BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035O22

Length=657
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611514.1|  PREDICTED: long chain base biosynthesis prot...    289   1e-91   Nicotiana tomentosiformis
ref|XP_009761445.1|  PREDICTED: long chain base biosynthesis prot...    286   2e-90   Nicotiana sylvestris
ref|XP_006347368.1|  PREDICTED: long chain base biosynthesis prot...    286   2e-90   Solanum tuberosum [potatoes]
ref|XP_004516386.1|  PREDICTED: long chain base biosynthesis prot...    285   7e-90   Cicer arietinum [garbanzo]
gb|KEH25646.1|  long chain base biosynthesis 2a-like protein            285   8e-90   Medicago truncatula
dbj|BAG68298.1|  serine palmitoyltransferase                            284   1e-89   Nicotiana benthamiana
ref|XP_004241473.1|  PREDICTED: long chain base biosynthesis prot...    283   2e-89   Solanum lycopersicum
dbj|BAC55228.1|  serine palmitoyltransferase                            283   3e-89   Lotus japonicus
dbj|BAE96963.1|  serine palmitpoyltransferase subunit2                  282   4e-89   Nicotiana tabacum [American tobacco]
ref|XP_004235384.1|  PREDICTED: long chain base biosynthesis prot...    282   5e-89   
ref|XP_002284409.1|  PREDICTED: long chain base biosynthesis prot...    282   7e-89   Vitis vinifera
emb|CBI15735.3|  unnamed protein product                                282   1e-88   Vitis vinifera
emb|CAB44316.1|  serine palmitoyltransferase                            281   2e-88   Solanum tuberosum [potatoes]
ref|XP_006364387.1|  PREDICTED: long chain base biosynthesis prot...    281   2e-88   Solanum tuberosum [potatoes]
ref|XP_003518128.1|  PREDICTED: long chain base biosynthesis prot...    280   2e-88   Glycine max [soybeans]
gb|KHN00617.1|  Serine palmitoyltransferase 2                           280   4e-88   Glycine soja [wild soybean]
ref|XP_003548027.1|  PREDICTED: long chain base biosynthesis prot...    280   5e-88   Glycine max [soybeans]
gb|KHN13380.1|  Serine palmitoyltransferase 2                           280   5e-88   Glycine soja [wild soybean]
gb|ABV57769.1|  serine C-palmitoyltransferase                           272   2e-87   Gossypium hirsutum [American cotton]
gb|KHG30176.1|  Serine palmitoyltransferase 2                           278   2e-87   Gossypium arboreum [tree cotton]
ref|XP_002512864.1|  serine palmitoyltransferase, putative              277   4e-87   Ricinus communis
ref|XP_008464380.1|  PREDICTED: long chain base biosynthesis prot...    277   4e-87   Cucumis melo [Oriental melon]
ref|XP_004138028.1|  PREDICTED: long chain base biosynthesis prot...    277   4e-87   Cucumis sativus [cucumbers]
ref|XP_004161364.1|  PREDICTED: LOW QUALITY PROTEIN: long chain b...    277   5e-87   
ref|XP_010036863.1|  PREDICTED: long chain base biosynthesis prot...    276   1e-86   Eucalyptus grandis [rose gum]
ref|XP_007038096.1|  Long chain base2 isoform 2                         276   2e-86   
gb|EYU24476.1|  hypothetical protein MIMGU_mgv1a004686mg                276   2e-86   Erythranthe guttata [common monkey flower]
emb|CDO98665.1|  unnamed protein product                                276   2e-86   Coffea canephora [robusta coffee]
ref|XP_007038095.1|  Long chain base2 isoform 1                         276   3e-86   
ref|XP_011042943.1|  PREDICTED: long chain base biosynthesis prot...    275   3e-86   Populus euphratica
ref|XP_002318160.1|  serine palmitoyltransferase family protein         275   3e-86   Populus trichocarpa [western balsam poplar]
ref|XP_007151745.1|  hypothetical protein PHAVU_004G071100g             275   3e-86   Phaseolus vulgaris [French bean]
gb|KCW48525.1|  hypothetical protein EUGRSUZ_K02201                     275   6e-86   Eucalyptus grandis [rose gum]
gb|KJB51269.1|  hypothetical protein B456_008G209600                    274   6e-86   Gossypium raimondii
gb|KJB51268.1|  hypothetical protein B456_008G209600                    274   8e-86   Gossypium raimondii
ref|XP_011083372.1|  PREDICTED: long chain base biosynthesis prot...    274   9e-86   Sesamum indicum [beniseed]
ref|XP_008239635.1|  PREDICTED: long chain base biosynthesis prot...    270   1e-84   Prunus mume [ume]
ref|XP_007209963.1|  hypothetical protein PRUPE_ppa004890mg             271   2e-84   Prunus persica
ref|XP_006446964.1|  hypothetical protein CICLE_v10017847mg             269   6e-84   Citrus clementina [clementine]
ref|XP_006468870.1|  PREDICTED: long chain base biosynthesis prot...    268   1e-83   Citrus sinensis [apfelsine]
gb|KDO47369.1|  hypothetical protein CISIN_1g040324mg                   268   1e-83   Citrus sinensis [apfelsine]
ref|XP_006446965.1|  hypothetical protein CICLE_v10015046mg             268   1e-83   Citrus clementina [clementine]
ref|XP_011073130.1|  PREDICTED: long chain base biosynthesis prot...    268   2e-83   Sesamum indicum [beniseed]
ref|XP_011073128.1|  PREDICTED: long chain base biosynthesis prot...    268   5e-83   
ref|XP_010929641.1|  PREDICTED: long chain base biosynthesis prot...    266   6e-83   Elaeis guineensis
ref|XP_010907607.1|  PREDICTED: long chain base biosynthesis prot...    266   6e-83   Elaeis guineensis
gb|KDP41837.1|  hypothetical protein JCGZ_26855                         266   6e-83   Jatropha curcas
emb|CAP16702.1|  putative serine palmitoyltransferase subunit LCB2      261   2e-82   Nicotiana benthamiana
ref|XP_002275468.1|  PREDICTED: long chain base biosynthesis prot...    265   3e-82   Vitis vinifera
ref|XP_007031987.1|  Long chain base2 isoform 1                         265   4e-82   Theobroma cacao [chocolate]
gb|EPS63051.1|  serine palmitoyltransferase                             259   4e-82   Genlisea aurea
ref|XP_010093950.1|  Serine palmitoyltransferase 2                      266   4e-82   
ref|XP_008775142.1|  PREDICTED: long chain base biosynthesis prot...    264   8e-82   Phoenix dactylifera
emb|CDM85908.1|  unnamed protein product                                269   2e-81   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001151995.1|  LOC100285632                                       263   2e-81   Zea mays [maize]
ref|XP_009403784.1|  PREDICTED: long chain base biosynthesis prot...    263   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011002110.1|  PREDICTED: long chain base biosynthesis prot...    262   4e-81   Populus euphratica
ref|NP_001045279.1|  Os01g0928800                                       262   5e-81   
gb|EMT23338.1|  Serine palmitoyltransferase 2                           261   7e-81   
ref|XP_008778939.1|  PREDICTED: long chain base biosynthesis prot...    263   9e-81   
ref|XP_002321740.1|  serine palmitoyltransferase family protein         261   1e-80   Populus trichocarpa [western balsam poplar]
gb|AFW84059.1|  putative serine palmitoyltransferase                    256   1e-80   
ref|NP_001067972.1|  Os11g0516000                                       260   1e-80   
gb|EMS48138.1|  Serine palmitoyltransferase 2                           261   1e-80   Triticum urartu
ref|XP_010660694.1|  PREDICTED: long chain base biosynthesis prot...    260   2e-80   Vitis vinifera
ref|XP_004979342.1|  PREDICTED: long chain base biosynthesis prot...    260   2e-80   Setaria italica
ref|XP_008791061.1|  PREDICTED: long chain base biosynthesis prot...    260   2e-80   Phoenix dactylifera
ref|XP_009378026.1|  PREDICTED: long chain base biosynthesis prot...    259   5e-80   Pyrus x bretschneideri [bai li]
ref|XP_010678318.1|  PREDICTED: long chain base biosynthesis prot...    259   5e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007215280.1|  hypothetical protein PRUPE_ppa004859mg             259   6e-80   
ref|XP_008379061.1|  PREDICTED: long chain base biosynthesis prot...    259   7e-80   
ref|XP_008341247.1|  PREDICTED: long chain base biosynthesis prot...    259   7e-80   Malus domestica [apple tree]
ref|XP_009421040.1|  PREDICTED: long chain base biosynthesis prot...    258   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249161.1|  PREDICTED: long chain base biosynthesis prot...    258   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006662956.1|  PREDICTED: long chain base biosynthesis prot...    258   2e-79   Oryza brachyantha
ref|XP_008656901.1|  PREDICTED: long chain base biosynthesis prot...    258   2e-79   
ref|XP_002459025.1|  hypothetical protein SORBIDRAFT_03g044700          258   2e-79   Sorghum bicolor [broomcorn]
ref|XP_004971156.1|  PREDICTED: long chain base biosynthesis prot...    257   4e-79   Setaria italica
ref|XP_002450805.1|  hypothetical protein SORBIDRAFT_05g018880          257   4e-79   Sorghum bicolor [broomcorn]
ref|XP_008231042.1|  PREDICTED: long chain base biosynthesis prot...    256   5e-79   Prunus mume [ume]
ref|XP_010096046.1|  Serine palmitoyltransferase 2                      257   5e-79   
ref|NP_001148953.1|  serine palmitoyltransferase 2                      256   6e-79   
ref|XP_003577540.1|  PREDICTED: long chain base biosynthesis prot...    256   1e-78   Brachypodium distachyon [annual false brome]
ref|XP_006645277.1|  PREDICTED: long chain base biosynthesis prot...    255   2e-78   Oryza brachyantha
ref|XP_004304557.1|  PREDICTED: long chain base biosynthesis prot...    255   2e-78   Fragaria vesca subsp. vesca
ref|XP_009403557.1|  PREDICTED: long chain base biosynthesis prot...    254   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003564989.1|  PREDICTED: long chain base biosynthesis prot...    254   4e-78   Brachypodium distachyon [annual false brome]
ref|XP_009419359.1|  PREDICTED: long chain base biosynthesis prot...    254   5e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404745.1|  PREDICTED: long chain base biosynthesis prot...    252   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_197756.1|  serine palmitoyltransferase subunit LCB2              250   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872066.1|  LCB2 subunit protein                               250   2e-76   Arabidopsis lyrata subsp. lyrata
emb|CDX68498.1|  BnaC01g25760D                                          249   3e-76   
ref|XP_006404217.1|  hypothetical protein EUTSA_v10010322mg             249   3e-76   Eutrema salsugineum [saltwater cress]
ref|XP_009151545.1|  PREDICTED: long chain base biosynthesis prot...    249   4e-76   Brassica rapa
emb|CDX83048.1|  BnaA01g20480D                                          249   4e-76   
ref|XP_010515202.1|  PREDICTED: long chain base biosynthesis prot...    248   6e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010503519.1|  PREDICTED: long chain base biosynthesis prot...    248   6e-76   Camelina sativa [gold-of-pleasure]
dbj|BAB03231.1|  serine palmitoyltransferase                            248   6e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CDX87007.1|  BnaC03g52770D                                          248   8e-76   
ref|NP_190447.1|  serine palmitoyltransferase 1                         248   9e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290987.1|  hypothetical protein CARUB_v10017101mg             248   9e-76   Capsella rubella
gb|KFK27657.1|  hypothetical protein AALP_AA8G411600                    248   1e-75   Arabis alpina [alpine rockcress]
gb|KFK34178.1|  hypothetical protein AALP_AA5G110700                    248   1e-75   Arabis alpina [alpine rockcress]
ref|XP_006287613.1|  hypothetical protein CARUB_v10000825mg             248   1e-75   Capsella rubella
ref|XP_010519476.1|  PREDICTED: long chain base biosynthesis prot...    246   4e-75   Tarenaya hassleriana [spider flower]
ref|XP_010421176.1|  PREDICTED: long chain base biosynthesis prot...    246   5e-75   Camelina sativa [gold-of-pleasure]
gb|ABW97708.1|  serine palmitoyltransferase long chain base subunit     246   6e-75   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_009150176.1|  PREDICTED: long chain base biosynthesis prot...    246   6e-75   Brassica rapa
ref|XP_010454654.1|  PREDICTED: long chain base biosynthesis prot...    245   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_002875925.1|  hypothetical protein ARALYDRAFT_485232             245   2e-74   
ref|XP_010493489.1|  PREDICTED: long chain base biosynthesis prot...    242   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006394629.1|  hypothetical protein EUTSA_v10004251mg             236   3e-72   
ref|XP_006394630.1|  hypothetical protein EUTSA_v10004251mg             237   4e-72   
ref|XP_009363696.1|  PREDICTED: long chain base biosynthesis prot...    228   4e-71   Pyrus x bretschneideri [bai li]
gb|AFW60854.1|  hypothetical protein ZEAMMB73_652361                    227   3e-70   
ref|XP_002450804.1|  hypothetical protein SORBIDRAFT_05g018870          231   3e-69   
ref|XP_008678154.1|  PREDICTED: long chain base biosynthesis prot...    229   2e-68   Zea mays [maize]
ref|XP_008678152.1|  PREDICTED: long chain base biosynthesis prot...    229   6e-68   
ref|XP_006828786.1|  hypothetical protein AMTR_s00001p00112910          228   6e-68   Amborella trichopoda
gb|EMS46639.1|  Serine palmitoyltransferase 2                           225   6e-67   Triticum urartu
ref|XP_009411041.1|  PREDICTED: long chain base biosynthesis prot...    224   9e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR18369.1|  unknown                                                 222   1e-65   Picea sitchensis
ref|XP_006645276.1|  PREDICTED: long chain base biosynthesis prot...    220   5e-65   Oryza brachyantha
ref|NP_001045278.1|  Os01g0928700                                       216   1e-63   
ref|XP_006645275.1|  PREDICTED: long chain base biosynthesis prot...    215   4e-63   Oryza brachyantha
gb|EAY77076.1|  hypothetical protein OsI_05036                          212   5e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_011073129.1|  PREDICTED: long chain base biosynthesis prot...    211   2e-61   
sp|Q8RYL1.1|LCB2B_ORYSJ  RecName: Full=Long chain base biosynthes...    208   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009394362.1|  PREDICTED: long chain base biosynthesis prot...    209   1e-59   
ref|XP_007031988.1|  Long chain base2 isoform 2                         204   3e-59   
gb|EEE52176.1|  hypothetical protein OsJ_34042                          204   4e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009150173.1|  PREDICTED: long chain base biosynthesis prot...    201   7e-58   Brassica rapa
ref|XP_001783810.1|  predicted protein                                  199   6e-57   
ref|XP_002978032.1|  hypothetical protein SELMODRAFT_108076             190   8e-54   Selaginella moellendorffii
ref|XP_002966707.1|  hypothetical protein SELMODRAFT_86377              190   9e-54   Selaginella moellendorffii
ref|XP_011401811.1|  Serine palmitoyltransferase 2                      167   4e-45   Auxenochlorella protothecoides
gb|AAX20007.1|  putative serine palmitoyltransferase                    157   4e-44   Zea mays [maize]
ref|XP_005647033.1|  PLP-dependent transferase                          163   1e-43   Coccomyxa subellipsoidea C-169
ref|XP_005848468.1|  hypothetical protein CHLNCDRAFT_144864             158   1e-41   Chlorella variabilis
ref|XP_008678155.1|  PREDICTED: long chain base biosynthesis prot...    152   9e-40   Zea mays [maize]
ref|XP_009403558.1|  PREDICTED: long chain base biosynthesis prot...    151   2e-39   
ref|XP_011401812.1|  Serine palmitoyltransferase 2                      150   5e-38   Auxenochlorella protothecoides
ref|XP_010322021.1|  PREDICTED: long chain base biosynthesis prot...    147   7e-38   
gb|KIW03829.1|  hypothetical protein PV09_05128                         147   3e-37   Verruconis gallopava
gb|KDD76320.1|  class I/II aminotransferase                             142   6e-36   Helicosporidium sp. ATCC 50920
ref|XP_002839631.1|  hypothetical protein                               142   2e-35   Tuber melanosporum Mel28
ref|XP_002734812.1|  PREDICTED: serine palmitoyltransferase 2-like      138   3e-34   Saccoglossus kowalevskii
emb|CDX87006.1|  BnaC03g52760D                                          137   3e-34   
ref|XP_001544251.1|  hypothetical protein HCAG_01298                    137   4e-34   Histoplasma capsulatum NAm1
ref|XP_007587353.1|  putative serine palmitoyltransferase protein       139   4e-34   
gb|EKG16858.1|  Aminotransferase class I/classII                        137   4e-34   Macrophomina phaseolina MS6
ref|XP_008353440.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    140   5e-34   
ref|XP_001239438.1|  hypothetical protein CIMG_09059                    138   5e-34   Coccidioides immitis RS
ref|XP_003067044.1|  Serine palmitoyltransferase 2 , putative           138   6e-34   Coccidioides posadasii C735 delta SOWgp
gb|EWM21787.1|  serine palmitoyltransferase                             137   2e-33   Nannochloropsis gaditana
emb|CDS13464.1|  hypothetical protein LRAMOSA05640                      136   2e-33   Lichtheimia ramosa
gb|EER37408.1|  serine palmitoyltransferase                             136   2e-33   Histoplasma capsulatum H143
gb|EPZ34220.1|  Pyridoxal phosphate-dependent transferase domain-...    135   2e-33   Rozella allomycis CSF55
gb|EEH03654.1|  serine palmitoyltransferase                             136   3e-33   Histoplasma capsulatum G186AR
ref|XP_002414858.1|  serine palmitoyltransferase, putative              135   3e-33   Ixodes scapularis [blacklegged tick]
gb|EPS25829.1|  hypothetical protein PDE_00765                          135   4e-33   Penicillium oxalicum 114-2
ref|XP_007595827.1|  aminotransferase class I and II                    135   5e-33   
ref|XP_002613183.1|  hypothetical protein BRAFLDRAFT_210501             134   7e-33   Branchiostoma floridae
ref|XP_003855132.1|  serine palmitoyl transferase subunit 2             134   9e-33   Zymoseptoria tritici IPO323
ref|XP_006816918.1|  PREDICTED: serine palmitoyltransferase 2-like      133   1e-32   Saccoglossus kowalevskii
ref|XP_007674599.1|  hypothetical protein BAUCODRAFT_66436              133   1e-32   Baudoinia panamericana UAMH 10762
ref|XP_002734813.1|  PREDICTED: serine palmitoyltransferase 2-like      133   2e-32   Saccoglossus kowalevskii
gb|ENH86493.1|  serine palmitoyltransferase                             134   2e-32   
gb|KDN61953.1|  putative aminotransferase class I and II                134   2e-32   Colletotrichum sublineola
gb|EWC48527.1|  serine palmitoyltransferase 2                           133   2e-32   Drechslerella stenobrocha 248
ref|XP_002620119.1|  serine palmitoyltransferase 2                      131   3e-32   Blastomyces gilchristii SLH14081
ref|XP_003171686.1|  serine palmitoyltransferase 2                      133   4e-32   Nannizzia gypsea CBS 118893
ref|XP_002682326.1|  serine C-palmitoyltransferase                      131   5e-32   Naegleria gruberi strain NEG-M
gb|EEH21189.2|  hypothetical protein PABG_03420                         132   5e-32   Paracoccidioides brasiliensis Pb03
ref|XP_010757665.1|  hypothetical protein PADG_01990                    132   5e-32   Paracoccidioides brasiliensis Pb18
ref|XP_002845325.1|  serine palmitoyltransferase 2                      131   8e-32   Microsporum canis CBS 113480
ref|XP_003348860.1|  hypothetical protein SMAC_01883                    132   9e-32   Sordaria macrospora k-hell
gb|KDB26321.1|  hypothetical protein H109_01895                         132   1e-31   Trichophyton interdigitale MR816
ref|XP_003017462.1|  serine palmitoyltransferase 1, putative            132   1e-31   Trichophyton benhamiae CBS 112371
gb|EZF34964.1|  hypothetical protein H101_01502                         132   1e-31   Trichophyton interdigitale H6
gb|EGD96430.1|  serine palmitoyltransferase                             131   1e-31   Trichophyton tonsurans CBS 112818
ref|XP_003022680.1|  serine palmitoyltransferase 1, putative            131   1e-31   Trichophyton verrucosum HKI 0517
gb|ELR04857.1|  serine palmitoyltransferase                             132   1e-31   Pseudogymnoascus destructans 20631-21
emb|CCF34300.1|  aminotransferase class I and II                        131   1e-31   Colletotrichum higginsianum
ref|XP_006693108.1|  serine palmitoyltransferase 2-like protein         131   1e-31   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KFX46982.1|  Serine palmitoyltransferase 2                           132   2e-31   Talaromyces marneffei PM1
ref|XP_001264572.1|  serine palmitoyltransferase 2, putative            131   2e-31   Aspergillus fischeri NRRL 181
ref|XP_002795494.1|  serine palmitoyltransferase                        131   2e-31   Paracoccidioides lutzii Pb01
gb|EEQ90697.1|  serine palmitoyltransferase 2                           131   2e-31   Blastomyces dermatitidis ER-3
gb|EFQ25280.1|  aminotransferase class I and II                         130   2e-31   Colletotrichum graminicola M1.001
ref|XP_007688714.1|  hypothetical protein COCMIDRAFT_5986               130   2e-31   Bipolaris oryzae ATCC 44560
gb|EMD88052.1|  hypothetical protein COCHEDRAFT_1227287                 130   2e-31   Bipolaris maydis C5
ref|XP_003233381.1|  serine palmitoyltransferase                        130   2e-31   Trichophyton rubrum CBS 118892
ref|XP_007713154.1|  hypothetical protein COCCADRAFT_5787               130   2e-31   Bipolaris zeicola 26-R-13
ref|XP_008025168.1|  hypothetical protein SETTUDRAFT_73160              130   2e-31   Exserohilum turcica Et28A
ref|XP_752555.1|  serine palmitoyltransferase 2                         130   3e-31   Aspergillus fumigatus Af293
ref|XP_003298216.1|  hypothetical protein PTT_08848                     130   3e-31   
ref|XP_007280714.1|  serine palmitoyltransferase                        130   3e-31   
gb|KEY79580.1|  serine palmitoyltransferase 2                           130   3e-31   Aspergillus fumigatus var. RP-2014
gb|EDP56423.1|  serine palmitoyltransferase 2, putative                 130   3e-31   Aspergillus fumigatus A1163
emb|CEI99150.1|  Putative Serine palmitoyltransferase                   126   3e-31   Rhizopus microsporus
ref|XP_002559500.1|  Pc13g10800                                         130   3e-31   Penicillium rubens Wisconsin 54-1255
emb|CDH48525.1|  serine palmitoyltransferase                            130   3e-31   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_007699462.1|  hypothetical protein COCSADRAFT_316156             130   3e-31   Bipolaris sorokiniana ND90Pr
ref|XP_001936333.1|  serine palmitoyltransferase 2                      130   3e-31   Pyrenophora tritici-repentis Pt-1C-BFP
gb|EQB49036.1|  aminotransferase class I and II                         130   3e-31   Colletotrichum gloeosporioides Cg-14
gb|KFZ07335.1|  hypothetical protein V501_06551                         130   4e-31   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY75400.1|  hypothetical protein V499_04622                         130   4e-31   Pseudogymnoascus sp. VKM F-103
ref|XP_007785057.1|  serine palmitoyltransferase                        130   5e-31   Coniosporium apollinis CBS 100218
ref|XP_011107452.1|  hypothetical protein H072_1460                     129   5e-31   
ref|XP_007874560.1|  hypothetical protein PNEG_02547                    129   6e-31   Pneumocystis murina B123
ref|XP_003840146.1|  similar to serine palmitoyltransferase 2           130   6e-31   Leptosphaeria maculans JN3
gb|ESZ96400.1|  serine palmitoyltransferase 2                           129   6e-31   Sclerotinia borealis F-4128
gb|KEQ94532.1|  hypothetical protein AUEXF2481DRAFT_41119               129   7e-31   Aureobasidium subglaciale EXF-2481
emb|CEI86344.1|  Putative Serine palmitoyl transferase subunit          128   7e-31   Rhizopus microsporus
gb|KFY85583.1|  hypothetical protein V500_08288                         129   7e-31   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KIN04887.1|  hypothetical protein OIDMADRAFT_115587                  129   8e-31   Oidiodendron maius Zn
ref|XP_006682145.1|  hypothetical protein BATDEDRAFT_17918              128   8e-31   Batrachochytrium dendrobatidis JAM81
dbj|GAM40763.1|  serine palmitoyltransferase                            129   8e-31   Talaromyces cellulolyticus
gb|KEQ84476.1|  putative serine palmitoyltransferase 2                  129   9e-31   Aureobasidium pullulans EXF-150
ref|XP_001744245.1|  hypothetical protein                               127   9e-31   Monosiga brevicollis MX1
emb|CEG83280.1|  Putative Serine palmitoyltransferase 2                 128   9e-31   Rhizopus microsporus
gb|KEQ73715.1|  serine palmitoyl transferase subunit 2                  129   9e-31   Aureobasidium namibiae CBS 147.97
gb|ELQ39054.1|  serine palmitoyltransferase 2                           129   1e-30   Magnaporthe oryzae Y34
emb|CCD42541.1|  similar to serine palmitoyltransferase 2               129   1e-30   Botrytis cinerea T4
ref|XP_007832647.1|  Serine palmitoyltransferase 2                      129   1e-30   Pestalotiopsis fici W106-1
ref|XP_003712740.1|  serine palmitoyltransferase 2                      129   1e-30   Magnaporthe oryzae 70-15
gb|KFY10100.1|  hypothetical protein V492_05191                         129   1e-30   Pseudogymnoascus sp. VKM F-4246
