterized protein LOC104766677 [Camelina sativa]
Length=575

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 8/106 (8%)
 Frame = +3

Query  255  YDSS--AYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYC  428
            YD +  + +EC   P +A  + G  GG   E    + +N  G         DL  G IY 
Sbjct  34   YDQTLKSESECLMEPPQATVTTG--GGGFRE----LKINDNGGIRNVVERTDLEEGNIYS  87

Query  429  FSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
             S+W+++ N +   +   L  + G     G V+AK+GCWS +KGG 
Sbjct  88   ISAWIKLRNENQGKVGMILRRDNGRKVYGGEVMAKKGCWSMLKGGI  133



>ref|XP_010324022.1| PREDICTED: uncharacterized protein LOC104648447 [Solanum lycopersicum]
Length=135

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  CVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            CVG V+A+ GCWSF+KGGFVL  PS+  LLY Q
Sbjct  12   CVGNVIARPGCWSFLKGGFVLDLPSSYGLLYLQ  44



>ref|XP_010496773.1| PREDICTED: uncharacterized protein LOC104773807 isoform X1 [Camelina 
sativa]
Length=574

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 8/106 (8%)
 Frame = +3

Query  255  YDSS--AYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYC  428
            YD +  + +EC   P +A  + G  GG   E    + +N  G         DL  G IY 
Sbjct  34   YDQTLKSESECLMEPPQATVTTG--GGGFRE----LKINDNGGIRNVVERTDLEEGNIYS  87

Query  429  FSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
             S+W+++ N +   +   L  + G     G V+AK+GCWS +KGG 
Sbjct  88   ISAWIKLRNENQGKVGMILRRDNGRKVYGGEVMAKKGCWSMLKGGI  133



>ref|XP_009613540.1| PREDICTED: uncharacterized protein LOC104106642 isoform X2 [Nicotiana 
tomentosiformis]
Length=580

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 73/167 (44%), Gaps = 30/167 (18%)
 Frame = +3

Query  174  NTATLPFFFLFL-GYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG--------  326
            N   L  F LFL GY ++ +        YD SA  EC   P    Y GG++         
Sbjct  14   NNGFLLCFSLFLAGYLVHGATP------YDYSATIECLNQPLGPQYEGGLIANPSFDKGV  67

Query  327  ------GKVP-ESRQVIGLNGKGVY---TPTFLLQ--DLTAGTIYCFSSWVRIENADSAL  470
                  G V  E+R+  G      Y   TP  + Q  +L  G  Y FS+WV++      +
Sbjct  68   EAWKVDGHVKIEARESGGNKFIVAYNRTTPFSISQSFNLKEGVFYTFSAWVQLSEGSDIV  127

Query  471  LTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNL-SLLYFQ  608
            +     + +      G+V+AK GCWS IKGG  LT   N  S+L+FQ
Sbjct  128  VAMIYNSVENTVHVAGSVIAKSGCWSMIKGG--LTVDQNAPSVLHFQ  172



>gb|KFK39976.1| hypothetical protein AALP_AA3G313800 [Arabis alpina]
Length=542

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +3

Query  402  DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLT  575
            DL  G IY  S+W+++ N +  L+  +L  +       G V+AK+GCWS +KGGF++ 
Sbjct  47   DLQKGNIYSISAWIKLRNENERLVRVTLRGKNVRYIDGGHVMAKKGCWSLLKGGFIIN  104



>ref|XP_010496774.1| PREDICTED: uncharacterized protein LOC104773807 isoform X2 [Camelina 
sativa]
Length=573

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 7/105 (7%)
 Frame = +3

Query  255  YDSSAYTE-CKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCF  431
            YD +  +E C   P +A  + G  GG   E    + +N  G         DL  G IY  
Sbjct  34   YDQTLKSEKCLMEPPQATVTTG--GGGFRE----LKINDNGGIRNVVERTDLEEGNIYSI  87

Query  432  SSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
            S+W+++ N +   +   L  + G     G V+AK+GCWS +KGG 
Sbjct  88   SAWIKLRNENQGKVGMILRRDNGRKVYGGEVMAKKGCWSMLKGGI  132



>ref|XP_002465686.1| hypothetical protein SORBIDRAFT_01g043730 [Sorghum bicolor]
 gb|EER92684.1| hypothetical protein SORBIDRAFT_01g043730 [Sorghum bicolor]
Length=572

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 8/103 (8%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD SA  EC + PE+ LY GGI+      S +   + G      + L  DL     Y  S
Sbjct  61   YDYSANIECIKEPEKPLYGGGIISA-ADSSGKKCPIKG------SVLKVDLKKDYHYALS  113

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGG  563
             W++     +  +TA ++T  G+ +  G +VAK  CW+ +KGG
Sbjct  114  VWLKFSKG-TGDITAIIVTPDGKFNTAGAIVAKSECWTLLKGG  155



>ref|XP_010647914.1| PREDICTED: uncharacterized protein LOC100248080 [Vitis vinifera]
 ref|XP_010647915.1| PREDICTED: uncharacterized protein LOC100248080 [Vitis vinifera]
 ref|XP_010647916.1| PREDICTED: uncharacterized protein LOC100248080 [Vitis vinifera]
Length=578

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQ------VIGLNGK  371
            YD +A  EC + P +  Y GGI+               GG   E+R       ++  + K
Sbjct  32   YDYTASLECLEKPHKPQYGGGIILNPELNHGLKGWSAFGGAEMENRASGGNTFIVAHSRK  91

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             +         L    +Y FS+W+++ + ++ + TA   T  G P   G V A+ GCWS 
Sbjct  92   QMNDSISQKLHLHKDKLYTFSAWIQVSSGNTPV-TAVFRTNSG-PQYAGAVFAESGCWSM  149

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGG  + S S  + LYF+
Sbjct  150  LKGGLTVDS-SGPAELYFE  167



>ref|XP_010228324.1| PREDICTED: uncharacterized protein LOC100828321 [Brachypodium 
distachyon]
Length=561

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 59/134 (44%), Gaps = 38/134 (28%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------GGKVPESRQVIGLNGKGVYTPT-----  389
            YD +A  EC ++P   LY+GGI+          G  VP      G+N   + +P+     
Sbjct  7    YDHTASIECLKNPTRPLYNGGIIQNSEFNNGLAGWSVP-----FGVNTSVISSPSGNKFA  61

Query  390  ---------------FLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTV  524
                           FL++   A   Y  S+W+++ +   A++ A+     G     G++
Sbjct  62   ETSNKAQPSRSVSQKFLME---ANHHYSLSAWLQVSSGTGAIVKATFKAPNGAFIAGGSI  118

Query  525  VAKQGCWSFIKGGF  566
            VAK GCWS +KGG 
Sbjct  119  VAKSGCWSMLKGGM  132



>ref|XP_010068352.1| PREDICTED: uncharacterized protein LOC104455228 [Eucalyptus grandis]
Length=618

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 57/138 (41%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------------GGKVPESRQVIGLNGKGVYTP  386
            YD+SA T+C   P   +Y GGI+                 G++ E            Y  
Sbjct  69   YDASATTQCLAEPGITMYGGGIIVNPQFTYGTYGWTVSGQGEIAERVSRTNNGFMAAYNR  128