ref|XP_005820282.1|  hypothetical protein GUITHDRAFT_98377              129   1e-30   Guillardia theta CCMP2712
gb|KFY12487.1|  hypothetical protein V491_06778                         129   1e-30   Pseudogymnoascus sp. VKM F-3775
ref|XP_002287833.1|  predicted protein                                  128   1e-30   Thalassiosira pseudonana CCMP1335
ref|XP_001587396.1|  hypothetical protein SS1G_11388                    129   2e-30   Sclerotinia sclerotiorum 1980 UF-70
gb|EMF15033.1|  PLP-dependent transferase                               128   2e-30   Sphaerulina musiva SO2202
ref|XP_001269083.1|  serine palmitoyltransferase 2, putative            128   2e-30   Aspergillus clavatus NRRL 1
ref|XP_011127662.1|  hypothetical protein AOL_s00215g158                128   2e-30   Arthrobotrys oligospora ATCC 24927
emb|CCX10037.1|  Similar to Serine palmitoyltransferase 2; acc. n...    128   2e-30   Pyronema omphalodes CBS 100304
gb|AAP47107.1|  serine palmitoyl transferase subunit                    127   3e-30   Aspergillus nidulans
ref|XP_007923404.1|  hypothetical protein MYCFIDRAFT_186373             127   3e-30   Pseudocercospora fijiensis CIRAD86
gb|KHJ31935.1|  putative serine palmitoyltransferase 2                  128   3e-30   Erysiphe necator
gb|KGO46532.1|  Pyridoxal phosphate-dependent transferase, major ...    127   3e-30   Penicillium expansum
ref|XP_001818901.1|  serine palmitoyltransferase 2                      127   4e-30   Aspergillus oryzae RIB40
ref|XP_002484864.1|  serine palmitoyltransferase 2, putative            127   4e-30   Talaromyces stipitatus ATCC 10500
emb|CDM28758.1|  Serine palmitoyltransferase 2                          127   4e-30   Penicillium roqueforti FM164
ref|XP_658706.1|  hypothetical protein AN1102.2                         127   4e-30   Aspergillus nidulans FGSC A4
gb|KFX90109.1|  hypothetical protein V490_06649                         127   4e-30   Pseudogymnoascus sp. VKM F-3557
ref|XP_001392526.1|  serine palmitoyltransferase 2                      127   4e-30   Aspergillus niger CBS 513.88
ref|XP_004349889.1|  serine palmitoyltransferase                        125   4e-30   Capsaspora owczarzaki ATCC 30864
ref|XP_008712701.1|  hypothetical protein HMPREF1541_09806              127   4e-30   Cyphellophora europaea CBS 101466
gb|EHA18026.1|  hypothetical protein ASPNIDRAFT_208165                  126   5e-30   Aspergillus niger ATCC 1015
emb|CCJ29014.1|  unnamed protein product                                127   5e-30   Pneumocystis jirovecii
gb|KFY93153.1|  hypothetical protein V498_04536                         127   5e-30   Pseudogymnoascus sp. VKM F-4517 (FW-2822)
gb|KFY59490.1|  hypothetical protein V496_05676                         127   5e-30   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
gb|ESA21945.1|  hypothetical protein GLOINDRAFT_342892                  125   5e-30   
gb|EHL00610.1|  putative Serine palmitoyltransferase 2                  127   5e-30   Glarea lozoyensis 74030
dbj|GAA88403.1|  serine palmitoyltransferase 2                          127   5e-30   Aspergillus kawachii IFO 4308
ref|XP_008086364.1|  PLP-dependent transferase                          127   6e-30   Glarea lozoyensis ATCC 20868
ref|XP_007919029.1|  putative serine palmitoyltransferase 2 protein     126   6e-30   Phaeoacremonium minimum UCRPA7
ref|XP_009851217.1|  serine palmitoyltransferase 2                      127   6e-30   Neurospora tetrasperma FGSC 2508
emb|CDS03531.1|  hypothetical protein LRAMOSA00933                      126   6e-30   Lichtheimia ramosa
ref|XP_956766.1|  serine palmitoyltransferase 2                         127   7e-30   Neurospora crassa OR74A
gb|KFY25007.1|  hypothetical protein V493_04894                         127   7e-30   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
dbj|GAD95105.1|  serine palmitoyltransferase 2, putative                127   7e-30   Byssochlamys spectabilis No. 5
ref|XP_005706634.1|  serine palmitoyltransferase                        126   8e-30   Galdieria sulphuraria
emb|CCA75183.1|  related to LCB2-serine C-palmitoyltransferase su...    124   8e-30   Serendipita indica DSM 11827
ref|XP_001692248.1|  component of serine palmitoyltransferase           124   9e-30   Chlamydomonas reinhardtii
ref|XP_001210474.1|  serine palmitoyltransferase 2                      127   1e-29   Aspergillus terreus NIH2624
ref|XP_007869602.1|  PLP-dependent transferase                          126   1e-29   Gloeophyllum trabeum ATCC 11539
ref|XP_008366156.1|  PREDICTED: long chain base biosynthesis prot...    121   1e-29   
ref|XP_001635053.1|  predicted protein                                  124   1e-29   Nematostella vectensis
ref|XP_009217029.1|  serine palmitoyltransferase 2                      126   1e-29   Gaeumannomyces tritici R3-111a-1
gb|KEQ57549.1|  putative serine palmitoyltransferase 2                  126   1e-29   Aureobasidium melanogenum CBS 110374
gb|KIW40154.1|  hypothetical protein PV06_07379                         126   1e-29   Exophiala oligosperma
gb|EKV05826.1|  Serine palmitoyltransferase 2, putative                 125   1e-29   Penicillium digitatum PHI26
gb|KIK29493.1|  hypothetical protein PISMIDRAFT_672182                  125   2e-29   Pisolithus microcarpus 441
ref|XP_007379374.1|  serine palmitoyltransferase 2                      124   2e-29   Punctularia strigosozonata HHB-11173 SS5
gb|KDB16482.1|  serine palmitoyltransferase 2                           125   2e-29   Ustilaginoidea virens
ref|XP_009550761.1|  hypothetical protein HETIRDRAFT_388721             125   2e-29   Heterobasidion irregulare TC 32-1
gb|KIK44721.1|  hypothetical protein CY34DRAFT_10860                    125   3e-29   Suillus luteus UH-Slu-Lm8-n1
emb|CCG81032.1|  putative Serine palmitoyltransferase 2                 125   3e-29   Taphrina deformans PYCC 5710
ref|XP_007394593.1|  hypothetical protein PHACADRAFT_254057             125   4e-29   
ref|XP_007431400.1|  PREDICTED: serine palmitoyltransferase 2 iso...    123   4e-29   
gb|KGO77839.1|  Pyridoxal phosphate-dependent transferase, major ...    124   4e-29   
gb|KIJ37135.1|  hypothetical protein M422DRAFT_232109                   124   4e-29   
ref|XP_007290734.1|  serine palmitoyltransferase 2                      124   4e-29   
ref|XP_004989888.1|  serine palmitoyltransferase                        123   4e-29   
dbj|GAN03028.1|  serine palmitoyltransferase protein                    124   5e-29   
gb|EPB82229.1|  serine palmitoyltransferase                             124   5e-29   
ref|XP_001908042.1|  hypothetical protein                               124   5e-29   
gb|EQK97818.1|  serine palmitoyltransferase 2                           124   5e-29   
gb|KDQ54167.1|  hypothetical protein JAAARDRAFT_136140                  124   5e-29   
gb|EME47854.1|  hypothetical protein DOTSEDRAFT_69696                   124   6e-29   
ref|XP_007769766.1|  serine palmitoyltransferase 2                      124   8e-29   
gb|KIW21395.1|  hypothetical protein PV08_01975                         124   8e-29   
ref|XP_007904203.1|  PREDICTED: serine palmitoyltransferase 2           122   8e-29   
gb|KEF55798.1|  serine palmitoyltransferase                             124   9e-29   
ref|XP_001229637.1|  hypothetical protein CHGG_03121                    123   9e-29   
gb|KIJ33564.1|  hypothetical protein M422DRAFT_183185                   121   1e-28   
ref|XP_008671350.1|  PREDICTED: long chain base biosynthesis prot...    120   1e-28   
gb|KIM92390.1|  hypothetical protein PILCRDRAFT_810446                  123   1e-28   
gb|KIM24833.1|  hypothetical protein M408DRAFT_331508                   123   1e-28   
ref|XP_005795269.1|  PREDICTED: serine palmitoyltransferase 3-like      122   1e-28   
ref|XP_008043865.1|  serine palmitoyltransferase 2                      123   1e-28   
ref|XP_003971560.1|  PREDICTED: serine palmitoyltransferase 2-like      122   1e-28   
ref|XP_009022446.1|  hypothetical protein HELRODRAFT_66644              122   1e-28   
tpg|DAA38120.1|  TPA: hypothetical protein ZEAMMB73_853430              120   1e-28   
ref|XP_005990149.1|  PREDICTED: serine palmitoyltransferase 2           122   2e-28   
emb|CAG00103.1|  unnamed protein product                                121   2e-28   
ref|XP_006632191.1|  PREDICTED: serine palmitoyltransferase 2-like      121   2e-28   
gb|KIJ22636.1|  hypothetical protein M422DRAFT_196946                   122   3e-28   
ref|XP_007802741.1|  hypothetical protein EPUS_00521                    123   3e-28   
ref|XP_009656847.1|  serine palmitoyltransferase                        122   3e-28   
ref|XP_004083402.1|  PREDICTED: serine palmitoyltransferase 2-like      121   3e-28   
ref|XP_003002263.1|  serine palmitoyltransferase                        122   3e-28   
gb|EYE95434.1|  serine palmitoyl transferase subunit                    122   3e-28   
ref|XP_008303954.1|  PREDICTED: serine palmitoyltransferase 3           121   3e-28   
gb|EPQ62028.1|  hypothetical protein BGT96224_A20663                    122   3e-28   
emb|CCU76898.1|  serine palmitoyltransferase                            122   3e-28   
ref|XP_011268270.1|  PREDICTED: serine palmitoyltransferase 2           121   3e-28   
ref|XP_007303817.1|  serine palmitoyltransferase 2                      122   4e-28   
gb|KIW60028.1|  hypothetical protein PV05_00280                         122   4e-28   
gb|KID78354.1|  serine palmitoyltransferase 2                           122   4e-28   
ref|XP_008280215.1|  PREDICTED: serine palmitoyltransferase 2-like      120   5e-28   
gb|KFM79837.1|  Serine palmitoyltransferase 2                           120   5e-28   
dbj|GAM90634.1|  hypothetical protein ANO11243_086790                   121   5e-28   
gb|KIV87699.1|  hypothetical protein PV11_03229                         121   6e-28   
ref|XP_003031688.1|  hypothetical protein SCHCODRAFT_82237              121   7e-28   
ref|XP_009033679.1|  hypothetical protein AURANDRAFT_20733              119   8e-28   
ref|NP_001006483.1|  serine palmitoyltransferase 2                      120   8e-28   
gb|KFV03677.1|  Serine palmitoyltransferase 2                           119   9e-28   
gb|KIK29494.1|  hypothetical protein PISMIDRAFT_672183                  120   1e-27   
gb|KIY67222.1|  serine palmitoyltransferase 2                           120   1e-27   
ref|XP_010795463.1|  PREDICTED: serine palmitoyltransferase 2-like      118   1e-27   
ref|XP_002125950.1|  PREDICTED: serine palmitoyltransferase 2 iso...    119   1e-27   
ref|XP_007807976.1|  serine palmitoyltransferase 2                      120   1e-27   
ref|XP_008310964.1|  PREDICTED: serine palmitoyltransferase 2 iso...    119   1e-27   
emb|CCM05394.1|  predicted protein                                      120   1e-27   
emb|CCE27517.1|  probable LCB2-serine C-palmitoyltransferase subunit    120   1e-27   
gb|KDQ12451.1|  hypothetical protein BOTBODRAFT_34428                   120   1e-27   
gb|KIK96188.1|  hypothetical protein PAXRUDRAFT_139030                  120   2e-27   
gb|KIM96067.1|  hypothetical protein OIDMADRAFT_106173                  120   2e-27   
ref|XP_004996916.1|  serine palmitoyltransferase                        117   2e-27   
ref|XP_004542426.1|  PREDICTED: serine palmitoyltransferase 2-like      119   2e-27   
ref|XP_007818657.1|  serine palmitoyltransferase 2                      120   2e-27   
gb|KFG82474.1|  serine palmitoyltransferase 2                           120   2e-27   
gb|AFW60622.1|  hypothetical protein ZEAMMB73_847772                    118   2e-27   
gb|KIE01591.1|  serine palmitoyltransferase 2                           120   2e-27   
gb|KID92620.1|  serine palmitoyltransferase 2                           120   2e-27   
gb|KIW64715.1|  hypothetical protein PV04_09630                         120   2e-27   
gb|ETP54420.1|  hypothetical protein F442_00861                         117   2e-27   
gb|ACI68064.1|  Serine palmitoyltransferase 2                           115   3e-27   
emb|CEP10201.1|  hypothetical protein                                   120   3e-27   
gb|EXV06139.1|  pyridoxal phosphate-dependent acyltransferase           119   3e-27   
emb|CDQ91783.1|  unnamed protein product                                115   3e-27   
ref|XP_003440868.1|  PREDICTED: serine palmitoyltransferase 2-like      118   3e-27   
ref|XP_009493313.1|  serine palmitoyltransferase                        119   3e-27   
ref|XP_008597095.1|  serine palmitoyltransferase                        119   3e-27   
ref|XP_005724923.1|  PREDICTED: serine palmitoyltransferase 2-like      118   3e-27   
ref|XP_011413414.1|  PREDICTED: serine palmitoyltransferase 2-like      118   3e-27   
gb|KIP10842.1|  hypothetical protein PHLGIDRAFT_28301                   119   3e-27   
emb|CBN76133.1|  Serine palmitoyltransferase                            117   3e-27   
ref|XP_003964289.1|  PREDICTED: serine palmitoyltransferase 3-like      118   4e-27   
gb|EKC29472.1|  Serine palmitoyltransferase 2                           118   4e-27   
ref|XP_007566208.1|  PREDICTED: serine palmitoyltransferase 2           118   4e-27   
ref|XP_010864813.1|  PREDICTED: serine palmitoyltransferase 3-like      116   4e-27   
ref|XP_010710079.1|  PREDICTED: serine palmitoyltransferase 2           117   4e-27   
gb|KIJ59898.1|  hypothetical protein HYDPIDRAFT_99833                   119   4e-27   
ref|XP_010728188.1|  PREDICTED: serine palmitoyltransferase 3           117   4e-27   
gb|KFQ47632.1|  Serine palmitoyltransferase 2                           117   4e-27   
gb|KFO80545.1|  Serine palmitoyltransferase 2                           117   4e-27   
ref|XP_002149297.1|  serine palmitoyltransferase 2, putative            119   5e-27   
gb|EOB05513.1|  Serine palmitoyltransferase 2                           117   5e-27   
ref|XP_006263848.1|  PREDICTED: serine palmitoyltransferase 2           118   5e-27   
ref|XP_005160430.1|  PREDICTED: serine palmitoyltransferase 3 iso...    117   5e-27   
ref|XP_005013979.1|  PREDICTED: serine palmitoyltransferase 2           117   5e-27   
ref|XP_010207762.1|  PREDICTED: serine palmitoyltransferase 3-like      115   5e-27   
gb|KFH71158.1|  serine palmitoyltransferase                             117   5e-27   
ref|XP_002115779.1|  hypothetical protein TRIADDRAFT_30228              117   5e-27   
gb|KIO02524.1|  hypothetical protein M404DRAFT_1002135                  119   5e-27   
ref|NP_001003562.1|  serine palmitoyltransferase 3                      117   5e-27   
ref|XP_006638784.1|  PREDICTED: serine palmitoyltransferase 3-like      117   6e-27   
ref|XP_005809327.1|  PREDICTED: serine palmitoyltransferase 2-like      117   6e-27   
ref|XP_009018805.1|  hypothetical protein HELRODRAFT_80970              117   6e-27   
ref|XP_002543814.1|  serine palmitoyltransferase 2                      117   6e-27   
ref|XP_007303814.1|  serine palmitoyltransferase 2                      118   6e-27   
emb|CDQ60494.1|  unnamed protein product                                116   6e-27   
ref|XP_005084054.1|  PREDICTED: serine palmitoyltransferase 2           117   7e-27   
ref|XP_008870566.1|  hypothetical protein H310_07061                    117   7e-27   
gb|KFA77487.1|  hypothetical protein S40288_04235                       118   8e-27   
gb|KEY64272.1|  hypothetical protein S7711_09311                        118   8e-27   
emb|CDQ72138.1|  unnamed protein product                                117   9e-27   
ref|XP_008890515.1|  hypothetical protein PPTG_00771                    116   9e-27   
ref|XP_010766367.1|  PREDICTED: serine palmitoyltransferase 2-like      114   9e-27   
ref|XP_008396458.1|  PREDICTED: serine palmitoyltransferase 2-like      117   9e-27   
gb|KFA61969.1|  hypothetical protein S40285_07791                       117   9e-27   
ref|XP_005301717.1|  PREDICTED: serine palmitoyltransferase 2 iso...    117   1e-26   
ref|XP_002938915.1|  PREDICTED: serine palmitoyltransferase 2           117   1e-26   
ref|XP_004687220.1|  PREDICTED: serine palmitoyltransferase 3           117   1e-26   
ref|XP_005301718.1|  PREDICTED: serine palmitoyltransferase 2 iso...    117   1e-26   
ref|XP_461423.2|  DEHA2F24926p                                          117   1e-26   
ref|XP_002492961.1|  Component of serine palmitoyltransferase           117   1e-26   
ref|XP_006116050.1|  PREDICTED: serine palmitoyltransferase 2           116   1e-26   
ref|XP_003707580.1|  PREDICTED: serine palmitoyltransferase 2-like      116   1e-26   
gb|KGL85016.1|  Serine palmitoyltransferase 3                           114   1e-26   
ref|XP_002734767.1|  PREDICTED: serine palmitoyltransferase 2-like      117   1e-26   
ref|XP_010876930.1|  PREDICTED: serine palmitoyltransferase 2           117   1e-26   
gb|KIX08542.1|  hypothetical protein Z518_03198                         117   1e-26   
emb|CCI48496.1|  unnamed protein product                                115   1e-26   
gb|KIK39668.1|  hypothetical protein CY34DRAFT_14231                    118   1e-26   
ref|NP_001018455.1|  serine palmitoyltransferase 2                      116   1e-26   
ref|XP_007845913.1|  serine palmitoyltransferase                        117   1e-26   
ref|NP_001108213.1|  serine palmitoyltransferase, long chain base...    116   1e-26   
ref|XP_003329469.1|  serine palmitoyltransferase                        117   2e-26   
ref|XP_010224270.1|  PREDICTED: serine palmitoyltransferase 3           114   2e-26   
ref|XP_010953685.1|  PREDICTED: serine palmitoyltransferase 3           115   2e-26   
gb|KFQ23936.1|  Serine palmitoyltransferase 2                           115   2e-26   
gb|KFQ44055.1|  Serine palmitoyltransferase 3                           115   2e-26   
gb|KIV92905.1|  hypothetical protein PV10_04164                         117   2e-26   
ref|XP_009572382.1|  PREDICTED: serine palmitoyltransferase 3-like      113   2e-26   
emb|CDS05437.1|  hypothetical protein LRAMOSA07965                      115   2e-26   
gb|EZA48985.1|  Serine palmitoyltransferase                             116   2e-26   
gb|KFV81686.1|  Serine palmitoyltransferase 2                           115   2e-26   
gb|KFV20190.1|  Serine palmitoyltransferase 2                           115   2e-26   
gb|KFO94414.1|  Serine palmitoyltransferase 2                           114   2e-26   
gb|KFO06395.1|  Serine palmitoyltransferase 2                           114   2e-26   
gb|KFM08539.1|  Serine palmitoyltransferase 2                           115   2e-26   
ref|XP_007068889.1|  PREDICTED: serine palmitoyltransferase 2           116   2e-26   
ref|XP_007546379.1|  PREDICTED: serine palmitoyltransferase 3           115   2e-26   
ref|XP_010076928.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    115   2e-26   
emb|CEJ92079.1|  Putative Serine palmitoyltransferase                   117   2e-26   
ref|XP_011279258.1|  PREDICTED: serine palmitoyltransferase 3           115   2e-26   
ref|XP_007086871.1|  PREDICTED: serine palmitoyltransferase 3           115   2e-26   
gb|KFP61278.1|  Serine palmitoyltransferase 2                           115   2e-26   
gb|KFV76893.1|  Serine palmitoyltransferase 2                           115   2e-26   
ref|XP_011347333.1|  PREDICTED: serine palmitoyltransferase 2           116   2e-26   
gb|EFX00517.1|  serine palmitoyltransferase                             116   3e-26   
ref|XP_011483116.1|  PREDICTED: serine palmitoyltransferase 3           116   3e-26   
ref|XP_006192728.1|  PREDICTED: serine palmitoyltransferase 3-like      113   3e-26   
gb|KFR08160.1|  Serine palmitoyltransferase 2                           114   3e-26   
ref|XP_008946762.1|  PREDICTED: serine palmitoyltransferase 3-like      112   3e-26   
gb|KFR00497.1|  Serine palmitoyltransferase 2                           114   3e-26   
gb|KGL88305.1|  Serine palmitoyltransferase 3                           115   3e-26   
gb|KFQ81547.1|  Serine palmitoyltransferase 2                           114   3e-26   
gb|KFW63917.1|  Serine palmitoyltransferase 2                           114   3e-26   
gb|EPE07331.1|  serine palmitoyltransferase 2                           116   3e-26   
ref|XP_002155095.2|  PREDICTED: serine palmitoyltransferase 2-like      115   3e-26   
ref|XP_005749399.1|  PREDICTED: serine palmitoyltransferase 3-lik...    115   3e-26   
ref|XP_007733188.1|  serine palmitoyltransferase                        116   3e-26   
gb|KIL86701.1|  hypothetical protein FAVG1_09957                        116   3e-26   
gb|KIJ37114.1|  hypothetical protein M422DRAFT_178526                   116   3e-26   
gb|KFP98454.1|  Serine palmitoyltransferase 2                           114   3e-26   
ref|XP_006807001.1|  PREDICTED: serine palmitoyltransferase 3-lik...    115   3e-26   
ref|XP_005147521.1|  PREDICTED: serine palmitoyltransferase 3           115   3e-26   
gb|KFW82728.1|  Serine palmitoyltransferase 2                           114   3e-26   
ref|XP_009907650.1|  PREDICTED: serine palmitoyltransferase 2           115   3e-26   
gb|KIJ26495.1|  hypothetical protein M422DRAFT_192164                   116   3e-26   
gb|KFQ76219.1|  Serine palmitoyltransferase 2                           114   3e-26   
gb|KIZ01369.1|  serine palmitoyltransferase                             115   3e-26   
gb|EMC83907.1|  Serine palmitoyltransferase 2                           115   4e-26   
gb|KFQ58645.1|  Serine palmitoyltransferase 2                           114   4e-26   
gb|KGL94958.1|  Serine palmitoyltransferase 2                           114   4e-26   
ref|XP_006807000.1|  PREDICTED: serine palmitoyltransferase 3-lik...    115   4e-26   
ref|XP_005936388.1|  PREDICTED: serine palmitoyltransferase 3-lik...    115   4e-26   
gb|ERE72836.1|  serine palmitoyltransferase 2                           114   4e-26   
ref|XP_009523452.1|  hypothetical protein PHYSODRAFT_559005             114   4e-26   
ref|XP_010880781.1|  PREDICTED: serine palmitoyltransferase 2-like      115   4e-26   
ref|XP_005749398.1|  PREDICTED: serine palmitoyltransferase 3-lik...    115   4e-26   
ref|XP_004559826.1|  PREDICTED: serine palmitoyltransferase 3-like      115   4e-26   
ref|XP_002931785.2|  PREDICTED: serine palmitoyltransferase 3 iso...    115   4e-26   
ref|XP_006217806.1|  PREDICTED: serine palmitoyltransferase 3-like      115   4e-26   
ref|XP_007004995.1|  hypothetical protein TREMEDRAFT_44257              116   4e-26   
ref|XP_006157148.1|  PREDICTED: serine palmitoyltransferase 2           115   5e-26   
gb|KFV97820.1|  Serine palmitoyltransferase 3                           114   5e-26   
ref|XP_005525490.1|  PREDICTED: serine palmitoyltransferase 3           115   5e-26   
gb|KFU86876.1|  Serine palmitoyltransferase 2                           114   5e-26   
gb|KFW08673.1|  Serine palmitoyltransferase 2                           114   5e-26   
ref|XP_002200055.2|  PREDICTED: serine palmitoyltransferase 2           114   5e-26   
ref|XP_008503410.1|  PREDICTED: LOW QUALITY PROTEIN: serine palmi...    114   5e-26   
gb|KIO02521.1|  hypothetical protein M404DRAFT_650431                   115   5e-26   
gb|ERE72837.1|  serine palmitoyltransferase 2                           114   5e-26   
gb|EMC81581.1|  Serine palmitoyltransferase 3                           114   5e-26   
ref|XP_010202174.1|  PREDICTED: serine palmitoyltransferase 2-like      110   5e-26   
ref|XP_003441227.1|  PREDICTED: serine palmitoyltransferase 3 iso...    114   6e-26   
ref|XP_006799478.1|  PREDICTED: serine palmitoyltransferase 2-like      114   6e-26   
gb|KFP60479.1|  Serine palmitoyltransferase 3                           114   6e-26   
ref|XP_002173515.1|  serine palmitoyltransferase Lcb2                   115   6e-26   
ref|XP_003655120.1|  hypothetical protein THITE_2118418                 115   6e-26   
ref|XP_005995089.1|  PREDICTED: serine palmitoyltransferase 3 iso...    114   6e-26   
ref|XP_009251517.1|  hypothetical protein FPSE_00122                    115   6e-26   
gb|KFP22377.1|  Serine palmitoyltransferase 2                           114   6e-26   
gb|KIJ16290.1|  hypothetical protein PAXINDRAFT_113325                  115   7e-26   
ref|XP_005995088.1|  PREDICTED: serine palmitoyltransferase 3 iso...    114   7e-26   
ref|XP_005936386.1|  PREDICTED: serine palmitoyltransferase 3-lik...    114   7e-26   
ref|XP_009814001.1|  PREDICTED: serine palmitoyltransferase 3-like      111   7e-26   
ref|NP_001089928.1|  serine palmitoyltransferase, long chain base...    114   7e-26   
ref|XP_001713103.1|  serine palmitoyltransferase Lcb2 (predicted)       115   7e-26   
ref|XP_010953683.1|  PREDICTED: serine palmitoyltransferase 3-like      112   7e-26   
gb|KFZ57710.1|  Serine palmitoyltransferase 3                           111   7e-26   
ref|XP_006036854.1|  PREDICTED: serine palmitoyltransferase 3           114   7e-26   
ref|XP_005343462.1|  PREDICTED: serine palmitoyltransferase 2           114   7e-26   
gb|KFW88475.1|  Serine palmitoyltransferase 3                           111   7e-26   



>ref|XP_009611514.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
tomentosiformis]
Length=489

 Score =   289 bits (739),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVDGGT S+HTE+
Sbjct  121  TPRVIESLKKFSASTCSSRVDGGTTSIHTEL  151



>ref|XP_009761445.1| PREDICTED: long chain base biosynthesis protein 2a [Nicotiana 
sylvestris]
Length=489

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYC
Sbjct  61   HRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS RVDGGT S+HTE+
Sbjct  121  TPRVIESLKKFSASTCSARVDGGTTSIHTEL  151



>ref|XP_006347368.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006347369.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Solanum tuberosum]
Length=489

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TAL+T+FSY LLFAFGQFRDFFRKIFDW ++SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWNASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTL RTTK+++CLNLGSYNYLGF ASDEYC
Sbjct  61   LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLNRTTKVSRCLNLGSYNYLGFGASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFS STCSTRVDGGT +LH+E+
Sbjct  121  TPRVIESLKRFSASTCSTRVDGGTTTLHSEL  151



>ref|XP_004516386.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cicer 
arietinum]
Length=489

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT K+++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERSSNDNNKTLKRTNKVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVID+LK++SPSTCSTRVDGGT +LH E+
Sbjct  121  TPRVIDTLKKYSPSTCSTRVDGGTTALHNEL  151



>gb|KEH25646.1| long chain base biosynthesis 2a-like protein [Medicago truncatula]
Length=490

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT+K+++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSAPDAWFDVVERYSNDNNKTLKRTSKVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVID+LK++SPSTCSTRVDGGT +LH E+
Sbjct  121  TPRVIDTLKKYSPSTCSTRVDGGTTALHNEL  151



>dbj|BAG68298.1| serine palmitoyltransferase [Nicotiana benthamiana]
Length=489

 Score =   284 bits (726),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYC
Sbjct  61   HRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS RVDGGT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSARVDGGTTSIHMEL  151



>ref|XP_004241473.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=489

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TAL+T+FSY LLFAFGQFRDFFRKIFDW ++SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MINIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWNASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTL RTTK+++CLNLGSYNYLGFA+SDEYC
Sbjct  61   LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLNRTTKVSRCLNLGSYNYLGFASSDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK FS STCSTRVDGGT +LH+E+
Sbjct  121  TPRVIESLKTFSASTCSTRVDGGTTTLHSEL  151



>dbj|BAC55228.1| serine palmitoyltransferase [Lotus japonicus]
Length=489

 Score =   283 bits (723),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT K+++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTDKLSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSLK++SPSTCS RVDGGT  LH E+
Sbjct  121  TPRVIDSLKKYSPSTCSARVDGGTTDLHNEL  151



>dbj|BAE96963.1| serine palmitpoyltransferase subunit2 [Nicotiana tabacum]
 gb|ABW97709.1| serine palmitoyltransferase long chain base subunit [Nicotiana 
benthamiana]
Length=489

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW    NLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWRPRNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYC
Sbjct  61   HRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS RVDGGT S+HTE+
Sbjct  121  TPRVIESLKKFSASTCSARVDGGTTSIHTEL  151



>ref|XP_004235384.1| PREDICTED: long chain base biosynthesis protein 2b [Solanum lycopersicum]
Length=489

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFR+FFRKIFDW   SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFREFFRKIFDWWRGSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTT++++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTQVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGGT S+H E+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGTTSIHMEL  151



>ref|XP_002284409.1| PREDICTED: long chain base biosynthesis protein 2a [Vitis vinifera]
Length=489

 Score =   282 bits (721),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT FSY LLFAFGQFRDFFRKIFDW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTLFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRTTKI+KCLNLGSYNYLGFAASDE+C
Sbjct  61   LRIQDCFGRPISSAPDAWFDVVERFSNDNNKTLKRTTKISKCLNLGSYNYLGFAASDEFC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFSP TCSTRVDGGT +LH E+
Sbjct  121  TPRVIESLKRFSPGTCSTRVDGGTTTLHKEV  151



>emb|CBI15735.3| unnamed protein product [Vitis vinifera]
Length=513

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT FSY LLFAFGQFRDFFRKIFDW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTLFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRTTKI+KCLNLGSYNYLGFAASDE+C
Sbjct  61   LRIQDCFGRPISSAPDAWFDVVERFSNDNNKTLKRTTKISKCLNLGSYNYLGFAASDEFC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFSP TCSTRVDGGT +LH E+
Sbjct  121  TPRVIESLKRFSPGTCSTRVDGGTTTLHKEV  151



>emb|CAB44316.1| serine palmitoyltransferase [Solanum tuberosum]
Length=489

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFR+FFRKIFDW   +NLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFREFFRKIFDWWRGNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPICSPPDAWFDVVER+SNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPICSPPDAWFDVVERLSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGGT S+H E+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGTTSIHMEL  151



>ref|XP_006364387.1| PREDICTED: long chain base biosynthesis protein 2b-like [Solanum 
tuberosum]
Length=489

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFR+FFRKIFDW   +NLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFREFFRKIFDWWRGNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPICSPPDAWFDVVER+SNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPICSPPDAWFDVVERLSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGGT S+H E+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGTTSIHMEL  151



>ref|XP_003518128.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=489

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC ++NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERHSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV+D+LK++SPSTCSTRVDGGT  LH E+
Sbjct  121  TPRVVDTLKKYSPSTCSTRVDGGTTVLHLEL  151



>gb|KHN00617.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=505

 Score =   280 bits (717),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC ++NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERHSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV+D+LK++SPSTCSTRVDGGT  LH E+
Sbjct  121  TPRVVDTLKKYSPSTCSTRVDGGTTVLHLEL  151



>ref|XP_003548027.1| PREDICTED: long chain base biosynthesis protein 2a-like [Glycine 
max]
Length=490

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC ++ LQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANTLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV+D+LK++SPSTCSTRVDGGT +LH E+
Sbjct  121  TPRVVDTLKKYSPSTCSTRVDGGTTALHLEL  151



>gb|KHN13380.1| Serine palmitoyltransferase 2 [Glycine soja]
Length=490

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC ++ LQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSANTLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV+D+LK++SPSTCSTRVDGGT +LH E+
Sbjct  121  TPRVVDTLKKYSPSTCSTRVDGGTTALHLEL  151



>gb|ABV57769.1| serine C-palmitoyltransferase [Gossypium hirsutum]
Length=292

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW H+SNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLEGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD WFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGF A+DEYC
Sbjct  61   LRIQDCFGRPIASAPDGWFDVVERYSNDNNKTLKRTDKISRCLNLGSYNYLGFTAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSL RFS STCSTRV+GGT +LH E+
Sbjct  121  TPRVIDSLCRFSASTCSTRVEGGTTTLHKEL  151



>gb|KHG30176.1| Serine palmitoyltransferase 2 [Gossypium arboreum]
Length=496

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW H+SNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLEGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSL RFS STCSTRV+GGT +LH E+
Sbjct  121  TPRVIDSLCRFSASTCSTRVEGGTTTLHKEL  151



>ref|XP_002512864.1| serine palmitoyltransferase, putative [Ricinus communis]
 gb|EEF49367.1| serine palmitoyltransferase, putative [Ricinus communis]
Length=488

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKIFDWC S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQIRDFFRKIFDWCKSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKR+T +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERFSNDNNKTLKRSTNMSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++SPSTCS+RV+GGT +LH E+
Sbjct  121  TPRVIESLKKYSPSTCSSRVEGGTTALHNEL  151



>ref|XP_008464380.1| PREDICTED: long chain base biosynthesis protein 2a [Cucumis melo]
Length=490

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW +SSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTLKRTT +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLKRTTNVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFSPSTCS RVDGGT SLH E+
Sbjct  121  TPRVIESLKRFSPSTCSARVDGGTTSLHEEL  151



>ref|XP_004138028.1| PREDICTED: long chain base biosynthesis protein 2a-like [Cucumis 
sativus]
 gb|KGN63448.1| hypothetical protein Csa_1G000720 [Cucumis sativus]
Length=490

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW +SSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTLKRTT +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLKRTTNVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFSPSTCS RVDGGT SLH E+
Sbjct  121  TPRVIESLKRFSPSTCSARVDGGTTSLHKEL  151



>ref|XP_004161364.1| PREDICTED: LOW QUALITY PROTEIN: long chain base biosynthesis 
protein 2a-like [Cucumis sativus]
Length=490

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW +SSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWNSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTLKRTT +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLKRTTNVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFSPSTCS RVDGGT SLH E+
Sbjct  121  TPRVIESLKRFSPSTCSARVDGGTTSLHKEL  151



>ref|XP_010036863.1| PREDICTED: long chain base biosynthesis protein 2a [Eucalyptus 
grandis]
 gb|KCW48524.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=489

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TAL+T+FSY LLFAFGQFRDFFRKIFDW  S +LQGYAPICLGLEDFYTRRLY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWRSGDLQGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S P+AWFDVVER SNDNNKTLKRTTK+++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSAPNAWFDVVERYSNDNNKTLKRTTKVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LK+FSPSTCS+RVDGGT +LH E+
Sbjct  121  TPRVIETLKKFSPSTCSSRVDGGTTTLHNEL  151



>ref|XP_007038096.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY22597.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=489

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW H+SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLQGYAPICLGLEDFYFRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAWFDVVER SNDNNKT+KRT KI +CLNLGSYNYLGFAASDEYC
Sbjct  61   HRIQDCFGRPISSAPDAWFDVVERYSNDNNKTMKRTDKINRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSL RFS STCSTRVDGGT ++H E+
Sbjct  121  TPRVIDSLNRFSASTCSTRVDGGTTTVHKEL  151



>gb|EYU24476.1| hypothetical protein MIMGU_mgv1a004686mg [Erythranthe guttata]
Length=515

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = +2

Query  158  PPCRLIRSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPI  337
            PP +   + +  KMI IPY TALTT+FSY LLFAFGQ RDFFRKIFDW   S LQGYAPI
Sbjct  14   PPDQNAAAAVIIKMITIPYVTALTTYFSYGLLFAFGQLRDFFRKIFDWWSKSTLQGYAPI  73

Query  338  CLGLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGS  517
            CLGLEDFY RRLYLRIQDCF RPI S PDAWFDVVERVSNDNNKTL RTTK+ +CLNLGS
Sbjct  74   CLGLEDFYIRRLYLRIQDCFNRPISSSPDAWFDVVERVSNDNNKTLLRTTKVNRCLNLGS  133

Query  518  YNYLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YNYLGFAA+DEYCTPRVI+SLK+FSPSTCSTRVDGGT +LH E+
Sbjct  134  YNYLGFAAADEYCTPRVIESLKKFSPSTCSTRVDGGTTTLHAEL  177



>emb|CDO98665.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQFRDFFRKI DW   SNLQGYAPICLGLEDFYTRRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFVFGQFRDFFRKIVDWWLGSNLQGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI SPPD+W D+VERVS DNNKTL+RT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASPPDSWVDLVERVSKDNNKTLQRTAKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLKRFSPSTCSTRVDGGT +LH E+
Sbjct  121  TPRVIESLKRFSPSTCSTRVDGGTTTLHNEL  151



>ref|XP_007038095.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY22596.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=512

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDW H+SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWWHASNLQGYAPICLGLEDFYFRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAWFDVVER SNDNNKT+KRT KI +CLNLGSYNYLGFAASDEYC
Sbjct  61   HRIQDCFGRPISSAPDAWFDVVERYSNDNNKTMKRTDKINRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSL RFS STCSTRVDGGT ++H E+
Sbjct  121  TPRVIDSLNRFSASTCSTRVDGGTTTVHKEL  151



>ref|XP_011042943.1| PREDICTED: long chain base biosynthesis protein 2a [Populus euphratica]
Length=489

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI+IPY TAL+T+FSY LLFAFGQFRDFFRKIFD  HSSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIKIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDSWHSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S P AWFDVVER SNDNNKTLKRTTK+T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSSPGAWFDVVERYSNDNNKTLKRTTKVTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LKRFSPSTCS RVDGGT  LH E+
Sbjct  121  TPRVIETLKRFSPSTCSPRVDGGTTILHNEL  151



>ref|XP_002318160.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEE96380.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI+IPY TAL+T+FSY LLFAFGQFRDFFRKIFD  HSSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIKIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDSWHSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S P AWFDVVER SNDNNKTLKRTTK+T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSSPGAWFDVVERYSNDNNKTLKRTTKVTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LKRFSPSTCS RVDGGT  LH E+
Sbjct  121  TPRVIETLKRFSPSTCSPRVDGGTTILHNEL  151



>ref|XP_007151745.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
 gb|ESW23739.1| hypothetical protein PHAVU_004G071100g [Phaseolus vulgaris]
Length=487

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKIFDWC S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQFRDFFRKIFDWCSSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND+NKTL RT K+++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERFSNDSNKTLTRTDKLSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV+++LK++SPSTCS+RVDGGT  LH E+
Sbjct  121  TPRVVETLKKYSPSTCSSRVDGGTTELHNEL  151



>gb|KCW48525.1| hypothetical protein EUGRSUZ_K02201 [Eucalyptus grandis]
Length=501

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TAL+T+FSY LLFAFGQFRDFFRKIFDW  S +LQGYAPICLGLEDFYTRRLY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQFRDFFRKIFDWWRSGDLQGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S P+AWFDVVER SNDNNKTLKRTTK+++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSAPNAWFDVVERYSNDNNKTLKRTTKVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LK+FSPSTCS+RVDGGT +LH E+
Sbjct  121  TPRVIETLKKFSPSTCSSRVDGGTTTLHNEL  151



>gb|KJB51269.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=478

 Score =   274 bits (701),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFR IFDW H+SNL+GYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRNIFDWWHASNLEGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSL RFS STCSTRV+GGT +LH E+
Sbjct  121  TPRVIDSLCRFSASTCSTRVEGGTTTLHKEL  151



>gb|KJB51268.1| hypothetical protein B456_008G209600 [Gossypium raimondii]
Length=496

 Score =   274 bits (701),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFR IFDW H+SNL+GYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRNIFDWWHASNLEGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT KI++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTDKISRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSL RFS STCSTRV+GGT +LH E+
Sbjct  121  TPRVIDSLCRFSASTCSTRVEGGTTTLHKEL  151



>ref|XP_011083372.1| PREDICTED: long chain base biosynthesis protein 2a [Sesamum indicum]
Length=489

 Score =   274 bits (700),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKI DW   SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKILDWWSKSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER+SNDNNKTLKRTT++T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFNRPISSSPDAWFDVVERISNDNNKTLKRTTRVTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+F PSTCSTRVDGGT +LH E+
Sbjct  121  TPRVIESLKQFYPSTCSTRVDGGTTTLHAEL  151



>ref|XP_008239635.1| PREDICTED: long chain base biosynthesis protein 2a [Prunus mume]
Length=464

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TAL+T+FSY LLFAFGQ RDFFRKI DW  S +LQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQLRDFFRKIIDWWQSGDLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAWFDVVER SNDNNKTLKRTTKI++CLNLGSYNYLGFAASDEYC
Sbjct  61   NRIQDCFGRPISSAPDAWFDVVERYSNDNNKTLKRTTKISRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I+SLK+FSPSTCS+RVDGGT +LH E+
Sbjct  121  TPRAIESLKKFSPSTCSSRVDGGTTTLHKEL  151



>ref|XP_007209963.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
 gb|EMJ11162.1| hypothetical protein PRUPE_ppa004890mg [Prunus persica]
Length=487

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TAL+T+FSY LLFAFGQ RDFFRKI DW  S +LQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALSTYFSYGLLFAFGQLRDFFRKIIDWWQSGDLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAWFDVVER SNDNNKTLKRTTKI++CLNLGSYNYLGFAASDEYC
Sbjct  61   NRIQDCFGRPISSAPDAWFDVVERYSNDNNKTLKRTTKISRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I+SLK+FSPSTCS+RVDGGT +LH E+
Sbjct  121  TPRAIESLKKFSPSTCSSRVDGGTTTLHKEL  151



>ref|XP_006446964.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 ref|XP_006468873.1| PREDICTED: long chain base biosynthesis protein 2a-like [Citrus 
sinensis]
 gb|ESR60204.1| hypothetical protein CICLE_v10017847mg [Citrus clementina]
 gb|KDO47368.1| hypothetical protein CISIN_1g046230mg [Citrus sinensis]
Length=489

 Score =   269 bits (688),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQ RDFFRKI DW  ++NLQGYAPICLGLEDFY RRLY
Sbjct  1    MISIPYLTALTTYFSYGLLFVFGQIRDFFRKIIDWWSANNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND+NKTLKRT K+ +CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPISSAPDAWFDVVERFSNDSNKTLKRTNKVNRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++SPSTCS+RVDGGTL +H E+
Sbjct  121  TPRVIESLKKYSPSTCSSRVDGGTLMVHNEL  151



>ref|XP_006468870.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Citrus sinensis]
 ref|XP_006468871.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Citrus sinensis]
 ref|XP_006468872.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Citrus sinensis]
Length=488

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPYFTALTT+FSY LLF FGQFRDFFRKI DW  + NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYFTALTTYFSYGLLFVFGQFRDFFRKILDWWSTDNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             R+QDCFGRP+ S PDAWFDVVER SNDNNKTLKRT  +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   NRVQDCFGRPLSSAPDAWFDVVERYSNDNNKTLKRTNNVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSLK++S STCS+RVDGGTL+LH E+
Sbjct  121  TPRVIDSLKKYSHSTCSSRVDGGTLALHNEL  151



>gb|KDO47369.1| hypothetical protein CISIN_1g040324mg [Citrus sinensis]
Length=488

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPYFTALTT+FSY LLF FGQFRDFFRKI DW  + NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYFTALTTYFSYGLLFVFGQFRDFFRKILDWWSTDNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             R+QDCFGRP+ S PDAWFDVVER SNDNNKTLKRT  +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   NRVQDCFGRPLSSAPDAWFDVVERYSNDNNKTLKRTNNVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSLK++S STCS+RVDGGTL+LH E+
Sbjct  121  TPRVIDSLKKYSHSTCSSRVDGGTLALHNEL  151



>ref|XP_006446965.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
 gb|ESR60205.1| hypothetical protein CICLE_v10015046mg [Citrus clementina]
Length=488

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPYFTALTT+FSY LLF FGQFRDFFRKI DW  + NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYFTALTTYFSYGLLFVFGQFRDFFRKILDWWSTDNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             R+QDCFGRP+ S PDAWFDVVER SNDNNKTLKRT  +++CLNLGSYNYLGFAA+DEYC
Sbjct  61   NRVQDCFGRPLSSAPDAWFDVVERYSNDNNKTLKRTNNVSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSLK++S STCS+RVDGGTL+LH E+
Sbjct  121  TPRVIDSLKKYSHSTCSSRVDGGTLALHNEL  151



>ref|XP_011073130.1| PREDICTED: long chain base biosynthesis protein 2b isoform X3 
[Sesamum indicum]
Length=489

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKIFDW   ++L+GYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWSHNSLEGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPICS PDAWFDVVER+SND NKTLKRTT++ +CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFNRPICSSPDAWFDVVERISNDYNKTLKRTTRVDRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCSTRVDGGT +LH E+
Sbjct  121  TPRVIESLKKFSASTCSTRVDGGTTTLHAEL  151



>ref|XP_011073128.1| PREDICTED: long chain base biosynthesis protein 2b isoform X1 
[Sesamum indicum]
Length=520

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKIFDW   ++L+GYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWSHNSLEGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPICS PDAWFDVVER+SND NKTLKRTT++ +CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFNRPICSSPDAWFDVVERISNDYNKTLKRTTRVDRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCSTRVDGGT +LH E+
Sbjct  121  TPRVIESLKKFSASTCSTRVDGGTTTLHAEL  151



>ref|XP_010929641.1| PREDICTED: long chain base biosynthesis protein 2a-like [Elaeis 
guineensis]
Length=487

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  S NL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWPKSKNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAW DVVER SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWIDVVERYSNDNNKTLLRTSNTTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++SPSTCS RVDGGT  LHTE+
Sbjct  121  TPRVIESLKKYSPSTCSVRVDGGTTKLHTEL  151



>ref|XP_010907607.1| PREDICTED: long chain base biosynthesis protein 2a [Elaeis guineensis]
Length=487

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  S +L+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWSKSKDLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAW DVVER SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWIDVVERYSNDNNKTLHRTSNTTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++SPSTCS RVDGGT  LHTE+
Sbjct  121  TPRVIESLKKYSPSTCSVRVDGGTTKLHTEL  151



>gb|KDP41837.1| hypothetical protein JCGZ_26855 [Jatropha curcas]
Length=489

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKI DW  S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQIRDFFRKIIDWWSSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTL RT+ + +CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLIRTSNVKRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++SPSTCS+RVD GT +LH E+
Sbjct  121  TPRVIESLKKYSPSTCSSRVDAGTTALHNEL  151



>emb|CAP16702.1| putative serine palmitoyltransferase subunit LCB2, partial [Nicotiana 
benthamiana]
Length=356

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  230  TFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQDCFGRPI  409
            T+FSY LLFAFGQFRDFFRKIFDW  +SNLQGYAPICLGLEDFY RRLY RIQDCFGRPI
Sbjct  1    TYFSYGLLFAFGQFRDFFRKIFDWWKASNLQGYAPICLGLEDFYIRRLYHRIQDCFGRPI  60

Query  410  CSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVIDSLKRF  589
            CSPPDAWFDVVERVSNDNNKTLKRTTK+++CLNLGSYNYLGFAASDEYCTPRVI+SLK+F
Sbjct  61   CSPPDAWFDVVERVSNDNNKTLKRTTKVSRCLNLGSYNYLGFAASDEYCTPRVIESLKKF  120

Query  590  SPSTCSTRVDGGTLSLHTEI  649
            S STCS  VDGGT S+H E+
Sbjct  121  SASTCSACVDGGTTSIHMEL  140



>ref|XP_002275468.1| PREDICTED: long chain base biosynthesis protein 2a isoform X2 
[Vitis vinifera]
 emb|CBI21293.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI +PY TALTT+FSY LLF FGQ RD FRKI DW  S+NLQGYAPICLG EDFY RRLY
Sbjct  1    MIAVPYVTALTTYFSYGLLFVFGQIRDLFRKILDWFRSNNLQGYAPICLGFEDFYKRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAW DV+ER SNDNNKTLKRT+ I++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPISSAPDAWLDVIERNSNDNNKTLKRTSNISRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FSPSTCS+R DGGT+ +H E+
Sbjct  121  TPRVIESLKKFSPSTCSSRADGGTIMMHNEL  151



>ref|XP_007031987.1| Long chain base2 isoform 1 [Theobroma cacao]
 gb|EOY02913.1| Long chain base2 isoform 1 [Theobroma cacao]
Length=489

 Score =   265 bits (676),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWC-HSSNLQGYAPICLGLEDFYTRRL  373
            MI IPY TALTT+FSY LLF+FGQ RDFFRK  DWC  S+NLQGYAPICLGLEDFY RRL
Sbjct  1    MIAIPYLTALTTYFSYGLLFSFGQIRDFFRKFIDWCCTSNNLQGYAPICLGLEDFYIRRL  60

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
            YLRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT  +++CLNLGSYNYLGFAA+DEY
Sbjct  61   YLRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTANMSRCLNLGSYNYLGFAAADEY  120

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            CTPR I+SL RFSPSTCS+RVDGGT  LH E+
Sbjct  121  CTPRAIESLNRFSPSTCSSRVDGGTTILHNEL  152



>gb|EPS63051.1| serine palmitoyltransferase, partial [Genlisea aurea]
Length=326

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M  IPY  ALTT+FSY LLFAFGQ RDFFR+IFDW   S LQGYAPICLGLEDFY RRLY
Sbjct  1    MTTIPYIAALTTYFSYGLLFAFGQLRDFFRRIFDWWSQSRLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI SPPDAWFDVVER SNDNNKTL RT ++ +CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFNRPISSPPDAWFDVVERFSNDNNKTLMRTERVNRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++L +F+PSTCS+RVDGGT SLH E+
Sbjct  121  TPRVIETLMKFTPSTCSSRVDGGTTSLHAEL  151



>ref|XP_010093950.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB54913.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=530

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 138/167 (83%), Gaps = 16/167 (10%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQFRDFFRKI DW +SSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQFRDFFRKIIDWWNSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLK----------------RTTKITKCLN  508
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTLK                RT+K ++CLN
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKVFGVLWITLIKCLLCRRTSKKSRCLN  120

Query  509  LGSYNYLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            LGSYNYLGFAASDEYCTPRVI+SLKRFSPSTCSTRVDGG  ++H E+
Sbjct  121  LGSYNYLGFAASDEYCTPRVIESLKRFSPSTCSTRVDGGNTTIHKEL  167



>ref|XP_008775142.1| PREDICTED: long chain base biosynthesis protein 2a [Phoenix dactylifera]
Length=487

 Score =   264 bits (674),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  S +L+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWTKSKDLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLHRTSNTTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VI+SL+++SP TCS RVDGGT  LHTE+
Sbjct  121  TPHVIESLRKYSPGTCSVRVDGGTTKLHTEL  151



>emb|CDM85908.1| unnamed protein product [Triticum aestivum]
Length=757

 Score =   269 bits (688),  Expect = 2e-81, Method: Composition-based stats.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFG FRDFFR+I D   SSNL+GYAPICLG EDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGHFRDFFRRILDAGKSSNLKGYAPICLGYEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL+RTTK +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERHSNDGNKTLQRTTKTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGNTKLHTEL  151



>ref|NP_001151995.1| LOC100285632 [Zea mays]
 gb|ACG45307.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN25731.1| unknown [Zea mays]
 gb|AFW60856.1| Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFVDWFKAKNVKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD+WFDVVER SNDNNKTL+RT+  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDSWFDVVERTSNDNNKTLQRTSNTTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVIDSLK++S STCS RVDGGT  LHTE+
Sbjct  121  TPRVIDSLKKYSASTCSVRVDGGTTKLHTEL  151



>ref|XP_009403784.1| PREDICTED: long chain base biosynthesis protein 2a [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSS--NLQGYAPICLGLEDFYTRR  370
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  S   +L+GYAPICLGLEDFYTRR
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWSRSKSKDLKGYAPICLGLEDFYTRR  60

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLRIQDCF RPI S PDAW DVVER SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DE
Sbjct  61   LYLRIQDCFSRPIASAPDAWIDVVERYSNDNNKTLHRTSNTTKCLNLGSYNYLGFAAADE  120

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YCTPRVIDSLKR+SPSTCS RVDGGT +LHTE+
Sbjct  121  YCTPRVIDSLKRYSPSTCSVRVDGGTTNLHTEL  153



>ref|XP_011002110.1| PREDICTED: long chain base biosynthesis protein 2a-like [Populus 
euphratica]
Length=489