Query  387  TFLLQD------LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               L        L  G  Y FS+WV++    S  ++A   T  GE    G+VVA+ GCWS
Sbjct  129  KLPLDSFSQKVLLEKGKFYMFSAWVQVSEG-SETVSAVFGTGGGEFVPGGSVVAEHGCWS  187

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S   + LL+
Sbjct  188  LLKGGIAANSSGPVDLLF  205



>emb|CBI22450.3| unnamed protein product [Vitis vinifera]
Length=1130

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQ------VIGLNGK  371
            YD +A  EC + P +  Y GGI+               GG   E+R       ++  + K
Sbjct  49   YDYTASLECLEKPHKPQYGGGIILNPELNHGLKGWSAFGGAEMENRASGGNTFIVAHSRK  108

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             +         L    +Y FS+W+++ + ++ + TA   T  G P   G V A+ GCWS 
Sbjct  109  QMNDSISQKLHLHKDKLYTFSAWIQVSSGNTPV-TAVFRTNSG-PQYAGAVFAESGCWSM  166

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGG  + S S  + LYF+
Sbjct  167  LKGGLTVDS-SGPAELYFE  184



>ref|XP_010068360.1| PREDICTED: uncharacterized protein LOC104455238 [Eucalyptus grandis]
Length=609

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 57/138 (41%), Gaps = 23/138 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------------GGKVPESRQVIGLNGKGVYTP  386
            YD+SA T+C   P   +Y GGI+                 G++ E            Y  
Sbjct  60   YDASATTQCLAEPGITMYGGGIIVNPQFTYGTYGWTVSGQGEIAERVSRTNNGFMAAYNR  119

Query  387  TFLLQD------LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
               L        L  G  Y FS+WV++    S  ++A   T  GE    G+VVA+ GCWS
Sbjct  120  KLPLDSFSQKVLLEKGKFYMFSAWVQVSEG-SETVSAVFGTGGGEFVPGGSVVAEHGCWS  178

Query  549  FIKGGFVLTSPSNLSLLY  602
             +KGG    S   + LL+
Sbjct  179  LLKGGIAANSSGPVDLLF  196



>ref|XP_010447187.1| PREDICTED: uncharacterized protein LOC104729865 [Camelina sativa]
Length=570

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 48/108 (44%), Gaps = 3/108 (3%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            +  S  TEC + P  +  + G L        +S +   ++G G+         L  G IY
Sbjct  31   HSHSLITECLRKPPRSSETQGFLLLSRSVEDDSDEGWKIDGNGIIREIAQRVQLHQGNIY  90

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
             FS+WV++   +   +     TE       G + AKQGCW+ +KGG V
Sbjct  91   SFSAWVKLRKGNDKKVGVVFRTENERLVHGGEIRAKQGCWTLLKGGIV  138



>ref|XP_009613527.1| PREDICTED: uncharacterized protein LOC104106642 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613534.1| PREDICTED: uncharacterized protein LOC104106642 isoform X1 [Nicotiana 
tomentosiformis]
Length=597

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 62/139 (45%), Gaps = 23/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG--------------GKVP-ESRQVIGLNGKGVY---  380
            YD SA  EC   P    Y GG++               G V  E+R+  G      Y   
Sbjct  53   YDYSATIECLNQPLGPQYEGGLIANPSFDKGVEAWKVDGHVKIEARESGGNKFIVAYNRT  112

Query  381  TPTFLLQ--DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFI  554
            TP  + Q  +L  G  Y FS+WV++      ++     + +      G+V+AK GCWS I
Sbjct  113  TPFSISQSFNLKEGVFYTFSAWVQLSEGSDIVVAMIYNSVENTVHVAGSVIAKSGCWSMI  172

Query  555  KGGFVLTSPSNL-SLLYFQ  608
            KGG  LT   N  S+L+FQ
Sbjct  173  KGG--LTVDQNAPSVLHFQ  189



>ref|XP_006299800.1| hypothetical protein CARUB_v10015996mg [Capsella rubella]
 gb|EOA32698.1| hypothetical protein CARUB_v10015996mg [Capsella rubella]
Length=556

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (47%), Gaps = 12/116 (10%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD S  +EC   P ++    G       E  + + +N   V +      DL  G IY  S
Sbjct  24   YDQSLTSECFTEPPQSSVKTG-------EGFKELKINENVVESV-----DLEEGNIYSIS  71

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            +WV++ N +   +  +L  + G     G V+AK+GCWS +KGG       +L +++
Sbjct  72   AWVKLRNENQRKVGMALKGKNGRNVYGGEVMAKKGCWSLLKGGITADFTGHLDIIF  127



>ref|XP_006661710.1| PREDICTED: uncharacterized protein LOC102721021 [Oryza brachyantha]
Length=580

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 58/139 (42%), Gaps = 31/139 (22%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------------------GGKVPESRQV  353
            YD +A  EC + P + LY+GGI+                           G K       
Sbjct  24   YDYTASIECLRDPLKPLYNGGIIQNGEFNSGLMGWSTHRDIKAGVSSSPSGNKFAVVEGA  83

Query  354  IGLNGKGVYTPT---FLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTV  524
              L+G     P+   +    L   T Y  S+W+++ +A SA + A + T  GE    G+V
Sbjct  84   ASLSGADAAVPSRSVYQRIRLQRDTHYSLSAWLQV-SAGSAHVKAFVRTPNGERVVAGSV  142

Query  525  VAKQGCWSFIKGGFVLTSP  581
             A+ GCWS +KGG    SP
Sbjct  143  AAQSGCWSMLKGGMTAYSP  161



>gb|EYU18454.1| hypothetical protein MIMGU_mgv1a021702mg, partial [Erythranthe 
guttata]
Length=571

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 66/144 (46%), Gaps = 34/144 (24%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG----------------GKVPESRQVIGLNG------  368
            YD SA T+C   P   LY GG++G                GKV E R    +N       
Sbjct  7    YDYSATTDCLGGPWSPLYDGGLIGNPNFDSGLDEWDKFGLGKV-ELRTSKYVNNNYMVAY  65

Query  369  -KGVYTPTF-----LLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVA  530
             + + T +F     + +DL     Y FS+W +I+   S +++A +    G    VG+V+A
Sbjct  66   DRKMATDSFSHIFYVQKDL----YYTFSAWFQIDEG-SEIISAFVQEPNGTNVIVGSVIA  120

Query  531  KQGCWSFIKGGFVLTSPSNLSLLY  602
            K GCWS +KGGF +     + L +
Sbjct  121  KSGCWSMLKGGFEVDQNMKVQLFF  144



>ref|XP_002885933.1| endo-1,4-beta-xylanase/ hydrolase, hydrolyzing O-glycosyl compounds 
[Arabidopsis lyrata subsp. lyrata]
 gb|EFH62192.1| endo-1,4-beta-xylanase/ hydrolase, hydrolyzing O-glycosyl compounds 
[Arabidopsis lyrata subsp. lyrata]
Length=570