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI+IPY TAL T+FSY LLF FG FRDFFRKI    HSSNLQGYAPICLG EDFY RRLY
Sbjct  1    MIKIPYLTALNTYFSYGLLFVFGHFRDFFRKILGCFHSSNLQGYAPICLGPEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD WFDVV+R SNDNNKTL+RT+K+T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSAPDVWFDVVQRFSNDNNKTLRRTSKVTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LKRFSPSTCS RVDGGT +LH E+
Sbjct  121  TPRVIETLKRFSPSTCSPRVDGGTTTLHNEL  151



>ref|NP_001045279.1| Os01g0928800 [Oryza sativa Japonica Group]
 sp|Q5JK39.1|LCB2D_ORYSJ RecName: Full=Long chain base biosynthesis protein 2d [Oryza 
sativa Japonica Group]
 dbj|BAD88168.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07193.1| Os01g0928800 [Oryza sativa Japonica Group]
 dbj|BAH00095.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72091.1| hypothetical protein OsI_05038 [Oryza sativa Indica Group]
 gb|EEE55940.1| hypothetical protein OsJ_04635 [Oryza sativa Japonica Group]
Length=489

 Score =   262 bits (669),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFR+I D   SSNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDAGKSSNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND+NKTL RTTK +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDSNKTLHRTTKTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LH E+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGNTKLHVEL  151



>gb|EMT23338.1| Serine palmitoyltransferase 2 [Aegilops tauschii]
Length=489

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFG FRDFFR+I D   SSNL+GYAPICLG EDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGHFRDFFRRILDAGKSSNLKGYAPICLGYEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL+RTTK +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERHSNDGNKTLQRTTKTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGNTKLHTEL  151



>ref|XP_008778939.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=554

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  S +L+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKLIDWTKSKDLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLHRTSNTTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VI+SL+++SP TCS RVDGGT  LHTE+
Sbjct  121  TPHVIESLRKYSPGTCSVRVDGGTTKLHTEL  151



>ref|XP_002321740.1| serine palmitoyltransferase family protein [Populus trichocarpa]
 gb|EEF05867.1| serine palmitoyltransferase family protein [Populus trichocarpa]
Length=489

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI+IPY TAL+T+FSY LLF FG FRDFFRKI D  H SNLQGYAPICLG EDFY RRL+
Sbjct  1    MIKIPYLTALSTYFSYGLLFVFGHFRDFFRKILDCFHPSNLQGYAPICLGPEDFYIRRLF  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD WFDVV+R SNDNNKTL+RT+K+T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPISSAPDVWFDVVQRFSNDNNKTLRRTSKVTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LKRFSPSTCS RVDGGT +LH E+
Sbjct  121  TPRVIETLKRFSPSTCSPRVDGGTTTLHNEL  151



>gb|AFW84059.1| putative serine palmitoyltransferase [Zea mays]
Length=335

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFR+I D    SNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL RTT  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLHRTTATTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGNTKLHTEL  151



>ref|NP_001067972.1| Os11g0516000 [Oryza sativa Japonica Group]
 sp|Q2R3K3.1|LCB2A_ORYSJ RecName: Full=Long chain base biosynthesis protein 2a [Oryza 
sativa Japonica Group]
 gb|ABA93932.1| Serine palmitoyltransferase 2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28335.1| Os11g0516000 [Oryza sativa Japonica Group]
 gb|EEC68247.1| hypothetical protein OsI_36267 [Oryza sativa Indica Group]
Length=488

 Score =   260 bits (665),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  + N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLIDWFKAKNVKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND+NKTLKRT+  T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDSNKTLKRTSNTTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VI+SLK++SPSTCS RVDGGT  LHTE+
Sbjct  121  TPLVIESLKKYSPSTCSVRVDGGTTKLHTEL  151



>gb|EMS48138.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=508

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFG FRDFFR+I D   SSNL+GYAPICLG EDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGHFRDFFRRILDAGKSSNLKGYAPICLGYEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL+RTTK +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERHSNDGNKTLQRTTKTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGNTKLHTEL  151



>ref|XP_010660694.1| PREDICTED: long chain base biosynthesis protein 2a isoform X1 
[Vitis vinifera]
Length=490

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ-GYAPICLGLEDFYTRRL  373
            MI +PY TALTT+FSY LLF FGQ RD FRKI DW  S+NLQ GYAPICLG EDFY RRL
Sbjct  1    MIAVPYVTALTTYFSYGLLFVFGQIRDLFRKILDWFRSNNLQQGYAPICLGFEDFYKRRL  60

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
            YLRIQDCFGRPI S PDAW DV+ER SNDNNKTLKRT+ I++CLNLGSYNYLGFAASDEY
Sbjct  61   YLRIQDCFGRPISSAPDAWLDVIERNSNDNNKTLKRTSNISRCLNLGSYNYLGFAASDEY  120

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            CTPRVI+SLK+FSPSTCS+R DGGT+ +H E+
Sbjct  121  CTPRVIESLKKFSPSTCSSRADGGTIMMHNEL  152



>ref|XP_004979342.1| PREDICTED: long chain base biosynthesis protein 2a-like [Setaria 
italica]
Length=488

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  + N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLVDWFKAKNVKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD+WFDVVER SNDNNKTL+RT+  T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDSWFDVVERTSNDNNKTLQRTSNTTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI SLK++S STCS RVDGGT  LHTE+
Sbjct  121  TPRVIQSLKKYSASTCSVRVDGGTTKLHTEL  151



>ref|XP_008791061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Phoenix 
dactylifera]
Length=487

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RD FRK+ D   S NL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDLFRKLIDRSKSKNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SNDNNKTL RT+  +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLLRTSNTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VI+SLK++SPSTCS RVDGGT  LHTE+
Sbjct  121  TPHVIESLKKYSPSTCSVRVDGGTTKLHTEL  151



>ref|XP_009378026.1| PREDICTED: long chain base biosynthesis protein 2a [Pyrus x bretschneideri]
Length=490

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQ RDFFRKI DW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKIIDWWSASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER SND NKTLK T K ++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFNRPIASAPDAWFDVVERYSNDYNKTLKLTKKTSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I++LK++SPSTCS+RVDGGT +LH E+
Sbjct  121  TPRAIETLKKYSPSTCSSRVDGGTTNLHNEL  151



>ref|XP_010678318.1| PREDICTED: long chain base biosynthesis protein 2a [Beta vulgaris 
subsp. vulgaris]
Length=489

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKIFDW  S +LQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWTSGSLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFD+VER SND+NKTLKRT K+ +CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFERPIASAPDAWFDMVERYSNDHNKTLKRTDKVKRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK FS STCS RVDGGT  LH+E+
Sbjct  121  TPRVIESLKLFSASTCSPRVDGGTTILHSEL  151



>ref|XP_007215280.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
 gb|EMJ16479.1| hypothetical protein PRUPE_ppa004859mg [Prunus persica]
Length=488

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQ RDFFRK  DW  SSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKFIDWWSSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER SND NKTLK TTK ++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFNRPIASAPDAWFDVVERFSNDYNKTLKLTTKTSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I +LK++SPSTCS+RVDGGT  LH E+
Sbjct  121  TPRAIQTLKKYSPSTCSSRVDGGTTVLHNEL  151



>ref|XP_008379061.1| PREDICTED: long chain base biosynthesis protein 2a-like [Malus 
domestica]
Length=490

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQ RDFFRKI DW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKIIDWWSASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER SND NKTLK T K ++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFNRPIASAPDAWFDVVERYSNDYNKTLKLTKKTSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I++LK++SPSTCS+RVDGGT  LH E+
Sbjct  121  TPRAIETLKKYSPSTCSSRVDGGTTDLHNEL  151



>ref|XP_008341247.1| PREDICTED: long chain base biosynthesis protein 2a [Malus domestica]
Length=490

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQ RDFFRKI DW  +SNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDFFRKIIDWWSASNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER SND NKTLK T K ++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFNRPIASAPDAWFDVVERYSNDYNKTLKLTKKTSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I++LK++SPSTCS+RVDGGT  LH E+
Sbjct  121  TPRAIETLKKYSPSTCSSRVDGGTTDLHNEL  151



>ref|XP_009421040.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=488

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSS--NLQGYAPICLGLEDFYTRR  370
            M+ +PY TALTT FSY LLFAFGQ RDFFR++ DW  S   +L+GYAPICLGLEDFYTRR
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQMRDFFRRLIDWSKSKSKDLKGYAPICLGLEDFYTRR  60

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLRIQDCF RPI S PDAWFDVV+R SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DE
Sbjct  61   LYLRIQDCFSRPIASAPDAWFDVVDRYSNDNNKTLHRTSNTTKCLNLGSYNYLGFAAADE  120

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YCTP VIDSLK++SPSTCS RVDGGT +LHTE+
Sbjct  121  YCTPHVIDSLKKYSPSTCSVRVDGGTTNLHTEL  153



>ref|XP_010249161.1| PREDICTED: long chain base biosynthesis protein 2a [Nelumbo nucifera]
Length=489

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RD FRKI DW  + NLQGYAPICLGLEDFY RRLY
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQIRDLFRKILDWWSADNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAW DVVER SNDNNKTLKRTT I +CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFGRPIASAPDAWIDVVERYSNDNNKTLKRTTNINRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV  SL+ FS STCST VDGGT  LH E+
Sbjct  121  TPRVFRSLETFSASTCSTCVDGGTTVLHNEL  151



>ref|XP_006662956.1| PREDICTED: long chain base biosynthesis protein 2a-like [Oryza 
brachyantha]
Length=488

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFR++ DW  + N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRRLIDWFKAKNVKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND+NKTL+RTT  T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDSNKTLQRTTNTTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VI+SLK++SPSTCS RVDGGT  LH E+
Sbjct  121  TPLVIESLKKYSPSTCSVRVDGGTTKLHAEL  151



>ref|XP_008656901.1| PREDICTED: long chain base biosynthesis protein 2d [Zea mays]
 gb|ACG26228.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACL52834.1| unknown [Zea mays]
 gb|AFW84058.1| putative serine palmitoyltransferase [Zea mays]
Length=489

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFR+I D    SNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL RTT  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLHRTTATTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGNTKLHTEL  151



>ref|XP_002459025.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
 gb|EES04145.1| hypothetical protein SORBIDRAFT_03g044700 [Sorghum bicolor]
Length=489

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFR+I D    SNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL RTT  TKCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLHRTTATTKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGNTKLHTEL  151



>ref|XP_004971156.1| PREDICTED: long chain base biosynthesis protein 2d-like [Setaria 
italica]
Length=489

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFR+I D    SNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFFRRILDARKPSNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND NKTL RTTK +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDCNKTLHRTTKTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LH E+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGNTKLHNEL  151



>ref|XP_002450805.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
 gb|EES09793.1| hypothetical protein SORBIDRAFT_05g018880 [Sorghum bicolor]
Length=488

 Score =   257 bits (656),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFVDWFKAKNVKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD+WFDVVER SNDNNKTL+RT+  T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDSWFDVVERTSNDNNKTLQRTSNTTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK +S STCS RVDGGT  LH E+
Sbjct  121  TPRVIESLKTYSASTCSVRVDGGTTKLHAEL  151



>ref|XP_008231042.1| PREDICTED: long chain base biosynthesis protein 2a-like [Prunus 
mume]
Length=489

 Score =   256 bits (655),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLF FGQ RD FRK  DW  SSNLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFVFGQVRDVFRKFIDWWSSSNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER SND NKTLK TTK ++CLNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDCFNRPIASAPDAWFDVVERFSNDYNKTLKLTTKTSRCLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I +LK++SPSTCS+RVDGGT  LH E+
Sbjct  121  TPRAIQTLKKYSPSTCSSRVDGGTTVLHNEL  151



>ref|XP_010096046.1| Serine palmitoyltransferase 2 [Morus notabilis]
 gb|EXB62852.1| Serine palmitoyltransferase 2 [Morus notabilis]
Length=508

 Score =   257 bits (656),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 135/176 (77%), Gaps = 25/176 (14%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRK  DW  S+NLQGYAPICLGLEDFY RRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQLRDFFRKFIDWWSSNNLQGYAPICLGLEDFYIRRLY  60

Query  377  LRIQ-------------------------DCFGRPICSPPDAWFDVVERVSNDNNKTLKR  481
            LRIQ                         DCFGRPI S PDAWFDVVER SNDNNKTL R
Sbjct  61   LRIQIKASNQYLIIHSEKASEFEYASGDWDCFGRPISSAPDAWFDVVERFSNDNNKTLTR  120

Query  482  TTKITKCLNLGSYNYLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TTKI++CLNLGSYNYLGFAASDEYCTPR I+SLKR+SPSTCS+RVDGGT +LH ++
Sbjct  121  TTKISRCLNLGSYNYLGFAASDEYCTPRAIESLKRYSPSTCSSRVDGGTTALHNKL  176



>ref|NP_001148953.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACG33631.1| serine palmitoyltransferase 2 [Zea mays]
 gb|ACN26506.1| unknown [Zea mays]
 tpg|DAA42006.1| TPA: Serine palmitoyltransferase 2 [Zea mays]
Length=488

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW  + N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFVDWFKAKNVKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD+WFDVVER S DNNKTL+RT+  T+CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDSWFDVVERTSKDNNKTLQRTSNTTRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGGT  LH E+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGTTKLHNEL  151



>ref|XP_003577540.1| PREDICTED: long chain base biosynthesis protein 2a [Brachypodium 
distachyon]
Length=488

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK  DW    N++GYAPICLGLEDFY RRLY
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKFIDWFKDKNIKGYAPICLGLEDFYVRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PD+WFDVVER SNDNNKTL+RT+  T+CLNLGSYNYLGFAA+DE+C
Sbjct  61   LRIQDCFSRPIASAPDSWFDVVERYSNDNNKTLQRTSNTTRCLNLGSYNYLGFAAADEFC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++SPSTCS RVDGGT  LH E+
Sbjct  121  TPRVIESLKKYSPSTCSVRVDGGTTELHAEL  151



>ref|XP_006645277.1| PREDICTED: long chain base biosynthesis protein 2d-like [Oryza 
brachyantha]
Length=489

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDF R+I D   SSNL+GYAPICLGLEDFYTRRLY
Sbjct  1    MVRLPYVTALTTLFSYGLLFAFGQLRDFVRRILDAGKSSNLKGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PDAWFDVVER SND+NKTL  TTK +KCLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFGRPIASAPDAWFDVVERYSNDSNKTLHCTTKTSKCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGG   LH E+
Sbjct  121  TPRVIESLKKYSASTCSVRVDGGNTKLHIEL  151



>ref|XP_004304557.1| PREDICTED: long chain base biosynthesis protein 2a [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRK  DW  S+NLQGYAPICLGLEDFYTRRLY
Sbjct  1    MIAIPYLTALTTYFSYGLLFAFGQVRDFFRKFIDWRSSNNLQGYAPICLGLEDFYTRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCF RPI S PDAWFDVVER SND NKTLK T+  ++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRIQDCFNRPISSAPDAWFDVVERYSNDYNKTLKLTSSTSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I +L+++SPSTCS+RVDGGT  LH E+
Sbjct  121  TPRAIKTLRKYSPSTCSSRVDGGTTVLHNEL  151



>ref|XP_009403557.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSS--NLQGYAPICLGLEDFYTRR  370
            M+ +PY TALTT FSY LLFAFGQ RDFFRKI DW  SS  +L+GYAPICLGLEDFYTRR
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQLRDFFRKIIDWFKSSSKDLKGYAPICLGLEDFYTRR  60

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLRIQDCF RPI S PDAW DVVER SNDNNKTL RT+  T+CLNLGSYNYLGFAA+DE
Sbjct  61   LYLRIQDCFSRPIASAPDAWIDVVERYSNDNNKTLHRTSNTTRCLNLGSYNYLGFAAADE  120

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YCTP VIDSLK++S STCS RVDGGT  LHTE+
Sbjct  121  YCTPHVIDSLKKYSCSTCSVRVDGGTTDLHTEL  153



>ref|XP_003564989.1| PREDICTED: long chain base biosynthesis protein 2d [Brachypodium 
distachyon]
Length=489

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSS-NLQGYAPICLGLEDFYTRRL  373
            M+ +PY TALTT  SY LLFAFG FRDFFR+I D   SS NL+GYAPICLG EDFYTRRL
Sbjct  1    MVRLPYLTALTTLVSYGLLFAFGHFRDFFRRILDAGKSSDNLKGYAPICLGYEDFYTRRL  60

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
            YLRIQDCFGRPI S PDAW DVVERVSND NKTL+RTTK +KCLNLGSYNYLGFAA+DEY
Sbjct  61   YLRIQDCFGRPIASAPDAWVDVVERVSNDCNKTLQRTTKTSKCLNLGSYNYLGFAAADEY  120

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            CTPRVI+SLK++S STCS RVDGG   LHTE+
Sbjct  121  CTPRVIESLKKYSASTCSARVDGGNTKLHTEL  152



>ref|XP_009419359.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419360.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=490

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSN--LQGYAPICLGLEDFYTRR  370
            M+ +PY TALTT FSY LLF FGQ RDFFRKI DW  S++  L+GYAPICLGLEDFYTRR
Sbjct  1    MVRLPYLTALTTLFSYGLLFVFGQLRDFFRKIIDWSKSTSKGLKGYAPICLGLEDFYTRR  60

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLRIQDCF RPI S PDAW DVVER SNDNNKTL RT+  TKCLNLGSYNYLGFAA+DE
Sbjct  61   LYLRIQDCFSRPIASAPDAWIDVVERYSNDNNKTLHRTSNTTKCLNLGSYNYLGFAAADE  120

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YCTPRVI+SLK++S STCS RVDGGT  LH E+
Sbjct  121  YCTPRVIESLKKYSSSTCSIRVDGGTTDLHNEL  153



>ref|XP_009404745.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=489

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSS--NLQGYAPICLGLEDFYTRR  370
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  S   +L+GYAPICLGLEDFYTRR
Sbjct  1    MVRLPYLTALTTLFSYGLLFAFGQMRDFFRKLIDWSKSKGKDLKGYAPICLGLEDFYTRR  60

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLRIQDCF RPI S PDAW DVVER SND+NKTL RT+  TKCLNLGSYNYLGFAA+DE
Sbjct  61   LYLRIQDCFSRPIASAPDAWIDVVERYSNDHNKTLHRTSNTTKCLNLGSYNYLGFAAADE  120

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YCTP VI+SLK++S STCS RVDGGT +LHTE+
Sbjct  121  YCTPLVIESLKKYSASTCSVRVDGGTTNLHTEL  153



>ref|NP_197756.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 ref|NP_001031932.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 sp|Q9LSZ9.1|LCB2A_ARATH RecName: Full=Long chain base biosynthesis protein 2a; Short=AtLCB2a; 
AltName: Full=Long chain base biosynthesis protein 
2; Short=AtLCB2 [Arabidopsis thaliana]
 dbj|BAA97234.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAK92764.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM91761.1| putative serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AED93196.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
 gb|AED93197.1| serine palmitoyltransferase subunit LCB2 [Arabidopsis thaliana]
Length=489

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNLQGYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWFTSNLQGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_002872066.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48325.1| LCB2 subunit protein [Arabidopsis lyrata subsp. lyrata]
Length=489

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNLQGYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTSNLQGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>emb|CDX68498.1| BnaC01g25760D [Brassica napus]
Length=489

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R+IFDW  ++NL GYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLHGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVER SNDNNKTLKRTTK T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERFSNDNNKTLKRTTKSTRCLNLGSYNYLGFGSYDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VIDSLK+FSPSTCS+RVD GT S+H E+
Sbjct  121  TPLVIDSLKKFSPSTCSSRVDAGTTSVHAEL  151



>ref|XP_006404217.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
 gb|ESQ45670.1| hypothetical protein EUTSA_v10010322mg [Eutrema salsugineum]
Length=489

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R+IFDW  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVER SNDNNKTLKRTTK  +CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERYSNDNNKTLKRTTKSRRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FSPSTCS+RVD GT ++H E+
Sbjct  121  TPRVIESLKKFSPSTCSSRVDAGTTTVHAEL  151



>ref|XP_009151545.1| PREDICTED: long chain base biosynthesis protein 2b-like [Brassica 
rapa]
Length=489

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R+IFDW  ++NL GYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLHGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVER SNDNNKTLKRTTK T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERFSNDNNKTLKRTTKSTRCLNLGSYNYLGFGSYDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VIDSLK+FSPSTCS+RVD GT S+H E+
Sbjct  121  TPLVIDSLKKFSPSTCSSRVDAGTTSVHAEL  151



>emb|CDX83048.1| BnaA01g20480D [Brassica napus]
Length=489

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R+IFDW  ++NL GYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLHGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVER SNDNNKTLKRTTK T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERFSNDNNKTLKRTTKSTRCLNLGSYNYLGFGSYDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VIDSLK+FSPSTCS+RVD GT S+H E+
Sbjct  121  TPLVIDSLKKFSPSTCSSRVDAGTTSVHAEL  151



>ref|XP_010515202.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
 ref|XP_010426376.1| PREDICTED: long chain base biosynthesis protein 2b [Camelina 
sativa]
Length=489

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R +FDW  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLLFDWWRTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVERVSNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERVSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_010503519.1| PREDICTED: long chain base biosynthesis protein 2b-like [Camelina 
sativa]
Length=489

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R +FDW  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLLFDWWRTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVERVSNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERVSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>dbj|BAB03231.1| serine palmitoyltransferase [Arabidopsis thaliana]
Length=489

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNLQGYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWFTSNLQGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQ+CF RPI S PDAWFDVVER SNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQNCFERPISSAPDAWFDVVERYSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>emb|CDX87007.1| BnaC03g52770D [Brassica napus]
Length=489

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R IFDWC ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWCSTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PD+W DV+ER SNDNNKTLKRTTK T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFNRPISSAPDSWVDVIERYSNDNNKTLKRTTKSTRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|NP_190447.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
 sp|Q9M304.1|LCB2B_ARATH RecName: Full=Long chain base biosynthesis protein 2b; Short=AtLCB2b; 
AltName: Full=Serine palmitoyltransferase 1; Short=AtSPT1 
[Arabidopsis thaliana]
 emb|CAB87906.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAK96680.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL24364.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 dbj|BAB78461.1| serine palmitoyltransferase [Arabidopsis thaliana]
 gb|AAM47981.1| serine palmitoyltransferase-like protein [Arabidopsis thaliana]
 gb|AAP31959.1| At3g48780 [Arabidopsis thaliana]
 gb|AEE78455.1| serine palmitoyltransferase 1 [Arabidopsis thaliana]
Length=489

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R IFDW  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWWRTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVERVS+DNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWIDVVERVSDDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_006290987.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
 gb|EOA23885.1| hypothetical protein CARUB_v10017101mg [Capsella rubella]
Length=489

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R IFDW  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWWRTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVERVS+DNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERVSDDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>gb|KFK27657.1| hypothetical protein AALP_AA8G411600 [Arabis alpina]
Length=489

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  ++NL GYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFLDWWFATNLHGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFNRPISSAPDAWFDVVERYSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>gb|KFK34178.1| hypothetical protein AALP_AA5G110700 [Arabis alpina]
Length=489

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R+IFDW  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRRIFDWWSTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVER SNDNNKTLKRTTK  +CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWVDVVERYSNDNNKTLKRTTKSKRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_006287613.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
 gb|EOA20511.1| hypothetical protein CARUB_v10000825mg [Capsella rubella]
Length=489

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNL GYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTSNLHGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_010519476.1| PREDICTED: long chain base biosynthesis protein 2a [Tarenaya 
hassleriana]
Length=487

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY  LFAFGQ RDFFR++ DW  ++NLQGYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGFLFAFGQLRDFFRRLLDWWLTNNLQGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAWFDVVER SNDNNKTLKRTT  ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWFDVVERYSNDNNKTLKRTTNSSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI++LK+FS STCS RVD GT S+H E+
Sbjct  121  TPRVIETLKKFSASTCSPRVDAGTTSIHAEL  151



>ref|XP_010421176.1| PREDICTED: long chain base biosynthesis protein 2a [Camelina 
sativa]
Length=489

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  +SNL GYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTSNLHGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKT KRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTFKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>gb|ABW97708.1| serine palmitoyltransferase long chain base subunit [Brassica 
rapa subsp. chinensis]
Length=489

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R IFDWC ++NL GYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWCSTNNLHGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PD+W DV+ER SNDNNKTLKRTTK T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFNRPISSAPDSWVDVIERYSNDNNKTLKRTTKSTRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_009150176.1| PREDICTED: long chain base biosynthesis protein 2b [Brassica 
rapa]
 emb|CDY37911.1| BnaA06g19060D [Brassica napus]
Length=489

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R IFDWC ++NL GYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFDWCSTNNLHGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PD+W DV+ER SNDNNKTLKRTTK T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFNRPISSAPDSWVDVIERYSNDNNKTLKRTTKSTRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_010454654.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  ++NL GYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTTNLHGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKT KRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTFKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTSVHAEL  151



>ref|XP_002875925.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52184.1| hypothetical protein ARALYDRAFT_485232 [Arabidopsis lyrata subsp. 
lyrata]
Length=489

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RD+ R IF W  ++NLQGYAPICL  EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDYSRLIFGWWRTNNLQGYAPICLAHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S PDAW DVVERVS+DNNKTLKRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFGRPISSAPDAWIDVVERVSDDNNKTLKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS +TCS+RVD GT S+H E+
Sbjct  121  TPRVIESLKKFSATTCSSRVDAGTTSVHAEL  151



>ref|XP_010493489.1| PREDICTED: long chain base biosynthesis protein 2a-like [Camelina 
sativa]
Length=489

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDFFR+  DW  ++NL GYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFFRRFIDWWLTTNLHGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKT KRTTK ++CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTFKRTTKTSRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCS+RVD GT  +H E+
Sbjct  121  TPRVIESLKKFSASTCSSRVDAGTTFVHAEL  151



>ref|XP_006394629.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31915.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=406

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDF R+  DW   SNLQGYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFVRRFIDWWLVSNLQGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKTLKRT K T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTLKRTIKTTRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGG  625
            TPRVIDSLK+FS STCS+RVD G
Sbjct  121  TPRVIDSLKKFSASTCSSRVDAG  143



>ref|XP_006394630.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
 gb|ESQ31916.1| hypothetical protein EUTSA_v10004251mg [Eutrema salsugineum]
Length=434

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TA++T+FSY LLFAFGQ RDF R+  DW   SNLQGYAPICLG EDFY RRLY
Sbjct  1    MITIPYLTAVSTYFSYGLLFAFGQLRDFVRRFIDWWLVSNLQGYAPICLGHEDFYIRRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAWFDVVER SNDNNKTLKRT K T+CLNLGSYNYLGF + DEYC
Sbjct  61   HRIQDCFERPISSAPDAWFDVVERYSNDNNKTLKRTIKTTRCLNLGSYNYLGFGSFDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGG  625
            TPRVIDSLK+FS STCS+RVD G
Sbjct  121  TPRVIDSLKKFSASTCSSRVDAG  143



>ref|XP_009363696.1| PREDICTED: long chain base biosynthesis protein 2a-like [Pyrus 
x bretschneideri]
Length=220

 Score =   228 bits (580),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY T LT +FSY LLF F Q RDFFRK+ +W  + NLQGYAPICLGLEDFY  RLY
Sbjct  1    MIAIPYLTTLTKYFSYGLLFVFCQVRDFFRKMINWWSAGNLQGYAPICLGLEDFYICRLY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQD F RPI S  DAWF+VVER SND NKTLK T K ++ LNLGSYNYLGFAASDEYC
Sbjct  61   LRIQDYFNRPIASVSDAWFNVVERYSNDYNKTLKLTKKTSRRLNLGSYNYLGFAASDEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I++LK++SPSTCS+RV+GGT+ LH E+
Sbjct  121  TPRAIETLKKYSPSTCSSRVNGGTMDLHNEL  151



>gb|AFW60854.1| hypothetical protein ZEAMMB73_652361 [Zea mays]
Length=283

 Score =   227 bits (579),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 123/153 (80%), Gaps = 6/153 (4%)
 Frame = +2

Query  206  IPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNL-----QGYAPICLGLEDFYTRR  370
            + Y TALTT FSY LLFAFGQ RD FR +   C   N      QGYAPIC+GLEDF+ RR
Sbjct  5    LAYTTALTTLFSYGLLFAFGQLRDLFRHLL-GCFRPNKDDDVKQGYAPICVGLEDFFVRR  63

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLR+QDCFGRPI S PD+WFDVVER S+DNNKTL+RT+K T+CLNL SYNYLGFAA+DE
Sbjct  64   LYLRVQDCFGRPIASAPDSWFDVVERTSDDNNKTLQRTSKTTRCLNLTSYNYLGFAAADE  123

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YC PRV+DSLK++S STCS RVDGGT  LHTE+
Sbjct  124  YCVPRVVDSLKKYSASTCSARVDGGTTKLHTEL  156



>ref|XP_002450804.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
 gb|EES09792.1| hypothetical protein SORBIDRAFT_05g018870 [Sorghum bicolor]
Length=490

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  212  YFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQD  391
            Y TALTT FSY LLFAFGQ RDFFR + D    +N  GYAPIC+GLEDF+ RRLYLR+QD
Sbjct  8    YTTALTTLFSYGLLFAFGQLRDFFRNLIDCFKPNNAVGYAPICVGLEDFFVRRLYLRVQD  67

Query  392  CFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVI  571
            CFGRPI S PD+WFDVV+R SNDNNKTL+RT+  T+CLNL SYNYLGFAA+DEYC P V+
Sbjct  68   CFGRPIASAPDSWFDVVQRTSNDNNKTLQRTSNTTRCLNLTSYNYLGFAAADEYCIPHVV  127

Query  572  DSLKRFSPSTCSTRVDGGTLSLHTEI  649
             SLK++S STCS RVDGGT  LHTE+
Sbjct  128  QSLKKYSASTCSARVDGGTTKLHTEL  153



>ref|XP_008678154.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Zea mays]
Length=491

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 123/153 (80%), Gaps = 6/153 (4%)
 Frame = +2

Query  206  IPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNL-----QGYAPICLGLEDFYTRR  370
            + Y TALTT FSY LLFAFGQ RD FR +   C   N      QGYAPIC+GLEDF+ RR
Sbjct  5    LAYTTALTTLFSYGLLFAFGQLRDLFRHLL-GCFRPNKDDDVKQGYAPICVGLEDFFVRR  63

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLR+QDCFGRPI S PD+WFDVVER S+DNNKTL+RT+K T+CLNL SYNYLGFAA+DE
Sbjct  64   LYLRVQDCFGRPIASAPDSWFDVVERTSDDNNKTLQRTSKTTRCLNLTSYNYLGFAAADE  123

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YC PRV+DSLK++S STCS RVDGGT  LHTE+
Sbjct  124  YCVPRVVDSLKKYSASTCSARVDGGTTKLHTEL  156



>ref|XP_008678152.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
 ref|XP_008678153.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Zea mays]
Length=526

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 123/153 (80%), Gaps = 6/153 (4%)
 Frame = +2

Query  206  IPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNL-----QGYAPICLGLEDFYTRR  370
            + Y TALTT FSY LLFAFGQ RD FR +   C   N      QGYAPIC+GLEDF+ RR
Sbjct  5    LAYTTALTTLFSYGLLFAFGQLRDLFRHLL-GCFRPNKDDDVKQGYAPICVGLEDFFVRR  63

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LYLR+QDCFGRPI S PD+WFDVVER S+DNNKTL+RT+K T+CLNL SYNYLGFAA+DE
Sbjct  64   LYLRVQDCFGRPIASAPDSWFDVVERTSDDNNKTLQRTSKTTRCLNLTSYNYLGFAAADE  123

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YC PRV+DSLK++S STCS RVDGGT  LHTE+
Sbjct  124  YCVPRVVDSLKKYSASTCSARVDGGTTKLHTEL  156



>ref|XP_006828786.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
 gb|ERM96202.1| hypothetical protein AMTR_s00001p00112910 [Amborella trichopoda]
Length=487

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT FSY LLF FGQFRD FRK++    SS  + YAPI L  EDFYTRRLY
Sbjct  1    MITIPYVTALTTLFSYGLLFVFGQFRDLFRKLWRRI-SSKKELYAPIVLENEDFYTRRLY  59

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LRIQDCFGRPI S PD+WFD+VER S D NKTL RT+K  +CLNLGSYNYLGFA+SDEYC
Sbjct  60   LRIQDCFGRPISSAPDSWFDLVERYSTDCNKTLIRTSKTRRCLNLGSYNYLGFASSDEYC  119

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPR I+SLKR+SPSTCS RVD GT +LHTE+
Sbjct  120  TPRAIESLKRYSPSTCSNRVDAGTTNLHTEV  150



>gb|EMS46639.1| Serine palmitoyltransferase 2 [Triticum urartu]
Length=487

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+  P  TALTT FSY L+FAFG+ RDFF +I D   SSNL+GYAPIC G EDFY RR++
Sbjct  1    MVNPPILTALTTRFSYGLIFAFGRLRDFFCRILDAAKSSNLKGYAPICCGYEDFYWRRVH  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
            LR+QDCF RP+ S PDAW D+VER SND NKTL+ + + ++CLNLGSYNYLGFAA+DEYC
Sbjct  61   LRMQDCFDRPVASAPDAWLDLVERNSNDCNKTLQHSAETSRCLNLGSYNYLGFAAADEYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK++S STCS RVDGGT  LHTE+
Sbjct  121  TPRVIESLKKYSASTCSARVDGGTTKLHTEL  151



>ref|XP_009411041.1| PREDICTED: long chain base biosynthesis protein 2a-like [Musa 
acuminata subsp. malaccensis]
Length=483

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 0/151 (0%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ + Y TALTTFF YILL AFG  RD  RK+ DW  S +L+GYAPIC   EDFYTRR+Y
Sbjct  1    MVRLTYLTALTTFFGYILLIAFGVLRDLVRKLLDWFKSDDLKGYAPICPPFEDFYTRRIY  60

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCFGRPI S  DAW DVVER SNDN+KTL+RT+  ++CLNLGSYNYLGFAA D YC
Sbjct  61   HRIQDCFGRPIASAADAWIDVVERHSNDNDKTLRRTSTTSRCLNLGSYNYLGFAAGDRYC  120

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV++SLK+++  TCS R D GT  LH E+
Sbjct  121  TPRVVESLKKYASGTCSARADAGTTKLHIEL  151



>gb|ABR18369.1| unknown [Picea sitchensis]
Length=493

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ IPYFTALTT+FSY LLF FG  RDFFR  F     S  +GYAP+C   EDFYTRRLY
Sbjct  1    MVTIPYFTALTTYFSYGLLFVFGHMRDFFRS-FCKSDQSTPEGYAPLCRDFEDFYTRRLY  59

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
             RIQDCF RPI S PDAW +V ER SNDNN+TL RT K  +CLNLGSYNYLGFA++DEYC
Sbjct  60   HRIQDCFNRPIASAPDAWIEVSERYSNDNNETLFRTGKTHRCLNLGSYNYLGFASADEYC  119

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRV++SLKRFSPSTCS+RVD GT  LH E+
Sbjct  120  TPRVVESLKRFSPSTCSSRVDAGTTVLHQEL  150



>ref|XP_006645276.1| PREDICTED: long chain base biosynthesis protein 2c-like [Oryza 
brachyantha]
Length=492

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 120/156 (77%), Gaps = 5/156 (3%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHS-----SNLQGYAPICLGLEDFY  361
            M+++P  TA+TT FSY L+FAFG  RDFFR +F          ++ +GYAPIC G EDFY
Sbjct  1    MVKVPLVTAVTTVFSYGLIFAFGHLRDFFRFVFSAAGDGDGSPASSKGYAPICGGPEDFY  60

Query  362  TRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAA  541
             RR   RIQDCF RPI S PDAWFDVVER SNDNNKTL RTTK +KCLNLGSYNYLGFAA
Sbjct  61   ARRFIRRIQDCFWRPIASKPDAWFDVVERYSNDNNKTLIRTTKTSKCLNLGSYNYLGFAA  120

Query  542  SDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            +DEYCTPRV++SLK++S STCS RVDGG   LH E+
Sbjct  121  ADEYCTPRVLESLKKYSASTCSVRVDGGNTKLHVEL  156



>ref|NP_001045278.1| Os01g0928700 [Oryza sativa Japonica Group]
 sp|Q8RYL0.1|LCB2C_ORYSJ RecName: Full=Long chain base biosynthesis protein 2c [Oryza 
sativa Japonica Group]
 dbj|BAB90752.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 dbj|BAF07192.1| Os01g0928700 [Oryza sativa Japonica Group]
 gb|EAY77077.1| hypothetical protein OsI_05037 [Oryza sativa Indica Group]
 gb|EAZ14710.1| hypothetical protein OsJ_04634 [Oryza sativa Japonica Group]
Length=497

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 120/159 (75%), Gaps = 8/159 (5%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHS--------SNLQGYAPICLGLE  352
            M+ +P+ TA+TT FSY ++F FG  RD+FR +     S        +NL+GYAPIC G E
Sbjct  1    MVRVPFVTAVTTVFSYGVIFGFGHLRDWFRALLRSLFSGHSPAAAGTNLKGYAPICGGQE  60

Query  353  DFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLG  532
            DFY RR   R+QDCF RPI S PDAWFDVVER SND+NKTL RTTK ++CLNLGSYNYLG
Sbjct  61   DFYYRRFVRRVQDCFWRPIASKPDAWFDVVERYSNDSNKTLHRTTKTSRCLNLGSYNYLG  120

Query  533  FAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            FAA+DEYCTPRVI+SLK++S STCS RVDGG   LH E+
Sbjct  121  FAAADEYCTPRVIESLKKYSASTCSVRVDGGNTKLHVEL  159



>ref|XP_006645275.1| PREDICTED: long chain base biosynthesis protein 2b-like [Oryza 
brachyantha]
Length=498

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 119/160 (74%), Gaps = 9/160 (6%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---------DWCHSSNLQGYAPICLGL  349
            M+ +PY TA+TT FS+ L+FAFG  RD FR +          D     N +GYAPIC+G 
Sbjct  1    MVRVPYVTAVTTLFSFGLIFAFGHLRDSFRGLLIRFLLAGDDDSPAGGNPKGYAPICVGK  60

Query  350  EDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYL  529
            EDFY RR + RIQDCFGRPI S PDAWFDVVER S D+NKTL RTT+ +KCLNL S+NYL
Sbjct  61   EDFYIRRFFRRIQDCFGRPIASKPDAWFDVVERYSTDSNKTLHRTTRTSKCLNLASFNYL  120

Query  530  GFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            GFAA+DEYCTPRVI SLK++S STCS+RVDGG   LH E+
Sbjct  121  GFAAADEYCTPRVIQSLKKYSASTCSSRVDGGNTLLHIEL  160



>gb|EAY77076.1| hypothetical protein OsI_05036 [Oryza sativa Indica Group]
Length=499

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWC----------HSSNLQGYAPICLG  346
            +I++PY TA TT FS+ L+F FG  RD FR +                 N +GYAPIC+G
Sbjct  2    VIKVPYVTAATTLFSFGLIFGFGHLRDSFRALLRLLFSSAAAADSPAGCNSKGYAPICVG  61

Query  347  LEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNY  526
             EDFY RR + R+QDCFGRPI S PDAWFDVVER S D+NKTL RTTK +KCLNL S+NY
Sbjct  62   KEDFYIRRFFRRVQDCFGRPIASKPDAWFDVVERYSTDSNKTLHRTTKTSKCLNLASFNY  121

Query  527  LGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            LGFAA+DEYCTPRVI+SLK++S STCS+RVDGG   LH E+
Sbjct  122  LGFAAADEYCTPRVIESLKKYSASTCSSRVDGGNTQLHIEL  162



>ref|XP_011073129.1| PREDICTED: long chain base biosynthesis protein 2b isoform X2 
[Sesamum indicum]
Length=498

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 115/151 (76%), Gaps = 22/151 (15%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            MI IPY TALTT+FSY LLFAFGQ RDFFRKIFDW   ++L+                  
Sbjct  1    MITIPYLTALTTYFSYGLLFAFGQLRDFFRKIFDWWSHNSLE------------------  42

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
                DCF RPICS PDAWFDVVER+SND NKTLKRTT++ +CLNLGSYNYLGFAA+DEYC
Sbjct  43   ----DCFNRPICSSPDAWFDVVERISNDYNKTLKRTTRVDRCLNLGSYNYLGFAAADEYC  98

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TPRVI+SLK+FS STCSTRVDGGT +LH E+
Sbjct  99   TPRVIESLKKFSASTCSTRVDGGTTTLHAEL  129



>sp|Q8RYL1.1|LCB2B_ORYSJ RecName: Full=Long chain base biosynthesis protein 2b [Oryza 
sativa Japonica Group]
 dbj|BAB90751.1| putative serine palmitoyltransferase [Oryza sativa Japonica Group]
 gb|EAZ14709.1| hypothetical protein OsJ_04633 [Oryza sativa Japonica Group]
 dbj|BAH00934.1| unnamed protein product [Oryza sativa Japonica Group]
Length=499

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 117/161 (73%), Gaps = 10/161 (6%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWC----------HSSNLQGYAPICLG  346
            +I++PY TA TT FS+ L+F FG  RD FR +                 N +GYAPIC+G
Sbjct  2    VIKVPYVTAATTLFSFGLIFGFGHLRDSFRALLRLLFSSAAAADSPAGCNSKGYAPICVG  61

Query  347  LEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNY  526
             EDFY RR + R+QDCFGRPI S PDAWFDVVER S D+NKTL  TTK +KCLNL S+NY
Sbjct  62   KEDFYIRRFFRRVQDCFGRPIASKPDAWFDVVERYSTDSNKTLHCTTKTSKCLNLASFNY  121

Query  527  LGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            LGFAA+DEYCTPRVI+SLK++S STCS+RVDGG   LH E+
Sbjct  122  LGFAAADEYCTPRVIESLKKYSASTCSSRVDGGNTQLHIEL  162



>ref|XP_009394362.1| PREDICTED: long chain base biosynthesis protein 2d-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  239  SYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQDCFGRPICSP  418
             Y++ F FG  RD FR++FDW  S +L+GYAPIC   EDFYTRR+Y RIQDCF RPI S 
Sbjct  15   GYVVFFVFGFLRDLFRELFDWSKSDDLRGYAPICPPFEDFYTRRIYHRIQDCFARPIASA  74

Query  419  PDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVIDSLKRFSPS  598
            PDAW DVVER SNDNNKTL R++  ++CLNLGSYNYLGFAA DEYCTPRVI+SLK+++P+
Sbjct  75   PDAWIDVVERYSNDNNKTLHRSSTASRCLNLGSYNYLGFAAGDEYCTPRVIESLKKYAPT  134

Query  599  TCSTRVDGGTLSLHTEI  649
             CS R D GT  LH E+
Sbjct  135  ACSARADAGTTRLHVEL  151



>ref|XP_007031988.1| Long chain base2 isoform 2 [Theobroma cacao]
 gb|EOY02914.1| Long chain base2 isoform 2 [Theobroma cacao]
Length=454

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  314  NLQGYAPICLGLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKI  493
             ++GYAPICLGLEDFY RRLYLRIQDCFGRPI S PDAWFDVVER SNDNNKTLKRT  +
Sbjct  6    QMKGYAPICLGLEDFYIRRLYLRIQDCFGRPIASAPDAWFDVVERYSNDNNKTLKRTANM  65

Query  494  TKCLNLGSYNYLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            ++CLNLGSYNYLGFAA+DEYCTPR I+SL RFSPSTCS+RVDGGT  LH E+
Sbjct  66   SRCLNLGSYNYLGFAAADEYCTPRAIESLNRFSPSTCSSRVDGGTTILHNEL  117



>gb|EEE52176.1| hypothetical protein OsJ_34042 [Oryza sativa Japonica Group]
Length=466

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 111/151 (74%), Gaps = 22/151 (15%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLY  376
            M+ +PY TALTT FSY LLFAFGQ RDFFRK+ DW  + N                    
Sbjct  1    MVRLPYTTALTTLFSYGLLFAFGQLRDFFRKLIDWFKAKN--------------------  40

Query  377  LRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYC  556
              ++DCFGRPI S PDAWFDVVER SND+NKTLKRT+  T+CLNLGSYNYLGFAA+DEYC
Sbjct  41   --VKDCFGRPIASAPDAWFDVVERYSNDSNKTLKRTSNTTRCLNLGSYNYLGFAAADEYC  98

Query  557  TPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            TP VI+SLK++SPSTCS RVDGGT  LHTE+
Sbjct  99   TPLVIESLKKYSPSTCSVRVDGGTTKLHTEL  129



>ref|XP_009150173.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X1 [Brassica rapa]
Length=485

 Score =   201 bits (512),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = +2

Query  212  YFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSS-NLQGYAPICLGLEDFYTRRLYLRIQ  388
            YFT ++T+ S  L+  FG  RDFFR+I     ++ NLQGYAPIC G EDFY RR Y R+Q
Sbjct  2    YFTTISTYLSCCLIIGFGHLRDFFRRILVLLFTNDNLQGYAPICFGHEDFYMRRGYHRVQ  61

Query  389  DCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRV  568
            DCF RPI S PDAWFD+VER  ND  K + RTTK  +CLNLGSYNYLGF + DEYCTPRV
Sbjct  62   DCFARPIASAPDAWFDMVERDWNDGEKVIDRTTKRRRCLNLGSYNYLGFGSFDEYCTPRV  121

Query  569  IDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            I+SLK+FS STCS+RVD GT S+H E+
Sbjct  122  IESLKKFSASTCSSRVDAGTTSVHVEL  148



>ref|XP_001783810.1| predicted protein [Physcomitrella patens]
 gb|EDQ51402.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 109/149 (73%), Gaps = 4/149 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLR  382
            E+PY  A+TT+FSY +LF  G  RDF+R I      S  +GYAP+C   EDFYTRRLY R
Sbjct  8    EVPYHVAITTYFSYGILFIIGTLRDFYRNIM----RSGKKGYAPLCRDFEDFYTRRLYNR  63

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            IQDCF RPI S P  W DV+ERVS D+NKTL +T  + +CLNLGSYNYLGFA+ DEYCTP
Sbjct  64   IQDCFNRPIASAPTNWVDVIERVSYDSNKTLHQTENVRRCLNLGSYNYLGFASHDEYCTP  123

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            RV++SL ++  S CS RVDGGT  LH E+
Sbjct  124  RVLESLNKYGASACSARVDGGTTLLHNEL  152



>ref|XP_002978032.1| hypothetical protein SELMODRAFT_108076 [Selaginella moellendorffii]
 gb|EFJ20689.1| hypothetical protein SELMODRAFT_108076 [Selaginella moellendorffii]
Length=477

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  215  FTALTTFFSYILLFAFGQFRDFFRKI---FDWCHSSNLQGYAPICLGLEDFYTRRLYLRI  385
             T  +T+ SY LLF  G  RD  R I   F     +N  GYAP+C   EDFY RRLY RI
Sbjct  7    LTLYSTYISYGLLFVLGHLRDLCRSIHRAFFAIKDANPPGYAPLCRSYEDFYARRLYHRI  66

Query  386  QDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPR  565
            QDCF RPI S P++W DV+ER S+DNNKTL R  K  +CLNLGSYNYLGFAA+DEYCTPR
Sbjct  67   QDCFNRPIASAPESWIDVIERESSDNNKTLHRPFKTRRCLNLGSYNYLGFAAADEYCTPR  126

Query  566  VIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            VI+SL+++  STC++RVDGGT SLH E+
Sbjct  127  VIESLEKYGASTCASRVDGGTTSLHVEL  154



>ref|XP_002966707.1| hypothetical protein SELMODRAFT_86377 [Selaginella moellendorffii]
 gb|EFJ32734.1| hypothetical protein SELMODRAFT_86377 [Selaginella moellendorffii]
Length=477

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  215  FTALTTFFSYILLFAFGQFRDFFRKI---FDWCHSSNLQGYAPICLGLEDFYTRRLYLRI  385
             T  +T+ SY LLF  G  RD  R I   F     +N  GYAP+C   EDFY RRLY RI
Sbjct  7    LTLYSTYISYGLLFVLGHLRDLCRSIHRAFFAIKDANPPGYAPLCRSYEDFYARRLYHRI  66

Query  386  QDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPR  565
            QDCF RPI S P++W DV+ER S+DNNKTL R  K  +CLNLGSYNYLGFAA+DEYCTPR
Sbjct  67   QDCFNRPIASAPESWIDVIERESSDNNKTLHRPFKTRRCLNLGSYNYLGFAAADEYCTPR  126

Query  566  VIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            VI+SL+++  STC++RVDGGT SLH E+
Sbjct  127  VIESLEKYGASTCASRVDGGTTSLHVEL  154



>ref|XP_011401811.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28766.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=490

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +2

Query  221  ALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQDCFG  400
            AL  + S+ LL+ FGQFRDFFRK   W  +S L+GYAPI    EDFYTRR+Y RI DCF 
Sbjct  13   ALFAYTSFTLLYIFGQFRDFFRK--RWSKAS-LKGYAPIRQDYEDFYTRRMYYRIHDCFN  69

Query  401  RPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVIDSL  580
            RPI  PP +W DV+ER   +  + L  T KI +CLNLGSYNYLGFA+SD YCTPRV+D+L
Sbjct  70   RPITGPPSSWMDVLERTPVNRQEPLTTTGKIKRCLNLGSYNYLGFASSDPYCTPRVLDTL  129

Query  581  KRFSPSTCSTRVDGGTLSLHTEI  649
             +   S CS R D GT  +H E+
Sbjct  130  SQHGWSLCSNRADAGTTPVHEEL  152



>gb|AAX20007.1| putative serine palmitoyltransferase [Zea mays]
Length=171

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/89 (81%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            IQDCFGRPI S PDAWFDVVER SND NKTL RTT  TKCLNLGSYNYLGFAA+DEYCTP
Sbjct  1    IQDCFGRPIASAPDAWFDVVERYSNDCNKTLHRTTATTKCLNLGSYNYLGFAAADEYCTP  60

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            RVI+SLK++S STCS RVDGG   LHTE+
Sbjct  61   RVIESLKKYSASTCSVRVDGGNTKLHTEL  89



>ref|XP_005647033.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE22489.1| PLP-dependent transferase [Coccomyxa subellipsoidea C-169]
Length=489

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 99/147 (67%), Gaps = 4/147 (3%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQ  388
            P+F AL T  S+ +LF  G  RD FR+ +    S   +GYAPI    EDFYTRR++ RI 
Sbjct  9    PFFVALATMASWTILFIMGHIRDLFRRRY----SPERKGYAPIRQDYEDFYTRRMFYRIH  64

Query  389  DCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRV  568
            DC+ RPICS PD+  DV+ER +    K L  T ++ +CLNLGSYNYLGFAASDEYCTPRV
Sbjct  65   DCWNRPICSAPDSHIDVMERTAVSGQKPLTLTGRVRRCLNLGSYNYLGFAASDEYCTPRV  124

Query  569  IDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             D++  +  + CS+R+D GT  +H E+
Sbjct  125  QDAMNSYGWAMCSSRLDAGTTPVHLEL  151



>ref|XP_005848468.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
 gb|EFN56366.1| hypothetical protein CHLNCDRAFT_144864 [Chlorella variabilis]
Length=510

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 93/149 (62%), Gaps = 2/149 (1%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ--GYAPICLGLEDFYTRRLYLR  382
            P F AL ++ S+++LF FG  RDF+RK      S+  Q  GYAPI    EDFYTRR+Y R
Sbjct  10   PLFVALASYASWLVLFLFGHMRDFYRKKIWGGRSAAKQKEGYAPIRQDYEDFYTRRMYYR  69

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            I D F RPICS PDAW DV+ R   D  K L+ T    +CLNLGSYNYLGFAA DEYCTP
Sbjct  70   IHDTFNRPICSAPDAWIDVMRRTPVDGQKPLRLTGSSQRCLNLGSYNYLGFAAQDEYCTP  129

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            RV   L     +  + R DGGT   H E+
Sbjct  130  RVEAVLDSLGWAASAPRSDGGTTPRHAEL  158



>ref|XP_008678155.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X3 [Zea mays]
Length=464

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  389  DCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRV  568
            DCFGRPI S PD+WFDVVER S+DNNKTL+RT+K T+CLNL SYNYLGFAA+DEYC PRV
Sbjct  43   DCFGRPIASAPDSWFDVVERTSDDNNKTLQRTSKTTRCLNLTSYNYLGFAAADEYCVPRV  102

Query  569  IDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            +DSLK++S STCS RVDGGT  LHTE+
Sbjct  103  VDSLKKYSASTCSARVDGGTTKLHTEL  129



>ref|XP_009403558.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403559.1| PREDICTED: long chain base biosynthesis protein 2a-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            + DCF RPI S PDAW DVVER SNDNNKTL RT+  T+CLNLGSYNYLGFAA+DEYCTP
Sbjct  3    VHDCFSRPIASAPDAWIDVVERYSNDNNKTLHRTSNTTRCLNLGSYNYLGFAAADEYCTP  62