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD S  +EC   P +        G  V +  +   +N  G         DL  G IY  S
Sbjct  32   YDQSLQSECLMEPPQTT------GNTVGQGSKEFKINESGGIRNVVERVDLQEGNIYSVS  85

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            +WV++ N     +  +   + G     G V+AK+GCWS +KGG        + +L+
Sbjct  86   AWVKLRNESQRKVGMTFRGKNGINVFGGEVMAKRGCWSLLKGGITADFSGPIDILF  141



>gb|KFK30013.1| hypothetical protein AALP_AA7G206400 [Arabis alpina]
Length=575

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 61/139 (44%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGG---------------------KVPESRQVIGLNGK  371
            YD SA  EC + P +  Y+GGI+                       ++   + V+  + K
Sbjct  25   YDYSATMECLRQPLKPQYNGGIIVNPDLRDGPQAWTPFGNAKIDFREIGNDKFVVARDRK  84

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
              +        L  G +Y FS+W+++    + +   ++  + GE    G+V+A+  CWS 
Sbjct  85   QAFDSVSQKVTLQKGLLYTFSAWLQVNKGKAPI--KAVFKKNGEYKLAGSVIAESNCWSM  142

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGG  +   S  + LYF+
Sbjct  143  LKGGLTVDE-SGPAELYFE  160



>ref|XP_006422816.1| hypothetical protein CICLE_v10028089mg [Citrus clementina]
 gb|ESR36056.1| hypothetical protein CICLE_v10028089mg [Citrus clementina]
Length=578

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 58/139 (42%), Gaps = 23/139 (17%)
 Frame = +3

Query  252  LYDSSAYTECKQHPEEALYSGGIL---------------------GGKVPESRQVIGLNG  368
            LYD SA T+C   P  A Y GG++                          E  + I  + 
Sbjct  28   LYDYSATTKCLAEPRRAHYGGGLIVNPEFNRGTEGWTAFGQAAIREATSKEGNKYIVAHS  87

Query  369  KGVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCW  545
            +     +F  +  L  G +Y FS+W+++    S  + A   T  G+    G V+AK GCW
Sbjct  88   RTNPLDSFSQKVQLEKGKLYSFSAWIQVSRG-SDTVAAVFKTSDGKLIDAGKVLAKHGCW  146

Query  546  SFIKGGFVLTSPSNLSLLY  602
            S +KGG      S + +L+
Sbjct  147  SLLKGGLAANFTSLVEILF  165



>gb|AAN10199.1| endoxylanase [Carica papaya]
Length=584

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/166 (28%), Positives = 75/166 (45%), Gaps = 39/166 (23%)
 Frame = +3

Query  186  LPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLN  365
            LP+  LF G   N +LS      YD +A  +C ++P++A Y GGI+    PE  Q  GL 
Sbjct  16   LPYALLFPGLETN-ALS------YDYTASIQCLENPQKAQYGGGIITN--PELNQ--GLK  64

Query  366  GKGVY-----------TPTFLLQD--------------LTAGTIYCFSSWVRIENADSAL  470
            G   +           + +F++                L +  +Y FS+W+R+    + +
Sbjct  65   GWSTFGDAKIQHRVAGSNSFIVAHTRSQPHDSVSQTLYLQSNKLYTFSAWIRVSEGKTPV  124

Query  471  LTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
               ++   K      G VVA+  CWS +KGG  + + S  + LYF+
Sbjct  125  --KAIFKTKSGYKYAGAVVAESNCWSMLKGGLTVDA-SGPAELYFE  167



>ref|XP_009375672.1| PREDICTED: endo-1,4-beta-xylanase 2-like [Pyrus x bretschneideri]
Length=580

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 72/161 (45%), Gaps = 39/161 (24%)
 Frame = +3

Query  201  LFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVY  380
            +F GY +N +LS      YD +A  EC + P +  YSGGI+    PE +   GL G   +
Sbjct  17   IFAGYDVN-ALS------YDYTASIECLEKPHKPKYSGGIIVN--PELKH--GLKGWSAF  65

Query  381  TPTFL------------------LQD-------LTAGTIYCFSSWVRIENADSALLTASL  485
                L                  L D       L    +Y FS+W+++ N  S  +TA  
Sbjct  66   GNAKLQHRESQGNEFVVAHSRNELHDSISQKIYLQRNKLYSFSAWIQVSNG-SVPVTAVF  124

Query  486  MTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             T  G     G++VA+  CWS +KGG  + S S  + LYF+
Sbjct  125  KTNSGFV-YAGSIVAESNCWSMLKGGLTVNS-SGPAELYFE  163



>ref|XP_006283361.1| hypothetical protein CARUB_v10004408mg [Capsella rubella]
 gb|EOA16259.1| hypothetical protein CARUB_v10004408mg [Capsella rubella]
Length=605

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 3/106 (3%)
 Frame = +3

Query  261  SSAYTECKQHPEEALYSGGILG---GKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCF  431
             S  TEC   P  +  + G+L        +S +   ++G            L  G IY F
Sbjct  69   DSLKTECVMKPPRSSETRGLLRFSRSVEDDSDEEWKIDGNRNIREMVHRIHLLQGNIYSF  128

Query  432  SSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
            ++WV++   +   +     TE G     G V AKQGCW+ +KGG V
Sbjct  129  TAWVKLREGNDKKVEVVFRTENGRLVHGGEVRAKQGCWTLLKGGIV  174



>ref|XP_006651142.1| PREDICTED: uncharacterized protein LOC102719572 [Oryza brachyantha]
Length=579

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/171 (26%), Positives = 70/171 (41%), Gaps = 25/171 (15%)
 Frame = +3

Query  165  KMKNTATLPFFFLFLGYFINPSLSTYEGPL-YDSSAYTECKQHPEEALYSGGIL------  323
            + +  A+     + L   +N + +    PL YD S+  EC   P +A Y GGI+      
Sbjct  3    RRRRRASAVLLLVCLAGLMNAAAAGTAQPLAYDYSSSAECLPEPMDAHYGGGIIRNGDFS  62

Query  324  ----------------GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIEN  455
                            G     +R  +  N    Y        L   T Y  S+W+++ +
Sbjct  63   AGIQGWSAFGYGSLAEGASPAGNRYAVATNRTRPYQSVSQKVLLQNDTHYTLSAWLQVSD  122

Query  456  ADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
              SA + A + T  G+    G V A+ GCWS +KGG   T+ +  + LYF+
Sbjct  123  G-SADVRAVVKTASGDFIHSGGVEARSGCWSILKGGLTATT-AGPAELYFE  171



>ref|NP_179076.3| putative glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 dbj|BAD43713.1| 1,4-beta-xylan endohydrolase [Arabidopsis thaliana]
 gb|AEC06322.1| putative glycosyl hydrolase [Arabidopsis thaliana]
Length=570

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 47/104 (45%), Gaps = 6/104 (6%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFS  434
            YD S  +EC   P +   + G  G  V E    + +N  G         DL  G IY  S
Sbjct  32   YDQSLKSECLMEPPQTTANTG--GEGVKE----LKINENGGIRNVVEGVDLREGNIYITS  85

Query  435  SWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGF  566
            +WV++ N     +  +   + G     G V+AK+GCWS +KGG 
Sbjct  86   AWVKLRNESQRKVGMTFSEKNGRNVFGGEVMAKRGCWSLLKGGI  129



>ref|XP_007042652.1| Glycosyl hydrolase family 10 protein [Theobroma cacao]
 gb|EOX98483.1| Glycosyl hydrolase family 10 protein [Theobroma cacao]
Length=574

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 64/139 (46%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQVIG---LNGKGVY  380
            YD +A  EC ++P + LYSGGI+               G    E R++ G   +  +G  
Sbjct  30   YDYTASIECLENPHKPLYSGGIILNPELNVGLEGWHAFGDAKLEHRELAGNKFVVARGRN  89

Query  381  TPTFLLQD---LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             P+  +     L    +Y FS+W+++   ++ +  A++          G VVA+  CWS 
Sbjct  90   QPSDSVSQKLYLQKEMLYSFSAWIQVSEGNAPV--AAVFKAATGFKHAGAVVAESNCWSM  147

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGGF     S  + LYF+
Sbjct  148  LKGGFT-PDASGPAELYFE  165



>ref|XP_002313181.1| hypothetical protein POPTR_0009s09090g [Populus trichocarpa]
 gb|EEE87136.1| hypothetical protein POPTR_0009s09090g [Populus trichocarpa]
Length=575

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 58/139 (42%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTE-CKQHPEEALYSGGILG----------------GKVPE------SRQVIGLN  365
            YD SA TE C   P+ A Y GGI+                 G + E      +R ++  +
Sbjct  25   YDYSATTEQCLIEPQRAQYEGGIIANPDFTHGVQGWTVFGQGAIKEGISKNGNRYIVAHS  84

Query  366  GKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCW  545
                         L  G +Y FS+WV+I N     +       +GE    G V+A+ GCW
Sbjct  85   RSQPLDSISQKVQLEKGKLYSFSAWVQI-NGGRGNVAVVFKMSRGELVRGGKVLARNGCW  143

Query  546  SFIKGGFVLTSPSNLSLLY  602
            S +KGG    + S + +L+
Sbjct  144  SLLKGGVFANTSSRVEILF  162



>ref|XP_009406807.1| PREDICTED: endo-1,4-beta-xylanase A-like [Musa acuminata subsp. 
malaccensis]
Length=571

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 62/144 (43%), Gaps = 32/144 (22%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPESRQVIGLNGKGVYT------------PTFLL  398
            YD SA  EC   P+   Y GGI+  + PE     GL G  V+               FL 
Sbjct  28   YDYSASIECLAEPQRPQYGGGIV--RNPEFND--GLKGWSVFGYGKLAERTSDTGNRFLA  83

Query  399  QD--------------LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQ  536
             D              L  G +Y FS+W++++  ++ + TA   T K     VG V A+ 
Sbjct  84   TDGRSLSHQSMSQKIYLQRGMLYTFSAWLQVDQGNTTV-TAIFKTAKDGFVHVGAVEARS  142

Query  537  GCWSFIKGGFVLTSPSNLSLLYFQ  608
            GCWS +KGG    S S  +  YF+
Sbjct  143  GCWSMLKGGLTAKS-SGPAEFYFE  165



>gb|EYU39075.1| hypothetical protein MIMGU_mgv1a0048872mg, partial [Erythranthe 
guttata]
Length=195

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 75/173 (43%), Gaps = 41/173 (24%)
 Frame = +3

Query  180  ATLPFFFLFLGYF-INPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILGGKVPESRQVI  356
            A L + + FL +  I  S        YD S   EC   P +  Y+GGI+    PE  +  
Sbjct  2    AKLVYSWWFLSFLLILVSRIEAHSVTYDPSFTHECLSTPLKPQYNGGIIIN--PELNE--  57

Query  357  GLNG---------------------------KGVYTPTFLLQDLTAGTIYCFSSWVRIEN  455
             LNG                           + +++    L++     +Y FS+WV++ N
Sbjct  58   KLNGWIVSGDASAALGESCDGNNYIITSKRKQSIFSQKLFLEE---NKLYTFSAWVQVSN  114

Query  456  ADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV--LTSPSNLSLLYFQ  608
             + A + A + T        G V+ ++GCWS +KGGFV  +T P++   LYF+
Sbjct  115  GNDADVAAIIKTST-YSQSPGAVIGREGCWSMLKGGFVVNVTGPAD---LYFE  163



>emb|CAN61987.1| hypothetical protein VITISV_034671 [Vitis vinifera]
Length=162

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 23/125 (18%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQ------VIGLNGK  371
            YD +A  EC + P +  Y GGI+               GG   E+R       ++  + K
Sbjct  32   YDYTASLECLEKPHKPQYGGGIILNPELNHGLKGWSAFGGAEMENRASGGNTFIVAHSRK  91

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             +         L    +Y FS+W+++ + ++ + TA   T  G P   G V A+ GCWS 
Sbjct  92   QMNDSISQKLHLHKDKLYTFSAWIQVSSGNTPV-TAVFRTNSG-PQYAGAVFAESGCWSM  149

Query  552  IKGGF  566
            +KGG 
Sbjct  150  LKGGL  154



>ref|XP_006651141.1| PREDICTED: uncharacterized protein LOC102719284 [Oryza brachyantha]
Length=557

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 62/136 (46%), Gaps = 19/136 (14%)
 Frame = +3

Query  195  FFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGIL-------------GGKV  335
            F L +  F   S+ +   P YD SA  EC + PE+ LY GGIL             GGK 
Sbjct  10   FLLAMILFEVCSVRSDRVP-YDYSANMECVKEPEKPLYGGGILKDLKDTEAAKGYAGGKK  68

Query  336  PESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCV  515
              S +      KG    + L  +L     Y  S+W+++    +  + A L+T  G+ +  
Sbjct  69   LLSEKCKSAPVKG----SVLKVELKKDHHYALSAWLKLSKG-AGDVRAVLVTPDGKFNTA  123

Query  516  GTVVAKQGCWSFIKGG  563
            G +V +  CW+ +KGG
Sbjct  124  GVIVTQSDCWTMLKGG  139



>ref|NP_001064415.1| Os10g0351700 [Oryza sativa Japonica Group]
 gb|AAP53220.2| 1,4-beta-xylanase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26329.1| Os10g0351700 [Oryza sativa Japonica Group]
 dbj|BAG92066.1| unnamed protein product [Oryza sativa Japonica Group]
Length=578

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 59/132 (45%), Gaps = 29/132 (22%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------------------GGKVPESRQV  353
            YD +A  EC + P + LY+GGI+                           G K    ++ 
Sbjct  25   YDHTASIECLRDPMKPLYNGGIIQNGEFNSGLMGWSTHRDIKAGLSSSPSGNKFAVVQRA  84

Query  354  IGLNGKGVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVA  530
              L+G  V + +   +  L   T Y  S+W+++ +A +A + A + T  GE    G+V A
Sbjct  85   DSLSGAAVPSRSVYQKIQLQGDTHYSLSAWLQV-SAGAAHVKAFVKTPNGERVVAGSVSA  143