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             VIDSLK++S STCS RVDGGT  LHTE+
Sbjct  63   HVIDSLKKYSCSTCSVRVDGGTTDLHTEL  91



>ref|XP_011401812.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
 gb|KFM28767.1| Serine palmitoyltransferase 2 [Auxenochlorella protothecoides]
Length=760

 Score =   150 bits (378),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 70/143 (49%), Positives = 93/143 (65%), Gaps = 3/143 (2%)
 Frame = +2

Query  221  ALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQDCFG  400
            AL  + ++ +L+ FG  RDF R   +    ++ +GYAPI    EDF+TRR+Y RI D F 
Sbjct  13   ALLAYATWTILYIFGLLRDFVR---NRRGKASFKGYAPIRQDFEDFFTRRIYYRIHDVFN  69

Query  401  RPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVIDSL  580
             P+  PP AW D++ER   +  K L  T KI +CLNLGSYNYLGFA+SD YCTPRV+D+L
Sbjct  70   CPVKGPPSAWMDIIERTPVNRQKPLMATGKIKRCLNLGSYNYLGFASSDPYCTPRVLDTL  129

Query  581  KRFSPSTCSTRVDGGTLSLHTEI  649
             +   S CS+R D GT  +H E+
Sbjct  130  SQHGWSLCSSRADAGTTPVHEEL  152



>ref|XP_010322021.1| PREDICTED: long chain base biosynthesis protein 2a-like [Solanum 
lycopersicum]
Length=452

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 92/146 (63%), Gaps = 28/146 (19%)
 Frame = +2

Query  212  YFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQD  391
            +F   TT+FS  ++ AF + R          H +NLQ                      D
Sbjct  5    FFITFTTYFSCAIIIAFDKLRHI------CSHFTNLQ----------------------D  36

Query  392  CFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVI  571
            CF RPICS PDAWFDVV+RV++DNNK  KRT  +++CLNLGSYNYLGFAA DEYC+PR I
Sbjct  37   CFERPICSSPDAWFDVVKRVTDDNNKIQKRTKNVSRCLNLGSYNYLGFAAFDEYCSPRTI  96

Query  572  DSLKRFSPSTCSTRVDGGTLSLHTEI  649
            + LK FS STCS+RVDGGT  +HTE+
Sbjct  97   ECLKIFSASTCSSRVDGGTTIIHTEL  122



>gb|KIW03829.1| hypothetical protein PV09_05128 [Verruconis gallopava]
Length=684

 Score =   147 bits (371),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 69/150 (46%), Positives = 96/150 (64%), Gaps = 3/150 (2%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRLYL  379
            PY+  +TT+ SY++L  FG  RDFF K F   H ++LQ   GYAP+    ++FYTRRL +
Sbjct  148  PYYFVITTYISYLILIIFGHVRDFFGKRFRPAHYAHLQAANGYAPLNSDFDNFYTRRLKM  207

Query  380  RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCT  559
            RI DCF RP    P  +  +++R S+DNN T + T   T+ LN+ SYNYLGFA S+  C 
Sbjct  208  RINDCFARPTTGVPGRFITLLDRESDDNNHTFRLTGTKTETLNMSSYNYLGFAQSEGPCA  267

Query  560  PRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              V ++++++  STCSTR D GT  LH E+
Sbjct  268  DAVEEAVRKYGISTCSTRADAGTSDLHKEV  297



>gb|KDD76320.1| class I/II aminotransferase [Helicosporidium sp. ATCC 50920]
Length=502

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 88/147 (60%), Gaps = 3/147 (2%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLRIQ  388
            P+ TA+ T+  +  L+  G+ RD  RK+ +        GYAPI    EDFYTRR+Y RI 
Sbjct  14   PFMTAIVTYICWTTLYIVGKLRDMARKLVE---GEKRPGYAPIRQDYEDFYTRRMYYRIH  70

Query  389  DCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRV  568
            DCF RPICS P +W DV+ R      + L  T +   CLNLGSYNYLGFA++DEYCTP+V
Sbjct  71   DCFNRPICSAPGSWVDVMLRTPPSRQRALTSTGETRSCLNLGSYNYLGFASTDEYCTPQV  130

Query  569  IDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            +DSL      T S R   GT   H ++
Sbjct  131  LDSLDSCGWWTGSARGAAGTTRAHQDL  157



>ref|XP_002839631.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ83822.1| unnamed protein product [Tuber melanosporum]
Length=669

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 68/152 (45%), Positives = 98/152 (64%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY RRL
Sbjct  144  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKVENYKHLRAQNGYAPLNDDFDNFYVRRL  203

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RPI   P  + +V++R S+D N+T K +   T+ LN+ SYNYLGFA S+  
Sbjct  204  KMRINDCFARPITGVPGRFVNVLDRTSDDFNQTFKFSGTSTETLNMSSYNYLGFAQSEGP  263

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V D+++++  S+ S+R+D GTL LHT++
Sbjct  264  CADAVEDTVRKYGLSSASSRMDAGTLDLHTDV  295



>ref|XP_002734812.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=551

 Score =   138 bits (347),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ----GYAPICLGLEDFYTRR  370
            E P   A+ T+ +Y LL   G  RDF RK+    +S+  +    G+ P+    E FYTR 
Sbjct  56   EAPMLIAIVTYMAYALLVVVGHVRDFLRKLCGEKNSAAKEFGNKGFVPLYSDFESFYTRN  115

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LY RI+DC+ RPICS P  WFD++ER S+D N  L  T K ++C+NLGSYNYLGFA    
Sbjct  116  LYRRIRDCWNRPICSTPGGWFDIMERTSSDYNWHLDVTGKSSRCINLGSYNYLGFAEDSG  175

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C     ++L ++    CSTR + G L +H E+
Sbjct  176  TCAEASQETLIKYGAGVCSTRQELGNLDIHIEL  208



>emb|CDX87006.1| BnaC03g52760D [Brassica napus]
Length=406

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            ++DCF RPI S PDAWFD+VER  ND  K + RTTK  +CLNLGSYNYLGF + DEYCTP
Sbjct  1    MKDCFARPIASAPDAWFDMVERDWNDGEKVIDRTTKRRRCLNLGSYNYLGFGSFDEYCTP  60

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            RVI+SLK+FS STCS+RVD GT S+H E+
Sbjct  61   RVIESLKKFSASTCSSRVDAGTTSVHVEL  89



>ref|XP_001544251.1| hypothetical protein HCAG_01298 [Histoplasma capsulatum NAm1]
 gb|EDN03433.1| hypothetical protein HCAG_01298 [Histoplasma capsulatum NAm1]
Length=481

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  156  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYTHLKPKNGYGALNSDFDNFYVR  215

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R S+D+N+  + T   T  LN+ SYNYLGFA S+
Sbjct  216  RLKLRINDCFERPVTGVPGRYITLIDRTSDDHNRHFRLTGTYTDTLNMSSYNYLGFAQSE  275

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V D +KR+  S+ STR D GT  LH E+
Sbjct  276  GPCADAVEDIIKRYGISSVSTRADAGTQDLHIEV  309



>ref|XP_007587353.1| putative serine palmitoyltransferase protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD45194.1| putative serine palmitoyltransferase protein [Neofusicoccum parvum 
UCRNP2]
Length=686

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 92/152 (61%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY RRL
Sbjct  156  EPPYYFLLTTYISYLVLIIFGHVRDFFGKRFKQNNYKHLRAQDGYAPLNSDFDNFYVRRL  215

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RPI   P  +  +++R S+D N T K T   T+ LN+ SYNYLGFA S+  
Sbjct  216  KMRINDCFARPITGVPGRYITLLDRKSDDYNLTFKMTGTTTETLNMSSYNYLGFAQSEGP  275

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C     + +K+   STCSTR D GT SLH E+
Sbjct  276  CADATEEGIKKLGISTCSTRADVGTTSLHLEV  307



>gb|EKG16858.1| Aminotransferase class I/classII [Macrophomina phaseolina MS6]
Length=587

 Score =   137 bits (346),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   ++ H     GYAP+    ++FY RRL
Sbjct  57   EPPYYFLLTTYISYLILIIFGHVRDFFGKRFRQNNYKHLRAQDGYAPLNSDFDNFYVRRL  116

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  +++R S+D N T K T   ++ LN+ SYNYLGFA S+  
Sbjct  117  KMRINDCFARPTTGVPGRYITLLDRKSDDYNLTFKMTGTTSETLNMSSYNYLGFAQSEGP  176

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V + +K++  S CSTR D GT +LHTE+
Sbjct  177  CADAVEEGIKKYGISVCSTRADVGTTTLHTEV  208



>ref|XP_008353440.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417009 
[Malus domestica]
Length=1099

 Score =   140 bits (352),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 60/77 (78%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  419  PDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVIDSLKRFSPS  598
            PDAWFDVVER SND NKTLK T K ++CLNLGSYNYLGFAASDEYCTPR I++LK++SPS
Sbjct  684  PDAWFDVVERYSNDYNKTLKLTKKTSRCLNLGSYNYLGFAASDEYCTPRAIETLKKYSPS  743

Query  599  TCSTRVDGGTLSLHTEI  649
            TCS+RVDGGT  LH E+
Sbjct  744  TCSSRVDGGTTDLHNEL  760



>ref|XP_001239438.1| hypothetical protein CIMG_09059 [Coccidioides immitis RS]
 gb|EAS27855.3| serine palmitoyltransferase 2 [Coccidioides immitis RS]
Length=669

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PYF  LTT+ SY++L AFG  RDFF K F   D+ H     GY  +    ++FY R
Sbjct  140  MDEPPYFYLLTTYISYLILIAFGHVRDFFGKRFKEKDYRHLKPQNGYGALNSDFDNFYVR  199

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  200  RLKLRINDCFERPVTGVPGRYITLIDRVSDDQNRHFRFTGTTTDTLNMSSYNYLGFAQSE  259

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V  +++++  S+  TRVD GT  LH E+
Sbjct  260  GPCADAVEQTIRKYGISSVGTRVDAGTQDLHVEV  293



>ref|XP_003067044.1| Serine palmitoyltransferase 2 , putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EER24899.1| Serine palmitoyltransferase 2 , putative [Coccidioides posadasii 
C735 delta SOWgp]
 gb|EFW19213.1| serine palmitoyltransferase 2 [Coccidioides posadasii str. Silveira]
Length=670

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PYF  LTT+ SY++L AFG  RDFF K F   D+ H     GY  +    ++FY R
Sbjct  141  MDEPPYFYLLTTYISYLILIAFGHVRDFFGKRFKEKDYRHLKPQNGYGALNSDFDNFYVR  200

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  201  RLKLRINDCFERPVTGVPGRYITLIDRVSDDQNRHFRFTGTTTDTLNMSSYNYLGFAQSE  260

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V  +++++  S+  TRVD GT  LH E+
Sbjct  261  GPCADAVEQTIRKYGISSVGTRVDAGTQDLHVEV  294



>gb|EWM21787.1| serine palmitoyltransferase [Nannochloropsis gaditana]
Length=648

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 104/187 (56%), Gaps = 9/187 (5%)
 Frame = +2

Query  104  PPADLCHLRP-PVFAGFSSPPCRLIRSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDF  280
            PPA +   RP    AG    P    +S      + I +F A+TT+F Y +L  FG  RDF
Sbjct  140  PPAPVKIDRPFSTVAGLRDMP----KSYERGHEVPITWFAAITTYFGYAVLILFGHIRDF  195

Query  281  FRKIFD---WCHSSNLQGYAPICLGLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERV  451
            F ++F    +  +S   GYAP+    E+FYTRRLY RI+DC+ RP+CS P     VVER 
Sbjct  196  FGRLFGMSRYLATSPPPGYAPLLKDWENFYTRRLYHRIRDCWERPVCSAPGGRITVVERD  255

Query  452  SNDNNKTLKRTTKITKCLNLGSYNYLGFAAS-DEYCTPRVIDSLKRFSPSTCSTRVDGGT  628
            S D NKT+  T +  +CLNLGSYNYLGFA      C   V+ +L  F+   CS R+D GT
Sbjct  256  SPDGNKTMLMTKRTRECLNLGSYNYLGFADDWQTSCKSHVMPTLDNFNSCLCSARMDLGT  315

Query  629  LSLHTEI  649
               H  +
Sbjct  316  SREHVRL  322



>emb|CDS13464.1| hypothetical protein LRAMOSA05640 [Absidia idahoensis var. thermophila]
Length=625

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 93/155 (60%), Gaps = 3/155 (2%)
 Frame = +2

Query  194  KMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYT  364
            KM E P +  ++T+ +Y++L   G  RD   K+F   ++ H  N QGYAP+    + FYT
Sbjct  147  KMEEAPLYVLVSTYLNYLVLILLGHLRDVIGKVFKRKEYAHLRNNQGYAPLVSDFDSFYT  206

Query  365  RRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAAS  544
            RR+Y+RI+DC+ RPI   P     V+ER ++D NKT K T +    LN  SYNYLGFA +
Sbjct  207  RRMYMRIRDCWNRPITGVPTRKTQVLERETDDFNKTFKLTGRKIDALNFASYNYLGFAQA  266

Query  545  DEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            +  C   V D+++ +  S  STR + GTL LH ++
Sbjct  267  EGPCADAVEDTVREYGISCASTRTEAGTLDLHRQV  301



>gb|EER37408.1| serine palmitoyltransferase [Histoplasma capsulatum H143]
 gb|EGC47985.1| serine palmitoyltransferase [Histoplasma capsulatum H88]
Length=693

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  156  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPKNGYGALNSDFDNFYVR  215

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R S+D+N+  + T   T  LN+ SYNYLGFA S+
Sbjct  216  RLKLRINDCFERPVTGVPGRYITLIDRTSDDHNRHFRLTGTYTDTLNMSSYNYLGFAQSE  275

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V D +KR+  S+ STR D GT  LH E+
Sbjct  276  GPCADAVEDIIKRYGISSASTRADAGTQDLHLEV  309



>gb|EPZ34220.1| Pyridoxal phosphate-dependent transferase domain-containing protein 
1 [Rozella allomycis CSF55]
Length=486

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 91/151 (60%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            + PYF  +TT+ SY++L  FG  RDFF K F   D+ H  +  G+AP+    E FYTRRL
Sbjct  6    DAPYFVLVTTYLSYLILILFGHVRDFFGKRFRKHDYSHLMDSNGFAPLTSDFESFYTRRL  65

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
            Y RI+DC+ RPI   P     ++ R S D NKT   T K+ + LNL SYNYLGFA +   
Sbjct  66   YTRIRDCWNRPITKVPGRTIHLLTRESKDFNKTFNLTGKVNEVLNLSSYNYLGFALNSGP  125

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
            C   V  +L+++S S CS R + GT+ +H +
Sbjct  126  CANAVEKTLRKYSISVCSPRSEAGTMDIHRQ  156



>gb|EEH03654.1| serine palmitoyltransferase [Histoplasma capsulatum G186AR]
Length=693

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  156  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPKNGYGALNSDFDNFYVR  215

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R S+D+N+  + T   T  LN+ SYNYLGFA S+
Sbjct  216  RLKLRINDCFERPVTGVPGRYITLIDRTSDDHNRHFRLTGTYTDTLNMSSYNYLGFAQSE  275

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V D +KR+  S+ STR D GT  LH E+
Sbjct  276  GPCADAVEDIIKRYGISSVSTRADAGTQDLHLEV  309



>ref|XP_002414858.1| serine palmitoyltransferase, putative [Ixodes scapularis]
 gb|EEC18523.1| serine palmitoyltransferase, putative [Ixodes scapularis]
Length=532

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 92/153 (60%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKI----FDWCHSSNLQGYAPICLGLEDFYTRR  370
            E P   AL+T+ SY++L  FG  RDF R +           + +GY P+    E FYTR 
Sbjct  48   ETPLLMALSTYLSYVILGIFGHIRDFMRSVGLEEIRTATEKDREGYVPLYQSFESFYTRN  107

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            +Y  I+DCF +PICS P A  D+V+RV++DNN T      +TK +N+GSYNYLGFA +  
Sbjct  108  VYRPIRDCFNQPICSVPGAVIDLVDRVTDDNNWTFTMPGTVTKAINMGSYNYLGFAENSG  167

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
                 V  +++R+   TCS+R + GTL++H E+
Sbjct  168  PVVDEVEKAIRRYGSGTCSSRHELGTLAIHQEL  200



>gb|EPS25829.1| hypothetical protein PDE_00765 [Penicillium oxalicum 114-2]
Length=676

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 93/154 (60%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  149  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLQARDGYGALNSDFDNFYVR  208

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+N+    T   T  LNL SYNYLGFA S+
Sbjct  209  RLKLRINDCFERPVTGVPGRFITLIDRATDDHNQHFHLTGTFTDTLNLSSYNYLGFAQSE  268

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V D+++++  ST STR +GGT  LH E+
Sbjct  269  GPCADSVEDTIRKYGISTPSTRAEGGTQDLHVEV  302



>ref|XP_007595827.1| aminotransferase class I and II [Colletotrichum fioriniae PJ7]
 gb|EXF80546.1| aminotransferase class I and II [Colletotrichum fioriniae PJ7]
Length=655

 Score =   135 bits (340),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 74/162 (46%), Positives = 96/162 (59%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY+LL  FG  RDFF K F D  H   L+   GYAP+  
Sbjct  118  KPLDPPIIDEPPYYYILTTYISYLLLILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNE  177

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S D N+T   T   T+ LN+ SYN
Sbjct  178  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESRDYNRTYNYTGTHTETLNMSSYN  237

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +KR+S STCS R D GT  L  E+
Sbjct  238  YLGFAQSEGPCADAVEECVKRYSLSTCSPRADVGTSDLALEV  279



>ref|XP_002613183.1| hypothetical protein BRAFLDRAFT_210501 [Branchiostoma floridae]
 gb|EEN69192.1| hypothetical protein BRAFLDRAFT_210501, partial [Branchiostoma 
floridae]
Length=483

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 5/153 (3%)
 Frame = +2

Query  206  IPYFTALTTFFSYILLFAFGQFRDFFRKI-FDWCHSS----NLQGYAPICLGLEDFYTRR  370
            +P   A  T+  Y +L  FG FRDF RK   +  HS+     ++ + P+    E FYTR 
Sbjct  9    VPLLVACLTYLGYGMLVLFGYFRDFLRKSGVETTHSTIERKKMKDFVPLYQSFESFYTRN  68

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LY RI+DC+ RPICS P A FDV ERVS+D N  L+ T K  +C+NLGSYNYLGFA +  
Sbjct  69   LYTRIRDCWNRPICSVPSAEFDVSERVSDDGNWHLRLTGKSRRCVNLGSYNYLGFAENKG  128

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C     ++L+++    CSTR + G   +H E+
Sbjct  129  PCADAAAEALQQYGAGVCSTRQELGNYRIHEEL  161



>ref|XP_003855132.1| serine palmitoyl transferase subunit 2 [Zymoseptoria tritici 
IPO323]
 gb|EGP90108.1| serine palmitoyl transferase subunit 2 [Zymoseptoria tritici 
IPO323]
Length=584

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 91/152 (60%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PYF  +TT+ SY++L  FG  RDFF K F   H   L+   GYAP+    ++FY RRL
Sbjct  55   EPPYFYLITTYISYLVLIIFGHVRDFFGKRFKPDHYKQLRECDGYAPLNSDFDNFYIRRL  114

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RP+   P  +  +++R S+D N T K T   T+ LN+ SYNYLGFA ++  
Sbjct  115  QLRINDCFRRPVTGVPGRFITLLDRTSDDGNITFKLTGTTTQTLNMSSYNYLGFADAEGE  174

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      SLK++  S CS R D GT  LHTE+
Sbjct  175  CADAAEASLKKYGISFCSPRGDVGTSELHTEV  206



>ref|XP_006816918.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=590

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 86/153 (56%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKI----FDWCHSSNLQGYAPICLGLEDFYTRR  370
            E P  TA+ T+ SY  L   G F+D  R++     D       +G+ P+    E FYTR 
Sbjct  91   EAPMLTAILTYISYAFLVIIGHFKDILRRLGVDKSDVAKEKGNEGFVPLYCDFESFYTRN  150

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LY  ++DC  RPICS P AWFDV+ERVS DNN  L  T K ++C+NLGSYNYLGFA +  
Sbjct  151  LYRYVRDCVNRPICSTPGAWFDVMERVSPDNNLHLNITGKSSRCINLGSYNYLGFAENSG  210

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C      +L ++      TR + G L +H E+
Sbjct  211  PCAEAAQRALIKYGAGVGGTRQELGNLDIHLEL  243



>ref|XP_007674599.1| hypothetical protein BAUCODRAFT_66436 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC97986.1| hypothetical protein BAUCODRAFT_66436 [Baudoinia compniacensis 
UAMH 10762]
Length=584

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  +TT+ SY++L  FG  RDFF K F   H  +LQ   GYAP+    ++FY RRL
Sbjct  55   EPPYYYLITTYISYLILIIFGHVRDFFGKRFRQDHYRHLQEQDGYAPLNNDFDNFYIRRL  114

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RP+   P  +  +++R S+D N + K T   T+ LN+ SYNYLGFA +D  
Sbjct  115  QLRINDCFRRPVTGVPGRFITLLDRTSDDFNLSFKMTGTTTETLNMSSYNYLGFAQADGE  174

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      S+K++  S CS R D G   LH E+
Sbjct  175  CADAAEQSIKKYGISFCSPRADAGNSELHVEV  206



>ref|XP_002734813.1| PREDICTED: serine palmitoyltransferase 2-like [Saccoglossus kowalevskii]
Length=553

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 90/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF----DWCHSSNLQGYAPICLGLEDFYTRR  370
            E+P   A+ T  SY LL   G  R+F RKI     +       +G+ P+    E FY + 
Sbjct  56   EVPMIRAVFTCLSYALLVVVGHLREFLRKIGVDKNEVTREKGNKGFVPLYCDFESFYNQN  115

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            LY R++DC+ RPICS P AWF+V+ERVS D N  L  T K ++C+NLGSYNYLGFA +  
Sbjct  116  LYRRVRDCWNRPICSTPGAWFNVMERVSPDYNWHLNLTGKSSRCINLGSYNYLGFAENSG  175

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C    +++L ++    CSTR + G L +H E+
Sbjct  176  PCAEASLETLIKYGAGVCSTRQELGNLDIHIEL  208



>gb|ENH86493.1| serine palmitoyltransferase [Colletotrichum orbiculare MAFF 240422]
Length=655

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 72/162 (44%), Positives = 97/162 (60%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+  
Sbjct  118  KPLDPPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNE  177

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S+D N+T   T   T+ LN+ SYN
Sbjct  178  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESSDYNRTYNYTGTHTETLNVSSYN  237

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +K++S STCS R D GT  L  E+
Sbjct  238  YLGFAQSEGPCADAVEECVKKYSLSTCSPRADVGTSDLALEV  279



>gb|KDN61953.1| putative aminotransferase class I and II [Colletotrichum sublineola]
Length=655

 Score =   134 bits (336),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 72/162 (44%), Positives = 96/162 (59%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+  
Sbjct  118  KPLDPPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNE  177

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S D N+T   T   T+ LN+ SYN
Sbjct  178  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESRDYNRTYNYTGTHTETLNMSSYN  237

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +K++S STCS R D GT  L  E+
Sbjct  238  YLGFAQSEGPCADAVEECVKKYSLSTCSPRADVGTSDLALEV  279



>gb|EWC48527.1| serine palmitoyltransferase 2 [Drechslerella stenobrocha 248]
Length=649

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 92/151 (61%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLEDFYTRRL  373
            E PYF  +TT+FSY++L  FG  RDFF K F    + H  +  GYA +    ++FY RRL
Sbjct  125  EPPYFIMITTYFSYLILIIFGHVRDFFGKRFKGHKYSHLKSKNGYAALNSDFDNFYVRRL  184

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LR+ DCF RPI   P  +  ++ R S+D N+T + T +  + LN+ SYNYLGFA S+  
Sbjct  185  KLRLDDCFSRPITGVPGRFITLLGRKSDDYNETFQMTGEKIETLNMSSYNYLGFAQSEGP  244

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
            C     ++++++  S+  TR DGGTL +H E
Sbjct  245  CADAAEETVRKYGVSSAGTRADGGTLDIHIE  275



>ref|XP_002620119.1| serine palmitoyltransferase 2 [Blastomyces dermatitidis SLH14081]
 gb|EEQ77280.1| serine palmitoyltransferase 2 [Blastomyces dermatitidis SLH14081]
Length=411

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 3/153 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+   TT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  154  MDEPPYYYLFTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYGALNSDFDNFYIR  213

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R S+D+N+  + T   T  LN+ SYNYLGFA S+
Sbjct  214  RLKLRINDCFERPVTGVPGRYITLIDRTSDDHNRHFRLTGTYTDTLNMSSYNYLGFAQSE  273

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
              C   V +++KR+  S+  TR D GT  +H E
Sbjct  274  GPCADAVEETIKRYGISSVGTRADAGTQDIHVE  306



>ref|XP_003171686.1| serine palmitoyltransferase 2 [Microsporum gypseum CBS 118893]
 gb|EFR03232.1| serine palmitoyltransferase 2 [Microsporum gypseum CBS 118893]
Length=660

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S+ STR + GT  LH E+
Sbjct  250  GPCADAVEETIKKYGISSVSTRSEVGTQDLHLEV  283



>ref|XP_002682326.1| serine C-palmitoyltransferase [Naegleria gruberi]
 gb|EFC49582.1| serine C-palmitoyltransferase [Naegleria gruberi]
Length=491

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 92/149 (62%), Gaps = 0/149 (0%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLR  382
            +I  +  +TT+ +Y +L   GQ RDFF ++F        +G+AP+    ED YTRRLY R
Sbjct  5    DISSWVLITTYLNYAVLILLGQIRDFFHELFIGSIHQTPKGFAPLVHSYEDLYTRRLYRR  64

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            I DC+ RPI S P A+ DV++RVSND NKT++ T     CLNL SYNYLGFA S ++   
Sbjct  65   ICDCWNRPISSRPGAYIDVMKRVSNDYNKTIQITDDRIHCLNLASYNYLGFADSPKHVLD  124

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             V+ S+ ++ P++ S   D G   +H E+
Sbjct  125  DVLKSIDQYGPASASAYGDFGYSKIHKEL  153



>gb|EEH21189.2| hypothetical protein PABG_03420 [Paracoccidioides brasiliensis 
Pb03]
Length=684