Query  531  KQGCWSFIKGGF  566
            + GCWS +KGG 
Sbjct  144  QSGCWSMLKGGM  155



>gb|EEC66792.1| hypothetical protein OsI_33191 [Oryza sativa Indica Group]
Length=578

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 59/132 (45%), Gaps = 29/132 (22%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------------------GGKVPESRQV  353
            YD +A  EC + P + LY+GGI+                           G K    ++ 
Sbjct  25   YDHTASIECLRDPMKPLYNGGIIQNGEFNSGLMGWSTHRDIKAGLSSSPSGNKFAVVQRA  84

Query  354  IGLNGKGVYTPTFLLQ-DLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVA  530
              L+G  V + +   +  L   T Y  S+W+++ +A +A + A + T  GE    G+V A
Sbjct  85   DSLSGAAVPSRSVYQKIQLQGDTHYSLSAWLQV-SAGAAHVKAFVKTPNGERVVAGSVSA  143

Query  531  KQGCWSFIKGGF  566
            + GCWS +KGG 
Sbjct  144  QSGCWSMLKGGM  155



>ref|XP_010447188.1| PREDICTED: uncharacterized protein LOC104729866 isoform X1 [Camelina 
sativa]
Length=573

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 52/115 (45%), Gaps = 21/115 (18%)
 Frame = +3

Query  261  SSAYTECKQHPEEALYSGGIL------------GGKVPESRQVIGLNGKGVYTPTFLLQD  404
             S  TEC  +P  +  + G+L            G K+  ++ +     +G+    +L Q 
Sbjct  38   DSLKTECVMNPPRSSETQGLLRFSRSVEDDSDEGWKIDGNKAI-----RGMVQRIYLHQ-  91

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
               G IY FS+WV++   +   +     TE G     G V AKQGCW+ +KGG V
Sbjct  92   ---GNIYSFSAWVKLREGNKNKVGVVFKTENGRLVHGGEVRAKQGCWTLLKGGIV  143



>ref|XP_010447189.1| PREDICTED: uncharacterized protein LOC104729866 isoform X2 [Camelina 
sativa]
Length=565

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 48/106 (45%), Gaps = 3/106 (3%)
 Frame = +3

Query  261  SSAYTECKQHPEEALYSGGILG-GKVPESRQVIGLNGKGVYTPTFLLQD--LTAGTIYCF  431
             S  TEC  +P  +  + G+L   +  E     G    G      ++Q   L  G IY F
Sbjct  30   DSLKTECVMNPPRSSETQGLLRFSRSVEDDSDEGWKIDGNKAIRGMVQRIYLHQGNIYSF  89

Query  432  SSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
            S+WV++   +   +     TE G     G V AKQGCW+ +KGG V
Sbjct  90   SAWVKLREGNKNKVGVVFKTENGRLVHGGEVRAKQGCWTLLKGGIV  135



>ref|XP_002867151.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43410.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 62/140 (44%), Gaps = 25/140 (18%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL-------GG---------------KVPESRQVIGLNG  368
            YD SA  EC + P +  Y+GGI+       GG               K+     V+  + 
Sbjct  25   YDYSATIECLEIPLKPQYNGGIIVNPDLRDGGSLGWTPFGNAKVDFRKIGNHNFVVARDR  84

Query  369  KGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWS  548
            K  Y        L  G +Y FS+W+++    + +   ++  + GE    G+VVA+  CWS
Sbjct  85   KQPYDSVSQKVYLEKGLLYTFSAWLQVSKGKAPV--KAVFKKNGEYKHAGSVVAESKCWS  142

Query  549  FIKGGFVLTSPSNLSLLYFQ  608
             +KGG  +   S  + LYF+
Sbjct  143  MLKGGLTVDE-SGPAQLYFE  161



>ref|XP_010065883.1| PREDICTED: uncharacterized protein LOC104453076 [Eucalyptus grandis]
Length=535

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 3/103 (3%)
 Frame = +3

Query  300  ALYSGGILGGKVP--ESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALL  473
            A++  G++   +   ++R ++  N K           L  G  Y FS+W+++ N  S  +
Sbjct  20   AMFGKGVIEESISLSKNRFMVARNRKRPMDSVSQKVQLEKGKFYAFSAWIQV-NEGSETV  78

Query  474  TASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            +       GE    G++VA+QGCWS +KGG  + S S + +L+
Sbjct  79   SVVFGVGDGEFVPGGSIVAEQGCWSLLKGGVAVNSSSTVDVLF  121



>ref|XP_009406772.1| PREDICTED: endo-1,4-beta-xylanase C-like [Musa acuminata subsp. 
malaccensis]
Length=571

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 66/162 (41%), Gaps = 42/162 (26%)
 Frame = +3

Query  186  LPFFFLFLGYFINPSLSTYEGPL-----YDSSAYTECKQHPEEALYSGGILGGKVPESRQ  350
            L FF LF       S + + G L     YD SA  EC   P    Y GGI+  + PE   
Sbjct  6    LKFFLLF------SSATIFTGNLVTSISYDYSASIECLVEPPRPQYGGGIV--RNPEFND  57

Query  351  VIGLNGKGVYT------------PTFLLQD--------------LTAGTIYCFSSWVRIE  452
              GL G  V+               FL  +              L  G +Y FS+W++++
Sbjct  58   --GLKGWSVFGYGQIAERTSDTGNMFLATERRRLSHQSVSQKVYLQRGMLYTFSAWLQVD  115

Query  453  NADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTS  578
              ++ + TA   T K     VG V A+ GCWS +KGG    S
Sbjct  116  QGNTTV-TAIFKTAKDGFVHVGAVEARSGCWSMLKGGLTAKS  156



>ref|XP_008652268.1| PREDICTED: uncharacterized protein LOC103632224 [Zea mays]
 tpg|DAA43928.1| TPA: putative glycosyl hydrolase family 10 protein [Zea mays]
Length=580

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 64/142 (45%), Gaps = 29/142 (20%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILG----------------GKVPESRQVIGLNGKGV---  377
            YD S+ +EC   P E  Y GGIL                 G V E     G NG GV   
Sbjct  35   YDYSSSSECLPEPLEPQYGGGILRNANFSAGLQGWSAFGYGAVEEGLSATG-NGYGVARN  93

Query  378  ----YTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCW  545
                Y        L   T Y  S+W+++ N  SA + A + T+ GE    G V A+ GCW
Sbjct  94   RTRPYQSVSQKVYLQNDTHYTLSAWLQVSNG-SADVRAVVKTD-GEFIHAGAVEARSGCW  151

Query  546  SFIKGGFVLTSP-SNLSLLYFQ  608
            S +KGG  LT+P S  + LYF+
Sbjct  152  SILKGG--LTAPASGAAELYFE  171



>emb|CDY49377.1| BnaA03g50660D [Brassica napus]
Length=570

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 46/108 (43%), Gaps = 3/108 (3%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            +  S  TEC   P  ++    ++        +S Q   ++  G          L  G IY
Sbjct  31   HSRSLKTECIMKPPRSIAEQELILLSHSDEDDSDQEWEIDENGAIREMAQRIQLQQGIIY  90

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
             FS+WV++   +   +     +E G     G V AKQGCWS +KGG V
Sbjct  91   SFSAWVKLRGGNDKKVGIVFRSESGRLVHGGEVRAKQGCWSLLKGGIV  138



>ref|XP_002867155.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43414.1| glycosyl hydrolase family 10 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=568

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 58/140 (41%), Gaps = 7/140 (5%)
 Frame = +3

Query  162  MKMKNTATLPFFFLFLGYFINPSLSTYEGPLYDS-SAYTECKQHPEEALYSGGILG---G  329
            MK  N        L L  F++  +S    P   S S  TEC   P  +  + G+L     
Sbjct  1    MKNINNGFFLCMLLLLWCFVHSGISI--DPFSQSDSLKTECVMKPPRSSETQGLLQFSRS  58

Query  330  KVPESRQVIGLNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPD  509
               +S +   ++  G          L  G IY FS+WV++   +   +     TE G   
Sbjct  59   VEADSDEEWKIDENGSIREMTQRIQLQQGNIYSFSAWVKLREGNKKKVGVVFRTENGVVH  118

Query  510  CVGTVVAKQGCWSFIKGGFV  569
              G V AKQGCW+ +KGG V
Sbjct  119  G-GEVRAKQGCWTLLKGGIV  137



>ref|XP_002264837.3| PREDICTED: uncharacterized protein LOC100266982, partial [Vitis 
vinifera]
Length=575

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL----------------GGKVPE-----SRQVIGLNGK  371
            YD +A  EC + P +A Y GGI+                  K+ E     +  ++  +  
Sbjct  25   YDYTASLECLEKPHKAQYGGGIVLNPELDDGLEGWSAFGEAKIEERVSGGNNFIVAHSRN  84

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
              Y  +     L    +Y FS+W+++ +  SA + A L T  G     G VVA+ GCWS 
Sbjct  85   QPYDSSSQKLHLQKDKLYTFSAWIQVSSG-SAPVAAVLKTNAG-LKYAGAVVAESGCWSM  142

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGG  + + S  + LYF+
Sbjct  143  LKGGLTVDA-SGPAQLYFE  160



>ref|NP_001130600.1| putative glycosyl hydrolase family 10 protein [Zea mays]
 gb|ACF78883.1| unknown [Zea mays]
 gb|ACR35838.1| unknown [Zea mays]
 gb|AFW89319.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=595

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 72/180 (40%), Gaps = 34/180 (19%)
 Frame = +3

Query  147  CSFCSMKMKNTATLPFFF----LFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSG  314
            C  C  +M   A L F+     L  G  +  SL  YE   YD SA  EC   P E  Y G
Sbjct  13   CLPCRDRM-TKAKLAFWLGWIALLQGCMVKSSL-PYE---YDYSASIECLPEPLEPQYGG  67

Query  315  GILG----------------GKVPESRQVIG------LNGKGVYTPTFLLQDLTAGTIYC  428
            G+L                 G + ES    G      LN    Y        L A T Y 
Sbjct  68   GVLRNADFSAGLRGWSAFGYGSIAESTSAAGNGFAVALNRTRPYQSVSQKVYLQADTHYT  127

Query  429  FSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             S+W+++  +D      +++   G+    G  VAK GCWS +KGG    S S  + LYF+
Sbjct  128  LSAWLQV--SDGGADVRAVVKTVGDFVHAGGGVAKAGCWSMLKGGLTAAS-SGPAELYFE  184



>ref|XP_010444979.1| PREDICTED: uncharacterized protein LOC104727585 [Camelina sativa]
Length=430

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 35/70 (50%), Gaps = 0/70 (0%)
 Frame = +3

Query  360  LNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQG  539
            ++G G+         L  G IY FS+WV++   +   + A   TE       G + AKQG
Sbjct  33   IDGNGIIREIAQRVQLHQGNIYSFSAWVKLREGNDKKVGAVFRTENERLVHGGEIRAKQG  92

Query  540  CWSFIKGGFV  569
            CW+ ++GG V
Sbjct  93   CWTLLQGGIV  102



>gb|AFW89320.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=625

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 55/180 (31%), Positives = 72/180 (40%), Gaps = 34/180 (19%)
 Frame = +3

Query  147  CSFCSMKMKNTATLPFFF----LFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSG  314
            C  C  +M   A L F+     L  G  +  SL  YE   YD SA  EC   P E  Y G
Sbjct  43   CLPCRDRM-TKAKLAFWLGWIALLQGCMVKSSLP-YE---YDYSASIECLPEPLEPQYGG  97

Query  315  GILG----------------GKVPESRQVIG------LNGKGVYTPTFLLQDLTAGTIYC  428
            G+L                 G + ES    G      LN    Y        L A T Y 
Sbjct  98   GVLRNADFSAGLRGWSAFGYGSIAESTSAAGNGFAVALNRTRPYQSVSQKVYLQADTHYT  157

Query  429  FSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
             S+W+++  +D      +++   G+    G  VAK GCWS +KGG    S S  + LYF+
Sbjct  158  LSAWLQV--SDGGADVRAVVKTVGDFVHAGGGVAKAGCWSMLKGGLTAAS-SGPAELYFE  214



>ref|XP_010447190.1| PREDICTED: uncharacterized protein LOC104729866 isoform X3 [Camelina 
sativa]
 ref|XP_010447191.1| PREDICTED: uncharacterized protein LOC104729866 isoform X3 [Camelina 
sativa]
Length=528

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 0/55 (0%)
 Frame = +3

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
            L  G IY FS+WV++   +   +     TE G     G V AKQGCW+ +KGG V
Sbjct  44   LHQGNIYSFSAWVKLREGNKNKVGVVFKTENGRLVHGGEVRAKQGCWTLLKGGIV  98



>ref|NP_680761.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
 gb|AAO22618.1| putative glycosyl hydrolase family 10 protein [Arabidopsis thaliana]
 gb|AEE86281.1| glycosyl hydrolase family protein [Arabidopsis thaliana]
Length=570

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/108 (29%), Positives = 46/108 (43%), Gaps = 3/108 (3%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY  425
            +  S  TEC   P  +  + G+L        +S +   ++G G          L  G IY
Sbjct  31   HSHSLNTECVMKPPRSSETKGLLQFSRSLEDDSDEEWKIDGNGFIREMAQRIQLHQGNIY  90

Query  426  CFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
             FS+WV++   +   +     TE G     G V A Q CW+ +KGG V
Sbjct  91   SFSAWVKLREGNDKKVGVVFRTENGRLVHGGEVRANQECWTLLKGGIV  138



>emb|CDO97285.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = +3

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            L  GT Y  S+W+RI   +S + TA+  T  G  +  GTV A+ GCWS +KGG V+ + S
Sbjct  72   LRKGTFYVISAWLRISEGNSPI-TAAFKTSTGIKNA-GTVFARSGCWSMLKGGLVVNA-S  128