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+   TT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY RRL
Sbjct  156  EPPYYYLFTTYISYLILIAFGHVRDFFGKRFREENYKHLKPRNGYGALNSDFDNFYIRRL  215

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP+   P  +  +++R+S D N+  + T   T  LN+ SYNYLGFA S+  
Sbjct  216  KMRINDCFERPVTGVPGRYITLIDRMSEDQNRHFRLTGTFTDTLNMSSYNYLGFAQSEGP  275

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +++KR+  S+  TRVD GT  LH E+
Sbjct  276  CADAVEETIKRYGISSVGTRVDAGTQDLHIEV  307



>ref|XP_010757665.1| hypothetical protein PADG_01990 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH45840.1| hypothetical protein PADG_01990 [Paracoccidioides brasiliensis 
Pb18]
Length=684

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+   TT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY RRL
Sbjct  156  EPPYYYLFTTYISYLILIAFGHVRDFFGKRFREENYKHLKPRNGYGALNSDFDNFYIRRL  215

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP+   P  +  +++R+S D N+  + T   T  LN+ SYNYLGFA S+  
Sbjct  216  KMRINDCFERPVTGVPGRYITLIDRMSEDQNRHFRLTGTFTDTLNMSSYNYLGFAQSEGP  275

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +++KR+  S+  TRVD GT  LH E+
Sbjct  276  CADAVEETIKRYGISSVGTRVDAGTQDLHIEV  307



>ref|XP_002845325.1| serine palmitoyltransferase 2 [Arthroderma otae CBS 113480]
 gb|EEQ32375.1| serine palmitoyltransferase 2 [Arthroderma otae CBS 113480]
Length=578

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D+N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDHNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S  STR + GT  LH E+
Sbjct  250  GPCADAVEETIRKYGISAVSTRSEVGTQDLHLEV  283



>ref|XP_003348860.1| hypothetical protein SMAC_01883 [Sordaria macrospora k-hell]
 emb|CCC08336.1| unnamed protein product [Sordaria macrospora k-hell]
Length=663

 Score =   132 bits (331),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 73/179 (41%), Positives = 100/179 (56%), Gaps = 9/179 (5%)
 Frame = +2

Query  140  FAGFSSPPCRLIRS-----LLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DW  301
            F   +SP  R I +     L P    E PY+  LTT+ SY++L  FG  RDFF K F D 
Sbjct  110  FGPLNSPAHRYISTHDGSTLEPPVEDEPPYYYVLTTYLSYLILIFFGHARDFFGKRFGDQ  169

Query  302  CHSSNLQ---GYAPICLGLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKT  472
             H   L+   GYAP+    ++FY RRL +RI DCF RP    P  +  +++R S+D N+T
Sbjct  170  THYKALRVQNGYAPLNDDFDNFYVRRLKMRIDDCFARPTTGVPGRYITLLDRKSDDFNRT  229

Query  473  LKRTTKITKCLNLGSYNYLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             + T   T+ LN+ SYNYLGFA S   C   V + ++++  S+CS R D GT  L  E+
Sbjct  230  YQYTGTCTQTLNMSSYNYLGFAQSVGPCADAVEECVRKYGLSSCSPRADVGTSDLAVEV  288



>gb|KDB26321.1| hypothetical protein H109_01895 [Trichophyton interdigitale MR816]
Length=660

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S+ STR + GT  LH E+
Sbjct  250  GPCADAVEETIRKYGISSVSTRSEVGTQDLHLEV  283



>ref|XP_003017462.1| serine palmitoyltransferase 1, putative [Arthroderma benhamiae 
CBS 112371]
 gb|EFE36817.1| serine palmitoyltransferase 1, putative [Arthroderma benhamiae 
CBS 112371]
Length=660

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S+ STR + GT  LH E+
Sbjct  250  GPCADAVEETIRKYGISSVSTRSEVGTQDLHLEV  283



>gb|EZF34964.1| hypothetical protein H101_01502 [Trichophyton interdigitale H6]
Length=660

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S+ STR + GT  LH E+
Sbjct  250  GPCADAVEETIRKYGISSVSTRSEVGTQDLHLEV  283



>gb|EGD96430.1| serine palmitoyltransferase [Trichophyton tonsurans CBS 112818]
 gb|EGE05655.1| serine palmitoyltransferase [Trichophyton equinum CBS 127.97]
Length=660

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S+ STR + GT  LH E+
Sbjct  250  GPCADAVEETIRKYGISSVSTRSEVGTQDLHLEV  283



>ref|XP_003022680.1| serine palmitoyltransferase 1, putative [Trichophyton verrucosum 
HKI 0517]
 gb|EFE42062.1| serine palmitoyltransferase 1, putative [Trichophyton verrucosum 
HKI 0517]
Length=660

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S+ STR + GT  LH E+
Sbjct  250  GPCADAVEETIRKYGISSVSTRSEVGTQDLHLEV  283



>gb|ELR04857.1| serine palmitoyltransferase [Pseudogymnoascus destructans 20631-21]
Length=683

 Score =   132 bits (331),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 66/154 (43%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY R
Sbjct  154  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFYVR  213

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL +RI DCF RP    P  +  +++R S+D N+T + T   T+ LN+ SYNYLGFA SD
Sbjct  214  RLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNQTFQFTGTFTETLNMSSYNYLGFAQSD  273

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S  S R D GT  L  E+
Sbjct  274  GPCADAVEETVKKYGISVASPRADAGTSDLVLEV  307



>emb|CCF34300.1| aminotransferase class I and II [Colletotrichum higginsianum]
Length=671

 Score =   131 bits (330),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 71/162 (44%), Positives = 96/162 (59%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY++L  FG  RDFF K F +  H   L+   GYAP+  
Sbjct  134  KPLDPPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGEKKHYQALKPQNGYAPLNE  193

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S D N+T   T   T+ LN+ SYN
Sbjct  194  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESRDYNRTYNYTGTHTETLNMSSYN  253

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +KR++ STCS R D GT  L  E+
Sbjct  254  YLGFAQSEGPCADAVEECVKRYALSTCSPRADVGTSDLALEV  295



>ref|XP_006693108.1| serine palmitoyltransferase 2-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS20812.1| serine palmitoyltransferase 2-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=664

 Score =   131 bits (330),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF----DWCHSSNLQGYAPICLGLEDFYTRR  370
            E PYF  LTT+ SY++L   G  +DFF K F    ++       GYAP+    + FYTRR
Sbjct  136  EPPYFYVLTTYISYLILIFIGHAKDFFGKRFGKRDNYRTIKASNGYAPLNDDFDSFYTRR  195

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            L  R+ DCF RPI   P  +  +++RVS+D N++ + T   T+ LNL SYNYLGFA S+ 
Sbjct  196  LKKRLDDCFARPITGVPGRYITLIDRVSDDYNRSFRFTGTYTETLNLSSYNYLGFAQSEG  255

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C   V D ++++  S CS R D GTL L  E+
Sbjct  256  PCADAVEDCVRKYGLSACSPRFDSGTLDLALEV  288



>gb|KFX46982.1| Serine palmitoyltransferase 2 [Talaromyces marneffei PM1]
Length=1230

 Score =   132 bits (333),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  144  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFKEENYRHLKPRNGYGALNSDFDNFYVR  203

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D N+    T   T  LN+ SYNYLGFA S+
Sbjct  204  RLKLRINDCFERPVTGVPGRYITLIDRSTDDYNRHFYFTGTTTDTLNMSSYNYLGFAQSE  263

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++L+++  ST STR + GT  LH E+
Sbjct  264  GPCADAVEENLRKYGISTVSTRAEAGTCDLHVEV  297



>ref|XP_001264572.1| serine palmitoyltransferase 2, putative [Neosartorya fischeri 
NRRL 181]
 gb|EAW22675.1| serine palmitoyltransferase 2, putative [Neosartorya fischeri 
NRRL 181]
Length=680

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  151  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYGALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  211  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYLTGTTTDTLNLSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     D+L+++  S  STR + GT  LH E+
Sbjct  271  GPCADHAEDTLRKYGISAPSTRAEVGTQDLHAEV  304



>ref|XP_002795494.1| serine palmitoyltransferase [Paracoccidioides sp. 'lutzii' Pb01]
 gb|EEH40994.1| serine palmitoyltransferase [Paracoccidioides sp. 'lutzii' Pb01]
Length=684

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 89/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+   TT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY RRL
Sbjct  156  EPPYYYLFTTYISYLILIAFGHVRDFFGKRFREENYKHLKPRNGYGALNSDFDNFYIRRL  215

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP+   P  +  +++R S D N+  + T   T  LN+ SYNYLGFA S+  
Sbjct  216  KMRINDCFERPVTGVPGRYITLIDRTSEDQNRHFRLTGTFTDTLNMSSYNYLGFAQSEGP  275

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +++K++  S+  TRVD GT  LH E+
Sbjct  276  CADAVEETIKKYGISSVGTRVDAGTQDLHIEV  307



>gb|EEQ90697.1| serine palmitoyltransferase 2 [Blastomyces dermatitidis ER-3]
 gb|EGE78973.1| serine palmitoyltransferase [Blastomyces dermatitidis ATCC 18188]
 gb|EQL29677.1| serine palmitoyltransferase [Blastomyces dermatitidis ATCC 26199]
Length=689

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 3/153 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+   TT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  154  MDEPPYYYLFTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYGALNSDFDNFYIR  213

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R S+D+N+  + T   T  LN+ SYNYLGFA S+
Sbjct  214  RLKLRINDCFERPVTGVPGRYITLIDRTSDDHNRHFRLTGTYTDTLNMSSYNYLGFAQSE  273

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
              C   V +++KR+  S+  TR D GT  +H E
Sbjct  274  GPCADAVEETIKRYGISSVGTRADAGTQDIHVE  306



>gb|EFQ25280.1| aminotransferase class I and II [Colletotrichum graminicola M1.001]
Length=655

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 96/162 (59%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY++L  FG  RDFF K F D  H   L+   GYAP+  
Sbjct  118  KPLDPPIIDEPPYYYVLTTYISYLILILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNE  177

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S D N+T   T   T+ LN+ SYN
Sbjct  178  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESRDYNRTYNYTGTHTETLNMSSYN  237

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +K++S STCS R D GT  L  E+
Sbjct  238  YLGFAQSEGPCADAVEECVKKYSLSTCSPRADVGTSDLALEV  279



>ref|XP_007688714.1| hypothetical protein COCMIDRAFT_5986 [Bipolaris oryzae ATCC 44560]
 gb|EUC44750.1| hypothetical protein COCMIDRAFT_5986 [Bipolaris oryzae ATCC 44560]
Length=663

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 89/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  143  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  202

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  203  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGTTTETLNMSSYNYLGFAQSEGP  262

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  263  CADAAEAAIRKYGISMASPRSDSGTSELTVEV  294



>gb|EMD88052.1| hypothetical protein COCHEDRAFT_1227287 [Bipolaris maydis C5]
 gb|ENI02365.1| hypothetical protein COCC4DRAFT_74503 [Bipolaris maydis ATCC 
48331]
Length=662

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 89/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  142  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  201

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  202  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGTTTETLNMSSYNYLGFAQSEGP  261

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  262  CADAAEAAIRKYGISMASPRSDSGTSELTVEV  293



>ref|XP_003233381.1| serine palmitoyltransferase [Trichophyton rubrum CBS 118892]
 gb|EGD90140.1| hypothetical protein TERG_06370 [Trichophyton rubrum CBS 118892]
 gb|EZF24981.1| hypothetical protein H100_02620 [Trichophyton rubrum MR850]
 gb|EZF43979.1| hypothetical protein H102_02610 [Trichophyton rubrum CBS 100081]
 gb|EZF54642.1| hypothetical protein H103_02624 [Trichophyton rubrum CBS 288.86]
 gb|EZF65219.1| hypothetical protein H104_02602 [Trichophyton rubrum CBS 289.86]
 gb|EZF75918.1| hypothetical protein H105_02628 [Trichophyton soudanense CBS 
452.61]
 gb|EZF86540.1| hypothetical protein H110_02619 [Trichophyton rubrum MR1448]
 gb|EZF97306.1| hypothetical protein H113_02629 [Trichophyton rubrum MR1459]
 gb|EZG08298.1| hypothetical protein H106_02481 [Trichophyton rubrum CBS 735.88]
 gb|EZG18848.1| hypothetical protein H107_02698 [Trichophyton rubrum CBS 202.88]
 gb|KDB35754.1| hypothetical protein H112_02613 [Trichophyton rubrum D6]
Length=660

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  130  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFQSENYRHLKPQNGYAALNSDFDNFYVR  189

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++RVS+D N+  + T   T  LN+ SYNYLGFA S+
Sbjct  190  RLKLRINDCFERPVTGVPGRFITLIDRVSDDQNRHFRFTGTYTDTLNMSSYNYLGFAQSE  249

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S+ STR + GT  +H E+
Sbjct  250  GPCADAVEETIRKYGISSVSTRSEVGTQDIHLEV  283



>ref|XP_007713154.1| hypothetical protein COCCADRAFT_5787 [Bipolaris zeicola 26-R-13]
 gb|EUC32522.1| hypothetical protein COCCADRAFT_5787 [Bipolaris zeicola 26-R-13]
 gb|EUN29459.1| hypothetical protein COCVIDRAFT_24502 [Bipolaris victoriae FI3]
Length=663

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 89/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  143  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  202

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  203  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGTTTETLNMSSYNYLGFAQSEGP  262

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  263  CADAAEAAIRKYGISMASPRSDSGTSELTVEV  294



>ref|XP_008025168.1| hypothetical protein SETTUDRAFT_73160, partial [Setosphaeria 
turcica Et28A]
 gb|EOA87462.1| hypothetical protein SETTUDRAFT_73160, partial [Setosphaeria 
turcica Et28A]
Length=658

 Score =   130 bits (328),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 67/152 (44%), Positives = 89/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  142  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  201

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  202  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGTTTETLNMSSYNYLGFAQSEGP  261

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      S++++  +  S R D GT  L  E+
Sbjct  262  CADAAEASIRKYGIAMASPRSDSGTSELTVEV  293



>ref|XP_752555.1| serine palmitoyltransferase 2 [Aspergillus fumigatus Af293]
 emb|CAE47913.1| serine palmitoyltransferase 2, putative [Aspergillus fumigatus]
 gb|EAL90517.1| serine palmitoyltransferase 2, putative [Aspergillus fumigatus 
Af293]
Length=680

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  151  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRDGYGALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  211  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYLTGTTTDTLNLSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     D+L+++  S  STR + GT  LH E+
Sbjct  271  GPCADHAEDTLRKYGISAPSTRAEVGTQDLHAEV  304



>ref|XP_003298216.1| hypothetical protein PTT_08848 [Pyrenophora teres f. teres 0-1]
 gb|EFQ93693.1| hypothetical protein PTT_08848 [Pyrenophora teres f. teres 0-1]
Length=664

 Score =   130 bits (328),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 66/152 (43%), Positives = 88/152 (58%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+   TT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  143  EPPYYFLFTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  202

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  203  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGSTTETLNMSSYNYLGFAQSEGP  262

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  263  CADAAEATIRKYGISMASPRSDSGTSDLTVEV  294



>ref|XP_007280714.1| serine palmitoyltransferase [Colletotrichum gloeosporioides Nara 
gc5]
 gb|ELA30266.1| serine palmitoyltransferase [Colletotrichum gloeosporioides Nara 
gc5]
Length=655

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 97/162 (60%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY+LL  FG  RDFF K F D  H   L+   GYAP+  
Sbjct  118  KPLDPPIIDEPPYYYILTTYISYLLLILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNE  177

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S+D N+T   T   T+ LN+ SYN
Sbjct  178  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESSDYNRTYNYTGTHTETLNMSSYN  237

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +K+++ STCS R D GT  L  E+
Sbjct  238  YLGFAQSEGPCADAVEECVKKYALSTCSPRADVGTSDLALEV  279



>gb|KEY79580.1| serine palmitoyltransferase 2 [Aspergillus fumigatus var. RP-2014]
Length=680

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  151  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRDGYGALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  211  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYLTGTTTDTLNLSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     D+L+++  S  STR + GT  LH E+
Sbjct  271  GPCADHAEDTLRKYGISAPSTRAEVGTQDLHAEV  304



>gb|EDP56423.1| serine palmitoyltransferase 2, putative [Aspergillus fumigatus 
A1163]
Length=680

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  151  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRDGYGALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  211  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYLTGTTTDTLNLSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     D+L+++  S  STR + GT  LH E+
Sbjct  271  GPCADHAEDTLRKYGISAPSTRAEVGTQDLHAEV  304



>emb|CEI99150.1| Putative Serine palmitoyltransferase [Rhizopus microsporus]
Length=282

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 105/203 (52%), Gaps = 18/203 (9%)
 Frame = +2

Query  83   FSFSHHLPPAD--LCHLRPPVFAGFSSP---PCRLIRSL---------LPSKMIEIPYFT  220
            +S S   PP    L HL PP  +  + P   P +   S+         L  KM   P F 
Sbjct  35   YSVSSAYPPQRQPLIHL-PPSSSDLTLPDLTPTQRRNSIAASQRKYEDLEQKMEAAPLFV  93

Query  221  ALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLEDFYTRRLYLRIQD  391
             ++T+ +Y +L  FG  RD   K+F    + H    +GYAP+    + FYTRR+Y+RI+D
Sbjct  94   LVSTYLNYFILIIFGHLRDILGKMFKHKKYAHLRATEGYAPLVSDFDSFYTRRMYMRIRD  153

Query  392  CFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTPRVI  571
            C+ RP+   P     ++ER S D N+T   T +  +  N  SYNYLGFA ++ YC  +V 
Sbjct  154  CWNRPMTGVPGRKIKILERESKDFNQTFSLTGRTIEATNFSSYNYLGFAQNEGYCADQVE  213

Query  572  DSLKRFSPSTCSTRVDGGTLSLH  640
              +  +  S+ STR++ GTL +H
Sbjct  214  TCVNEYGLSSSSTRMEAGTLDIH  236



>ref|XP_002559500.1| Pc13g10800 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP92149.1| Pc13g10800 [Penicillium rubens Wisconsin 54-1255]
Length=671

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   H  +L+   GY  +    ++FY R
Sbjct  142  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREEHYRHLKPRNGYGALNSDFDNFYVR  201

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P     +++R ++D+N+    T   T  LNL SYNYLGFA SD
Sbjct  202  RLKLRINDCFERPVTGVPGRTITLIDRATDDHNQHFYLTGTTTDTLNLSSYNYLGFAQSD  261

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     DS+K++  +  STR + GT  LH E+
Sbjct  262  GPCADIAEDSIKKYGIAAPSTRAESGTQDLHVEV  295



>emb|CDH48525.1| serine palmitoyltransferase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=660

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 64/155 (41%), Positives = 89/155 (57%), Gaps = 3/155 (2%)
 Frame = +2

Query  194  KMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYT  364
            KM E P +  ++T+ +Y +L   G  RD   KIF   ++ H    QGYAP+    + FYT
Sbjct  184  KMEEAPLYILVSTYLNYFVLILLGHLRDILGKIFKRHEYAHLRTNQGYAPLVSDFDSFYT  243

Query  365  RRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAAS  544
            RRLY+RI+DC+ RPI   P     V+ER +ND NKT   T +  + LN  SYNYLGFA +
Sbjct  244  RRLYMRIRDCWNRPITGVPTRKTTVLERETNDFNKTFSLTGRKIEALNFASYNYLGFAQA  303

Query  545  DEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
               C   V +S++ +  S  +TR + GTL LH  +
Sbjct  304  QGPCADAVDESVRHYGMSCTATRAESGTLDLHRRL  338



>ref|XP_007699462.1| hypothetical protein COCSADRAFT_316156 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD64929.1| hypothetical protein COCSADRAFT_316156 [Bipolaris sorokiniana 
ND90Pr]
Length=663

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 89/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  143  EPPYYFLLTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  202

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  203  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGTTTETLNMSSYNYLGFAQSEGP  262

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  263  CADAAEAAIRKYGISMASPRSDSGTSELTIEV  294



>ref|XP_001936333.1| serine palmitoyltransferase 2 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU48920.1| serine palmitoyltransferase 2 [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=664

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 66/152 (43%), Positives = 88/152 (58%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+   TT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  143  EPPYYFLFTTYISYLILIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  202

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  203  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGSTTETLNMSSYNYLGFAQSEGP  262

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  263  CADAAEATIRKYGISMASPRSDSGTSDLTVEV  294



>gb|EQB49036.1| aminotransferase class I and II [Colletotrichum gloeosporioides 
Cg-14]
Length=655

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 97/162 (60%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RSLLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF-DWCHSSNLQ---GYAPICL  343
            + L P  + E PY+  LTT+ SY+LL  FG  RDFF K F D  H   L+   GYAP+  
Sbjct  118  KPLDPPIIDEPPYYYILTTYISYLLLILFGHARDFFGKRFGDKKHYQALKPQNGYAPLNE  177

Query  344  GLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYN  523
              ++FY RRL +RI DCF RPI   P  +  +++R S+D N+T   T   T+ LN+ SYN
Sbjct  178  DFDNFYVRRLKMRIDDCFARPITGVPGRYITLMDRESSDYNRTYNYTGTHTETLNMSSYN  237

Query  524  YLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            YLGFA S+  C   V + +K+++ STCS R D GT  L  E+
Sbjct  238  YLGFAQSEGPCADAVEECVKKYALSTCSPRADVGTSDLALEV  279



>gb|KFZ07335.1| hypothetical protein V501_06551 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=680

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY R
Sbjct  151  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL +RI DCF RP    P  +  +++R S+D N+T + T   T+ LN+ SYNYLGFA S+
Sbjct  211  RLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNQTFQFTGTFTETLNMSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S  S R D GT  L  E+
Sbjct  271  GPCADAVEETVKKYGISVASPRADAGTSDLVIEV  304



>gb|KFY75400.1| hypothetical protein V499_04622 [Pseudogymnoascus pannorum VKM 
F-103]
Length=680

 Score =   130 bits (327),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY R
Sbjct  151  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL +RI DCF RP    P  +  +++R S+D N+T + T   T+ LN+ SYNYLGFA S+
Sbjct  211  RLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNQTFQFTGTFTETLNMSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S  S R D GT  L  E+
Sbjct  271  GPCADAVEETVKKYGISVASPRADAGTSDLVIEV  304



>ref|XP_007785057.1| serine palmitoyltransferase [Coniosporium apollinis CBS 100218]
 gb|EON69740.1| serine palmitoyltransferase [Coniosporium apollinis CBS 100218]
Length=679

 Score =   130 bits (326),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 66/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  +TT+ SY++L  FG  RDFF K F      +LQ   GYAP+    ++FY RRL
Sbjct  150  EPPYYFLITTYISYLVLIIFGHVRDFFGKRFRQERYRHLQERDGYAPLNSDFDNFYVRRL  209

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  +++R S+D+N T K     T+ LN+ SYNYLGFA S+  
Sbjct  210  KMRINDCFARPTTGVPGRFITLLDRKSDDHNLTFKLQGTTTETLNMSSYNYLGFAQSEGP  269

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V   ++++  ST STR D GT  LH E+
Sbjct  270  CADAVEACVRKYGVSTASTRGDAGTSDLHVEV  301



>ref|XP_011107452.1| hypothetical protein H072_1460 [Dactylellina haptotyla CBS 200.50]
 gb|EPS44536.1| hypothetical protein H072_1460 [Dactylellina haptotyla CBS 200.50]
Length=648

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (58%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLEDFYTRRL  373
            E PYF   TT+FSY++L  FG  RDFF K F    + H     GYA +    ++FY RRL
Sbjct  124  EPPYFIMFTTYFSYLILIIFGHVRDFFGKRFKSRKYTHLKAQNGYAALNSDFDNFYVRRL  183

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
              R+ DCF RPI   P  +  ++ R SND N T + T +  + LN+ SYNYLGFA S+  
Sbjct  184  KKRLDDCFSRPITGVPGRFITLLGRESNDYNDTFRMTGEKIETLNMSSYNYLGFAQSEGP  243

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
            C     +S++++  S   TR +GGTL LH +
Sbjct  244  CADAAEESIRKYGVSAAGTRAEGGTLDLHVD  274



>ref|XP_007874560.1| hypothetical protein PNEG_02547 [Pneumocystis murina B123]
 gb|EMR09211.1| hypothetical protein PNEG_02547 [Pneumocystis murina B123]
Length=665

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E  Y+  +TT+FSY++L   G  RDFF K F     S+L+   GYAP+    ++FY RRL
Sbjct  149  EPSYYYLITTYFSYLILIILGHIRDFFGKRFKKQKYSHLRAHDGYAPLNSDFDNFYVRRL  208

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P     ++ERVS D NKT   T  + +CLN  SYNYLGFA S+  
Sbjct  209  KMRINDCFSRPTTGVPGRMITLIERVSYDYNKTFNFTGNLIECLNFSSYNYLGFAQSNGP  268

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
            C   V + +K++  S+C  R D GTL LH +
Sbjct  269  CADFVEEVIKKWKFSSCGARSDAGTLDLHVQ  299



>ref|XP_003840146.1| similar to serine palmitoyltransferase 2 [Leptosphaeria maculans 
JN3]
 emb|CBX96667.1| similar to serine palmitoyltransferase 2 [Leptosphaeria maculans 
JN3]
Length=677

 Score =   130 bits (326),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 66/152 (43%), Positives = 88/152 (58%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+   TT+ SY++L  FG  RDFF K F   H S+LQ   GYAP+    ++FYTRRL
Sbjct  150  EPPYYFLFTTYISYLVLIVFGHVRDFFGKRFRKQHYSHLQEKDGYAPLNSDFDNFYTRRL  209

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  +  V++R S+D N T K     T+ LN+ SYNYLGFA S+  
Sbjct  210  KMRINDCFSRPTTGVPGRFITVLDRKSDDGNNTFKMLGTTTETLNMSSYNYLGFAQSEGP  269

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +++++  S  S R D GT  L  E+
Sbjct  270  CADAAEAAIRKYGISMASPRSDSGTSELTVEV  301



>gb|ESZ96400.1| serine palmitoyltransferase 2 [Sclerotinia borealis F-4157]
Length=676

 Score =   129 bits (325),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 65/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F    + H +   GYA +    ++FY RRL
Sbjct  149  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKPESYRHLTAANGYAALNSDFDNFYVRRL  208

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RPI   P  +  +++R ++D NK  + T   T+ LNL SYNYLGFA S+  
Sbjct  209  KLRIDDCFARPITGVPGRYITLIDRKTDDFNKNYQYTGTYTETLNLSSYNYLGFAQSEGP  268