Query  585  NLSLLYFQ  608
              + L+F+
Sbjct  129  GPAQLHFR  136



>gb|KHG22781.1| Sulfhydryl oxidase 1 [Gossypium arboreum]
Length=172

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (45%), Gaps = 28/141 (20%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQVIGLNGKGVYT--  383
            YD +A  EC + P + L+ GGI+               G    E R++ G     V+   
Sbjct  11   YDYTASIECLETPLKPLHGGGIILNPELNMGLKGWQAFGDAKIEQRELAGNEFVAVHARN  70

Query  384  -PTFLLQD---LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             PT  +     L   T+Y FS+W+++   + A+  A   T  G     G VVA+  CWS 
Sbjct  71   HPTDSISQKLYLQQETLYSFSAWIQVSEGNEAV-AAEFKTGTGFKHG-GAVVAESKCWSM  128

Query  552  IKGGFV--LTSPSNLSLLYFQ  608
            +KGGF    T P+    LYF+
Sbjct  129  LKGGFTSDATGPAE---LYFE  146



>emb|CDY28324.1| BnaC03g66350D [Brassica napus]
Length=573

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 59/139 (42%), Gaps = 27/139 (19%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGILGGKVPE-----------------------SRQVIGLN  365
            YD SA  EC  +P +  Y+GGI+    PE                       ++ VI   
Sbjct  25   YDYSATIECLGNPNKPQYNGGIIVN--PELQNGSQGWSQLGNVKVDFTESGGNKFVIARG  82

Query  366  GKGVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCW  545
                Y     +  L  G +Y FS+W+++   ++ +   ++  + GE    G+V+A+  CW
Sbjct  83   RNQSYDSVSQMVYLEKGLLYTFSAWLQVSQGNAPV--RAVFKKNGEYKHAGSVIAESKCW  140

Query  546  SFIKGGFVLTSPSNLSLLY  602
            S +KGG  +       LL+
Sbjct  141  SMLKGGLTVDESGPADLLF  159



>dbj|BAD95434.1| hypothetical protein [Arabidopsis thaliana]
Length=42

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = -3

Query  592  DKFDGEVKTNPPLIKDQQPCLATTVPTQSGSPFSVMRLAV  473
            D   GE + NPPL KDQQPCLA T PTQ     S + LA+
Sbjct  2    DCLQGESRRNPPLRKDQQPCLAVTEPTQFNVALSALSLAL  41



>gb|KCW63590.1| hypothetical protein EUGRSUZ_G01215 [Eucalyptus grandis]
Length=496

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = +3

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPS  584
            L  G  Y FS+WV++      +  A   T  GE    G+VVA+QGCWS +KGG    S S
Sbjct  19   LEKGMFYAFSAWVQVSRGSETVWVA-FRTGDGEFVRGGSVVAEQGCWSLLKGGIAANSSS  77

Query  585  NLSLLY  602
               +L+
Sbjct  78   PADVLF  83



>gb|EYU39074.1| hypothetical protein MIMGU_mgv1a019481mg, partial [Erythranthe 
guttata]
Length=555

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/112 (28%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
 Frame = +3

Query  279  CKQHPEEALYSGGILGGKVPESRQ---VIGLNGKGVYTPTFLLQDLTAGT-IYCFSSWVR  446
            C   P +  Y+GGI+    P  +    VI  +        F  + L   T +Y FS+W++
Sbjct  26   CLAKPLKPQYNGGIIVNTEPNKKLDSCVISGDANATKECIFSQKLLLENTKLYTFSAWLK  85

Query  447  IENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLY  602
            + + ++ +   +++        VGTV A+ GCWS +KGGF+  +     LL+
Sbjct  86   VSDGNTDI--GAVVKTSTYNQSVGTVFAQHGCWSMLKGGFIANASGPAELLF  135



>emb|CDX72430.1| BnaC07g44520D [Brassica napus]
Length=567

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 30/55 (55%), Gaps = 0/55 (0%)
 Frame = +3

Query  405  LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
            L  G IY FS+WV++   +   +     +E G     G V AKQGCWS +KGG V
Sbjct  81   LQQGIIYSFSAWVKLRGGNDKKVGVVFRSENGRLVHGGEVRAKQGCWSLLKGGIV  135



>gb|KEH27913.1| glycosyl hydrolase family 10 protein [Medicago truncatula]
Length=570

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 61/139 (44%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQ------VIGLNGK  371
            YD SA  EC  HP++  Y+GGI+               G    E R+      V+  N  
Sbjct  22   YDHSASIECLAHPQKPQYNGGIIKNPELNDGLQGWTAFGNARIEHRESLGNKYVVANNRN  81

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
              +        L  G  Y  S+W+++  A+  L+TA + T +G     G + A+  CWS 
Sbjct  82   QPHDSVAQKIYLQNGLHYSLSAWIQVSEAN-VLVTAMVKTTEGF-KFGGAIYAEPNCWSM  139

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGG      + ++ LYF+
Sbjct  140  LKGGLT-ADATEVAELYFE  157



>ref|XP_006412306.1| hypothetical protein EUTSA_v10024995mg [Eutrema salsugineum]
 gb|ESQ53759.1| hypothetical protein EUTSA_v10024995mg [Eutrema salsugineum]
Length=496

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/139 (27%), Positives = 61/139 (44%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQ------VIGLNGK  371
            YD SA  EC   P +  Y+GGI+               G    E R+      V+    K
Sbjct  24   YDYSATIECLAKPFKPQYNGGIIVNPDLRNGPQAWSQFGNAKVEFREIGGDKFVVARERK  83

Query  372  GVYTPTFLLQDLTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
              +        L  G +Y FS+W+++   ++ +   ++  + GE    G+V+A+  CWS 
Sbjct  84   QPFDSVSQKVYLEKGLLYTFSAWLQVNKGNAPV--KAVFKKNGEYKHAGSVIAESKCWSM  141

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGG  +   S  + LYF+
Sbjct  142  LKGGLTVDE-SGPAELYFE  159



>ref|XP_006591552.1| PREDICTED: uncharacterized protein LOC100775814 [Glycine max]
Length=604

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (43%), Gaps = 27/173 (16%)
 Frame = +3

Query  165  KMKNTATLPFFFLFLGYFINPSLST---YEGPLYDSSAYTECKQHPEEALYSGGIL----  323
            K K ++++ F  +    FI   L+T    E   YD SA  EC  HP + LY+GGI+    
Sbjct  19   KSKISSSILFLLISKILFILMLLTTGFEVEALSYDYSASIECLAHPLKPLYNGGIIQNPE  78

Query  324  -----------GGKVPESRQVIGLNGKGVYTPTFLLQDLTAGTIY-------CFSSWVRI  449
                       G    E R+ +G N   V       +D  +  IY         S+W+++
Sbjct  79   LNNELQGWTAFGDAKIEHRESLG-NKYAVVHSRNQARDSVSQKIYLQKDKHYTLSAWIQV  137

Query  450  ENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            + ++  +   +++         G + A+  CWS +KGG   +  S  + LYF+
Sbjct  138  KGSEGNVPVTAVVKTTTRLKFAGAIFAESNCWSMLKGGLT-SDESGPAELYFE  189



>ref|XP_010095699.1| putative endo-1,4-beta-xylanase C [Morus notabilis]
 gb|EXC41981.1| putative endo-1,4-beta-xylanase C [Morus notabilis]
Length=635

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 56/131 (43%), Gaps = 23/131 (18%)
 Frame = +3

Query  276  ECKQHPEEALYSGGIL----------GGKVPESRQVIGLNGKG------VYTPTFLLQDL  407
            +C + P+ A Y GGI+          G KV    ++ G   K        +  T  L   
Sbjct  20   QCLREPQAAFYGGGIIVNPEFDHGIEGWKVFGQGKIEGRLAKEGNRFIVAHNRTHPLDSF  79

Query  408  TA------GTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFV  569
            +       G IY FS+WV++    S ++       KG+    G V+A+ GCWS +KGG V
Sbjct  80   SQKVQVDQGKIYSFSAWVQVSEG-SEIVAVVFRPTKGDLTHGGKVIARSGCWSLLKGGMV  138

Query  570  LTSPSNLSLLY  602
                S + + +
Sbjct  139  ANFSSPIEIFF  149



>gb|KDP44501.1| hypothetical protein JCGZ_16334 [Jatropha curcas]
Length=585

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 61/149 (41%), Gaps = 34/149 (23%)
 Frame = +3

Query  255  YDSSAYTE-------CKQHPEEALYSGGILGGKVPESRQVI---GLNGKGV---------  377
            YD  A TE       C + P+ A Y GGI+    PE    I    + GKG          
Sbjct  28   YDYYATTEARKYFLSCLKEPQRAQYGGGIIAN--PEFTNGIEGWSVFGKGAIKGGVSEDG  85

Query  378  ------YTPTFLLQDLTA------GTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGT  521
                  +T T  L   +       G IY FS+WV+++N    ++        GE    G 
Sbjct  86   NRYIIAHTRTHSLDSFSQKVQFEEGKIYSFSAWVQVKNGSENVVVV-FRRASGELIPGGR  144

Query  522  VVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            V A  GCWSF+KGG V    S  + + F+
Sbjct  145  VTAMDGCWSFLKGGIVANFSSGPADILFK  173



>gb|KHG22780.1| ndx-1: Putative nudix hydrolase 1 [Gossypium arboreum]
Length=194

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 24/139 (17%)
 Frame = +3

Query  255  YDSSAYTECKQHPEEALYSGGIL---------------GGKVPESRQVIGLNGKGVYT--  383
            YD +A  EC + P + L+ GGI+               G    E R++ G     V+   
Sbjct  33   YDYTASIECLETPLKPLHGGGIILNPELNMGLKGWQAFGDAKIEQRELAGNEFVAVHARN  92

Query  384  -PTFLLQD---LTAGTIYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSF  551
             PT  +     L   T+Y FS+W+++   + A+  A   T  G     G VVA+  CWS 
Sbjct  93   HPTDSISQKLYLQQETLYSFSAWIQVSEGNEAV-AAEFKTGTGFKHG-GAVVAESKCWSM  150

Query  552  IKGGFVLTSPSNLSLLYFQ  608
            +KGGF  +  +  + LYF+
Sbjct  151  LKGGFT-SDATGPAELYFE  168



>gb|EYU38257.1| hypothetical protein MIMGU_mgv1a004760mg [Erythranthe guttata]
Length=511

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (2%)
 Frame = +3

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLL  599
            +Y FS+W ++ N    +++A L    G    VG+V+AK GCWS +KGGF +    N  L 
Sbjct  24   LYTFSAWFQL-NKGKEIISAYLKHGDGTSTIVGSVIAKYGCWSMLKGGFQMQEDMNAQLY  82

Query  600  YF  605
            + 
Sbjct  83   FM  84



>gb|EEE58525.1| hypothetical protein OsJ_09814 [Oryza sativa Japonica Group]
Length=992

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 31/108 (29%), Positives = 50/108 (46%), Gaps = 7/108 (6%)
 Frame = +3

Query  258  DSSAYTECKQHPEEALYSGGIL----GGKVPESRQVIGLNGKGV--YTPTFLLQDLTAGT  419
            D+     C + PE+ LY GGIL           ++++  N K       + L  DL    
Sbjct  572  DNEFTIHCVKEPEKPLYGGGILKETEAKGYASGKKLLSENSKSAAPVKGSALKVDLKKDH  631

Query  420  IYCFSSWVRIENADSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGG  563
             Y  S W+++   +  +  A L+T  G+ +  G + AK GCW+ +KGG
Sbjct  632  HYALSVWLQLSKGEGDI-RAVLVTPDGKFNTAGMIAAKCGCWTMLKGG  678



>ref|XP_008658022.1| PREDICTED: putative glycosyl hydrolase family 10 protein isoform 
X1 [Zea mays]
 gb|AFW89318.1| putative glycosyl hydrolase family 10 protein [Zea mays]
Length=576

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 68/170 (40%), Gaps = 29/170 (17%)
 Frame = +3

Query  165  KMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG------  326
            K K    L +  L  G  +  SL  YE   YD SA  EC   P E  Y GG+L       
Sbjct  3    KAKLAFWLGWIALLQGCMVKSSL-PYE---YDYSASIECLPEPLEPQYGGGVLRNADFSA  58

Query  327  ----------GKVPESRQVIG------LNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
                      G + ES    G      LN    Y        L A T Y  S+W+++  +
Sbjct  59   GLRGWSAFGYGSIAESTSAAGNGFAVALNRTRPYQSVSQKVYLQADTHYTLSAWLQV--S  116

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            D      +++   G+    G  VAK GCWS +KGG    S S  + LYF+
Sbjct  117  DGGADVRAVVKTVGDFVHAGGGVAKAGCWSMLKGGLTAAS-SGPAELYFE  165



>ref|NP_001241765.1| 1,4-beta-xylanase precursor [Zea mays]
 gb|ACG36704.1| 1,4-beta-xylanase [Zea mays]
Length=576

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 68/170 (40%), Gaps = 29/170 (17%)
 Frame = +3

Query  165  KMKNTATLPFFFLFLGYFINPSLSTYEGPLYDSSAYTECKQHPEEALYSGGILG------  326
            K K    L +  L  G  +  SL  YE   YD SA  EC   P E  Y GG+L       
Sbjct  3    KAKLAFWLGWIALLQGCMVKSSL-PYE---YDYSASIECLPEPLEPQYGGGVLRNADFSA  58

Query  327  ----------GKVPESRQVIG------LNGKGVYTPTFLLQDLTAGTIYCFSSWVRIENA  458
                      G + ES    G      LN    Y        L A T Y  S+W+++  +
Sbjct  59   GLRGWSAFGYGSIAESTSAAGNGFAVALNRTRPYQSVSQKVYLQADTHYTLSAWLQV--S  116

Query  459  DSALLTASLMTEKGEPDCVGTVVAKQGCWSFIKGGFVLTSPSNLSLLYFQ  608
            D      +++   G+    G  VAK GCWS +KGG    S S  + LYF+
Sbjct  117  DGGADVRAVVKTVGDFVHAGGGVAKAGCWSMLKGGLTAAS-SGPAELYFE  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 829366762230