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +++K++  S+ S R D GT  L  E+
Sbjct  269  CADAVEETIKKYGISSASPRADSGTSDLALEV  300



>gb|KEQ94532.1| hypothetical protein AUEXF2481DRAFT_41119 [Aureobasidium subglaciale 
EXF-2481]
Length=672

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 3/150 (2%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRLYL  379
            PY+  LTT+FSY++L  FG  RDFF K F    + H S   GYAP+    ++FY RRL L
Sbjct  145  PYYFLLTTYFSYLVLIIFGHVRDFFGKRFKQEQYKHLSARDGYAPLNSDFDNFYIRRLQL  204

Query  380  RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCT  559
            RI DCF RPI   P  +  +++R S+D N + K T   T+ LN+ SYNYLGFA S+  C 
Sbjct  205  RINDCFRRPITGVPGRFITLLDRKSDDFNLSFKMTGTTTETLNMSSYNYLGFAQSEGECA  264

Query  560  PRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              V  + K++  S  S R D GT  LH E+
Sbjct  265  DAVEVATKKYGVSFASPRGDAGTSELHVEV  294



>emb|CEI86344.1| Putative Serine palmitoyl transferase subunit [Rhizopus microsporus]
Length=560

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 88/155 (57%), Gaps = 3/155 (2%)
 Frame = +2

Query  185  LPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLED  355
            L  KM   P F  ++T+ +Y +L  FG  RD   K+F    + H    +GYAP+    + 
Sbjct  82   LEQKMEAAPLFVLVSTYLNYFILIIFGHLRDILGKMFKHKKYAHLRATEGYAPLVSDFDS  141

Query  356  FYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGF  535
            FYTRR+Y+RI+DC+ RP+   P     ++ER S D N+T   T +  +  N  SYNYLGF
Sbjct  142  FYTRRMYMRIRDCWNRPMTGVPGRKIKILERESKDFNQTFSLTGRTIEATNFSSYNYLGF  201

Query  536  AASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLH  640
            A S+ YC  +V   +  +  S+ STR++ GTL +H
Sbjct  202  AQSEGYCADQVETCVNEYGLSSSSTRMEAGTLDIH  236



>gb|KFY85583.1| hypothetical protein V500_08288 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ03992.1| hypothetical protein V502_10499 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=678

 Score =   129 bits (325),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 66/159 (42%), Positives = 92/159 (58%), Gaps = 3/159 (2%)
 Frame = +2

Query  182  LLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLE  352
            L+   M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    +
Sbjct  144  LIEPVMDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFD  203

Query  353  DFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLG  532
            +FY RRL +RI DCF RP    P  +  +++R S+D N + + T   T+ LN+ SYNYLG
Sbjct  204  NFYVRRLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNLSFQFTGTFTETLNMSSYNYLG  263

Query  533  FAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            FA S+  C   V D++K++  S  S R D GT  L  E+
Sbjct  264  FAQSEGPCADAVEDTVKKYGISVASPRADAGTSDLVIEV  302



>gb|KIN04887.1| hypothetical protein OIDMADRAFT_115587 [Oidiodendron maius Zn]
Length=676

 Score =   129 bits (325),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 67/159 (42%), Positives = 93/159 (58%), Gaps = 3/159 (2%)
 Frame = +2

Query  182  LLPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLE  352
            L P  M E PYF  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    +
Sbjct  143  LRPPIMDEPPYFYLLTTYVSYLILIIFGHVRDFFGKRFKPNHYRHLKAANGYAALNSDFD  202

Query  353  DFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLG  532
            +FY RRL +R+ DCF RP    P  +  +++R SND N+T + T   T+ LN+ SYNYLG
Sbjct  203  NFYVRRLKMRLDDCFARPTTGVPGRYITLMDRKSNDFNETFQFTGTFTETLNMSSYNYLG  262

Query  533  FAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            FA S+  C   V ++++++  S  S R D GT  L  E+
Sbjct  263  FAQSEGPCADAVEETIRKYGISAASPRGDSGTSDLALEV  301



>ref|XP_006682145.1| hypothetical protein BATDEDRAFT_17918 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77112.1| hypothetical protein BATDEDRAFT_17918 [Batrachochytrium dendrobatidis 
JAM81]
Length=532

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 95/163 (58%), Gaps = 6/163 (4%)
 Frame = +2

Query  179  SLLPSK---MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPIC  340
            +LLP +   +   P  T +TT+ SY +L  FG  +D    I D   + H     GYAPI 
Sbjct  47   TLLPDEEQLLESAPLMTLVTTYISYFILIVFGHIQDLLGSILDPESFRHLRTQNGYAPIS  106

Query  341  LGLEDFYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSY  520
             G + FY RRLY+RI+DCF RPI + P     ++ER S D NKT + T K  + LNL SY
Sbjct  107  SGFDTFYHRRLYVRIRDCFNRPITNVPGGTVHLLERTSLDYNKTFQFTGKTREVLNLSSY  166

Query  521  NYLGFAASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            NYLGFA ++  C   V  ++K+    +CS R++ G++ LH+++
Sbjct  167  NYLGFAQNEGPCADAVQTAIKKNGLISCSPRLEAGSVELHSQV  209



>dbj|GAM40763.1| serine palmitoyltransferase [Talaromyces cellulolyticus]
Length=677

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  143  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFKEENYRHLKPRNGYGALNSDFDNFYVR  202

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D N+    T   T  LN+ SYNYLGFA S+
Sbjct  203  RLKLRINDCFERPVTGVPGRYITLIDRSTDDYNRHFYFTGTTTDTLNMSSYNYLGFAQSE  262

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++L+++  ST STR + GT  LH E+
Sbjct  263  GPCADAVEENLRKYGISTVSTRAEAGTCDLHVEV  296



>gb|KEQ84476.1| putative serine palmitoyltransferase 2 [Aureobasidium pullulans 
EXF-150]
Length=672

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 3/150 (2%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRLYL  379
            PY+  LTT+FSY++L  FG  RDFF K F    + H S   GYAP+    ++FY RRL L
Sbjct  145  PYYFLLTTYFSYLVLIIFGHVRDFFGKRFKQEQYKHLSARDGYAPLNSDFDNFYIRRLQL  204

Query  380  RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCT  559
            RI DCF RPI   P  +  +++R S+D N + K T   T+ LN+ SYNYLGFA S+  C 
Sbjct  205  RINDCFRRPITGVPGRFITLLDRKSDDFNLSFKMTGTTTETLNMSSYNYLGFAQSEGECA  264

Query  560  PRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              V  + K++  S  S R D GT  LH E+
Sbjct  265  DAVEVATKKYGVSFASPRGDAGTSELHVEV  294



>ref|XP_001744245.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90948.1| predicted protein [Monosiga brevicollis MX1]
Length=520

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 5/154 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRK-----IFDWCHSSNLQGYAPICLGLEDFYTR  367
            E P   A  T+ +Y LLF FG  RDF RK            + +  + P+    E FYTR
Sbjct  25   ETPLLVAFLTYLNYSLLFVFGHLRDFLRKHGIEKTKTAKELARMLHFPPLYRDFEAFYTR  84

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
             LY RI+DC+  PICS P A FD+VER +ND   T +RT ++ + +NLGSYNYLGFA + 
Sbjct  85   NLYTRIRDCWNLPICSVPGAEFDLVERRTNDYGWTFERTGEVNRYINLGSYNYLGFAENT  144

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C+   I+++ ++  S CS R + GT  LH E+
Sbjct  145  GVCSRESIEAIHKYGVSCCSARTEFGTTRLHEEV  178



>emb|CEG83280.1| Putative Serine palmitoyltransferase 2 [Rhizopus microsporus]
Length=563

 Score =   128 bits (321),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 88/155 (57%), Gaps = 3/155 (2%)
 Frame = +2

Query  185  LPSKMIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLED  355
            L  KM   P F  ++T+ +Y +L  FG  RD   KIF    + H    +GYAP+    + 
Sbjct  82   LEQKMEAAPLFVLVSTYLNYFILIIFGHLRDILGKIFKHKKYAHLRATEGYAPLVSDFDS  141

Query  356  FYTRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGF  535
            FYTRR+Y+RI+DC+ RP+   P     ++ER S D N+T   T +  +  N  SYNYLGF
Sbjct  142  FYTRRMYMRIRDCWNRPMTGVPGRKIKILERESKDFNQTFSLTGRTIEATNFSSYNYLGF  201

Query  536  AASDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLH  640
            A ++ YC  +V   +  +  S+ STR++ GTL +H
Sbjct  202  AQNEGYCADQVETCVNEYGLSSSSTRMEAGTLDIH  236



>gb|KEQ73715.1| serine palmitoyl transferase subunit 2 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=674

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 3/150 (2%)
 Frame = +2

Query  209  PYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRLYL  379
            PY+  LTT+FSY++L  FG  RDFF K F    + H S   GYAP+    ++FY RRL L
Sbjct  147  PYYFLLTTYFSYLVLIIFGHVRDFFGKRFKQEQYKHLSARDGYAPLNSDFDNFYIRRLQL  206

Query  380  RIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCT  559
            RI DCF RPI   P  +  +++R S+D N + K T   T+ LN+ SYNYLGFA S+  C 
Sbjct  207  RINDCFRRPITGVPGRFITLLDRKSDDFNLSFKMTGTTTETLNMSSYNYLGFAQSEGECA  266

Query  560  PRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              V  + K++  S  S R D GT  LH E+
Sbjct  267  DAVEVATKKYGVSFASPRGDAGTSELHVEV  296



>gb|ELQ39054.1| serine palmitoyltransferase 2 [Magnaporthe oryzae Y34]
 gb|ELQ63494.1| serine palmitoyltransferase 2 [Magnaporthe oryzae P131]
Length=639

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFF-RKIFDWCHSSNLQ---GYAPICLGLEDFYTRR  370
            E PY+  LTT+ SY++L   G  RDFF +++ +  H ++L+   GYAP+    ++FY RR
Sbjct  111  EPPYYYVLTTYISYLVLILVGHIRDFFGKRLGNPKHYASLKAANGYAPLNEDFDNFYVRR  170

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            L +R+ DCF RP    P  +  +++R SND N+T K T   T+ LN+ SYNYLGFA S+ 
Sbjct  171  LKMRLDDCFARPTVGVPGRYITLMDRTSNDFNRTYKYTGTHTETLNMSSYNYLGFAQSEG  230

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C   V + +KR+  S CS R DGGT  L  E+
Sbjct  231  TCADAVEECVKRYGLSFCSPRQDGGTSDLAIEV  263



>emb|CCD42541.1| similar to serine palmitoyltransferase 2 [Botrytis cinerea T4]
 gb|EMR85611.1| putative serine palmitoyltransferase 2 protein [Botrytis cinerea 
BcDW1]
Length=676

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 65/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F    + H +   GYA +    ++FY RRL
Sbjct  149  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKPEAYRHLTAANGYAALNSDFDNFYVRRL  208

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RPI   P  +  +++R ++D NK  + T   T+ LNL SYNYLGFA S+  
Sbjct  209  KLRIDDCFARPITGVPGRYITLIDRKTDDFNKNYQYTGTYTETLNLSSYNYLGFAQSEGP  268

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +++K++  S+ S R D GT  L  E+
Sbjct  269  CADAVEETIKKYGISSASPRADSGTSDLALEV  300



>ref|XP_007832647.1| Serine palmitoyltransferase 2 [Pestalotiopsis fici W106-1]
 gb|ETS83999.1| Serine palmitoyltransferase 2 [Pestalotiopsis fici W106-1]
Length=666

 Score =   129 bits (323),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 66/153 (43%), Positives = 89/153 (58%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFD----WCHSSNLQGYAPICLGLEDFYTRR  370
            E PY+  LTT+ SY+LL A G  RDFF K F     +     + GYAP+    + FY RR
Sbjct  139  EPPYYFVLTTYISYLLLIALGHVRDFFGKRFSKNPMYKSVKPINGYAPLTDDFDSFYVRR  198

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            L LRI DCF RP    P  +  +++RVS+D N++ K T   T+ LN+ SYNYLGFA S+ 
Sbjct  199  LKLRIDDCFARPTTGVPGRYITLMDRVSSDYNRSYKFTGSHTETLNMSSYNYLGFAQSEG  258

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C   V + ++++  S CS R D GT  L  E+
Sbjct  259  PCADAVEECVRKYGLSFCSPRGDVGTSDLAVEV  291



>ref|XP_003712740.1| serine palmitoyltransferase 2 [Magnaporthe oryzae 70-15]
 gb|EHA52933.1| serine palmitoyltransferase 2 [Magnaporthe oryzae 70-15]
Length=654

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 94/153 (61%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFF-RKIFDWCHSSNLQ---GYAPICLGLEDFYTRR  370
            E PY+  LTT+ SY++L   G  RDFF +++ +  H ++L+   GYAP+    ++FY RR
Sbjct  126  EPPYYYVLTTYISYLVLILVGHIRDFFGKRLGNPKHYASLKAANGYAPLNEDFDNFYVRR  185

Query  371  LYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDE  550
            L +R+ DCF RP    P  +  +++R SND N+T K T   T+ LN+ SYNYLGFA S+ 
Sbjct  186  LKMRLDDCFARPTVGVPGRYITLMDRTSNDFNRTYKYTGTHTETLNMSSYNYLGFAQSEG  245

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C   V + +KR+  S CS R DGGT  L  E+
Sbjct  246  TCADAVEECVKRYGLSFCSPRQDGGTSDLAIEV  278



>gb|KFY10100.1| hypothetical protein V492_05191 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY30103.1| hypothetical protein V494_08264 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=681

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY R
Sbjct  152  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFYVR  211

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL +RI DCF RP    P  +  +++R S+D N++ + T   T+ LN+ SYNYLGFA S+
Sbjct  212  RLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNQSFQFTGTFTETLNMSSYNYLGFAQSE  271

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S  S R D GT  L  E+
Sbjct  272  GPCADAVEETVKKYGISVASPRADAGTSDLVMEV  305



>ref|XP_005820282.1| hypothetical protein GUITHDRAFT_98377 [Guillardia theta CCMP2712]
 gb|EKX33302.1| hypothetical protein GUITHDRAFT_98377 [Guillardia theta CCMP2712]
Length=694

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 67/156 (43%), Positives = 87/156 (56%), Gaps = 10/156 (6%)
 Frame = +2

Query  206  IPYFTALTTFFSYILLFAFGQFRDFFRKIFDWC-------HSSNLQGYAPICLGLEDFYT  364
            +P+  ALTT+FSY +L  FG  RD    +   C        S   +G+A +    +DFYT
Sbjct  60   VPWIAALTTYFSYAILMVFGTLRDAVFNVM--CVVDPGRYRSPTPKGFAKLMNDFQDFYT  117

Query  365  RRLYLRIQDCFGRPICSPPDAWFDVVER-VSNDNNKTLKRTTKITKCLNLGSYNYLGFAA  541
            RRLY RIQDCF RPI S P AW DV+ER  +N    T++ T      LNL SYNYLGFA 
Sbjct  118  RRLYHRIQDCFNRPISSAPGAWIDVIEREFANAEMSTMRHTGSHVTALNLSSYNYLGFAE  177

Query  542  SDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            SD      V+ S++R      S+R + GT  +H E+
Sbjct  178  SDLEMRDEVVSSMRRLGVGNASSRTELGTTDVHHEL  213



>gb|KFY12487.1| hypothetical protein V491_06778 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=681

 Score =   129 bits (324),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY R
Sbjct  152  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFYVR  211

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL +RI DCF RP    P  +  +++R S+D N++ + T   T+ LN+ SYNYLGFA S+
Sbjct  212  RLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNQSFQFTGTFTETLNMSSYNYLGFAQSE  271

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S  S R D GT  L  E+
Sbjct  272  GPCADAVEETVKKYGISVASPRADAGTSDLVIEV  305



>ref|XP_002287833.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95276.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=622

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 89/153 (58%), Gaps = 4/153 (3%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQGYAPICLGLEDFYTRRLYLR  382
            +I  F A+TT+  YI+L   G  RD          S +L  YAP+    E+FYTRRLY R
Sbjct  144  DITIFAAITTYLGYIVLIITGHIRDISVANTGNYPSDDLTKYAPLLKSWENFYTRRLYHR  203

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTK---ITKCLNLGSYNYLGFAAS-DE  550
            IQDCF RPI S P A   V+ERVS D NKT+  T+    + +CLNLGSYNYLGFA   D 
Sbjct  204  IQDCFNRPIASRPSAIISVLERVSFDGNKTMSETSDGRVVRRCLNLGSYNYLGFADDWDI  263

Query  551  YCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
             C   V+ SL     S  S+R++ GT  LH E+
Sbjct  264  TCRKGVMGSLDVLPSSVGSSRLEFGTTKLHREV  296



>ref|XP_001587396.1| hypothetical protein SS1G_11388 [Sclerotinia sclerotiorum 1980]
 gb|EDN95510.1| hypothetical protein SS1G_11388 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=676

 Score =   129 bits (323),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F    + H +   GYA +    ++FY RRL
Sbjct  149  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKPESYRHLTAADGYAALNSDFDNFYVRRL  208

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RP+   P  +  +++R ++D NK  + T   T+ LNL SYNYLGFA S+  
Sbjct  209  KLRIDDCFARPVTGVPGRYITLIDRKTDDFNKNYQFTGTFTETLNLSSYNYLGFAQSEGP  268

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +++K++  S+ S R D GT  L  E+
Sbjct  269  CADAVEETIKKYGISSASPRADAGTSELALEV  300



>gb|EMF15033.1| PLP-dependent transferase [Sphaerulina musiva SO2202]
Length=695

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  +TT+ SY++L  FG  RDFF K F   H   L+   GYAP+    ++FY RRL
Sbjct  166  EPPYYFLITTYISYLILIIFGHVRDFFGKRFKPDHYKQLREHDGYAPLNSDFDNFYIRRL  225

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RP+   P  +  +++R S+D+N + K T   T+ LN+ SYNYLGFA S+  
Sbjct  226  QLRINDCFRRPVTGVPGRFITLLDRTSDDHNLSFKLTGTTTQTLNMSSYNYLGFAQSEGE  285

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C       LK++  S CS R D GT  LH ++
Sbjct  286  CADEAERVLKKYGISYCSPRGDVGTSDLHVDV  317



>ref|XP_001269083.1| serine palmitoyltransferase 2, putative [Aspergillus clavatus 
NRRL 1]
 gb|EAW07657.1| serine palmitoyltransferase 2, putative [Aspergillus clavatus 
NRRL 1]
Length=676

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F    + H     GY  +    ++FY R
Sbjct  147  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREESYRHLKPRNGYGALNSDFDNFYVR  206

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  207  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYFTGTTTDTLNLSSYNYLGFAQSE  266

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++++++  S  STR + GT  LH E+
Sbjct  267  GPCADLVEETIRKYGISAPSTRAEVGTQDLHAEV  300



>ref|XP_011127662.1| hypothetical protein AOL_s00215g158 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX43422.1| hypothetical protein AOL_s00215g158 [Arthrobotrys oligospora 
ATCC 24927]
Length=648

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 87/151 (58%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PYF   TT+FSY++L  FG  RDFF K F     +NL+   GYA +    ++FY RRL
Sbjct  124  EPPYFIMFTTYFSYLILIIFGHVRDFFGKRFRSSKYTNLKAQNGYAALNSDFDNFYVRRL  183

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
              R+ DCF RPI   P  +  ++ R S D N T   T +  + LN+ SYNYLGFA S+  
Sbjct  184  KKRLDDCFSRPITGVPGRYITLLGRESKDYNDTFNMTGEKIETLNMSSYNYLGFAQSEGP  243

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
            C     +S++++  S   TR DGGTL LH +
Sbjct  244  CADASEESIRKYGVSAAGTRSDGGTLDLHVD  274



>emb|CCX10037.1| Similar to Serine palmitoyltransferase 2; acc. no. Q09925 [Pyronema 
omphalodes CBS 100304]
Length=669

 Score =   128 bits (321),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 63/152 (41%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E P +  +TT+ SY++L  FG  RD+F K F     S+L+   GYAP+    ++FY RRL
Sbjct  144  EPPQYYFVTTYISYLILIIFGHVRDWFGKRFKEKKYSHLKIQNGYAPLNDDFDNFYVRRL  203

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RPI   P  + ++++R SND+N T K T   T+ LN+ SYNYLGFA S+  
Sbjct  204  KVRINDCFARPITGVPGRYINLLDRTSNDHNATFKLTGTTTETLNMSSYNYLGFAQSNGP  263

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V ++ +++  ++ S R D GTL L  ++
Sbjct  264  CADAVEEATRKYGMTSASGRADAGTLDLTADV  295



>gb|AAP47107.1| serine palmitoyl transferase subunit [Aspergillus nidulans]
Length=580

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  +TT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  51   MDEPPYYYLITTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYAALNSDFDNFYVR  110

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  111  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKNFYLTGTTTDTLNLSSYNYLGFAQSE  170

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     ++++++  +  STR + GT  LH E+
Sbjct  171  GPCADITEETIRKYGITPVSTRAEVGTQDLHVEL  204



>ref|XP_007923404.1| hypothetical protein MYCFIDRAFT_186373 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME85962.1| hypothetical protein MYCFIDRAFT_186373 [Pseudocercospora fijiensis 
CIRAD86]
Length=632

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PY+  +TT+ SY++L  FG  RDFF K F   H   L+   GYAP+    ++FY RRL
Sbjct  103  EPPYYYLITTYISYLILIIFGHVRDFFGKRFRPEHYKQLKEHDGYAPLNSDFDNFYIRRL  162

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RP+   P  +  +++R S+D N + K T   T+ LN+ SYNYLGFA S+  
Sbjct  163  QLRINDCFRRPVTGVPGRFITLLDRKSDDYNLSFKLTGTTTQTLNMSSYNYLGFAQSEGE  222

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C      +L+++  S CS R D GT  LH ++
Sbjct  223  CADEAEKTLRKYGISFCSPRADIGTSDLHVDV  254



>gb|KHJ31935.1| putative serine palmitoyltransferase 2 [Erysiphe necator]
Length=679

 Score =   128 bits (321),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 64/152 (42%), Positives = 88/152 (58%), Gaps = 3/152 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLEDFYTRRL  373
            E PY+  LTT+ SY++L  FG  RDFF K F    + H     GYA +    ++FY RRL
Sbjct  152  EPPYYYLLTTYISYLVLIIFGHVRDFFGKRFKPERYKHLKAANGYAALNSDFDNFYVRRL  211

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             LRI DCF RP    P  +  +++R +ND NK  + T  +T+ LN+ SYNYLGFA S+  
Sbjct  212  KLRIDDCFARPTTGVPGRYITLIDRETNDYNKHYRLTGTLTETLNMSSYNYLGFAQSEGP  271

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            C   V +S++++  S  S R D GT  L  E+
Sbjct  272  CADAVEESIRKYGTSVASPRADAGTSELALEV  303



>gb|KGO46532.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium expansum]
 gb|KGO50287.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium expansum]
 gb|KGO71506.1| Pyridoxal phosphate-dependent transferase, major region, subdomain 
2 [Penicillium expansum]
Length=671

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 89/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  142  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRDGYGALNSDFDNFYVR  201

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P     +++R ++D+N+    T   T  LNL SYNYLGFA SD
Sbjct  202  RLKLRINDCFERPVTGVPGRTITLIDRGTDDHNQHFFLTGTTTDTLNLSSYNYLGFAQSD  261

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     DS+K++  +  STR + GT  LH E+
Sbjct  262  GPCADIAEDSIKKYGIAAPSTRAESGTQDLHVEV  295



>ref|XP_001818901.1| serine palmitoyltransferase 2 [Aspergillus oryzae RIB40]
 ref|XP_002380337.1| serine palmitoyltransferase 2, putative [Aspergillus flavus NRRL3357]
 dbj|BAE56899.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED49956.1| serine palmitoyltransferase 2, putative [Aspergillus flavus NRRL3357]
 gb|EIT83438.1| serine palmitoyltransferase [Aspergillus oryzae 3.042]
 gb|KDE77308.1| serine palmitoyltransferase [Aspergillus oryzae 100-8]
Length=673

 Score =   127 bits (320),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  145  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYGALNSDFDNFYVR  204

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  205  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYFTGTTTDTLNLSSYNYLGFAQSE  264

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     +S++++  +  STR + GT  LH E+
Sbjct  265  GPCADLAEESIRKYGITAPSTRAEVGTQDLHMEV  298



>ref|XP_002484864.1| serine palmitoyltransferase 2, putative [Talaromyces stipitatus 
ATCC 10500]
 gb|EED14911.1| serine palmitoyltransferase 2, putative [Talaromyces stipitatus 
ATCC 10500]
Length=673

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  139  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFKEENYRHLKPRNGYGALNSDFDNFYVR  198

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D N+    T   T  LN+ SYNYLGFA S+
Sbjct  199  RLKLRINDCFERPVTGVPGRYITLIDRGTDDYNRHFYFTGTTTDTLNMSSYNYLGFAQSE  258

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V ++ +++  ST STR + GT  LH E+
Sbjct  259  GPCADAVEENTRKYGISTVSTRAEAGTTDLHVEV  292



>emb|CDM28758.1| Serine palmitoyltransferase 2 [Penicillium roqueforti FM164]
Length=671

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   H  +L+   GY  +    ++FY R
Sbjct  142  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREEHYRHLKPRNGYGALNSDFDNFYVR  201

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P     +++R ++D+N+    T   T  LNL SYNYLGFA SD
Sbjct  202  RLKLRINDCFERPVTGVPGRTITLIDRATDDHNQHFFLTGTTTDTLNLSSYNYLGFAQSD  261

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     +S+K++  +  STR + GT  +H E+
Sbjct  262  GPCADLAEESIKKYGIAAPSTRAESGTQDMHLEV  295



>ref|XP_658706.1| hypothetical protein AN1102.2 [Aspergillus nidulans FGSC A4]
 gb|EAA66220.1| hypothetical protein AN1102.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF88137.1| TPA: Serine palmitoyl transferase subunit [Source:UniProtKB/TrEMBL;Acc:Q7ZA40] 
[Aspergillus nidulans FGSC A4]
Length=672

 Score =   127 bits (320),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 63/154 (41%), Positives = 91/154 (59%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  +TT+ SY++L AFG  RDFF K F   ++ H     GYA +    ++FY R
Sbjct  143  MDEPPYYYLITTYISYLILIAFGHVRDFFGKRFREENYRHLKPRNGYAALNSDFDNFYVR  202

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  203  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKNFYLTGTTTDTLNLSSYNYLGFAQSE  262

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     ++++++  +  STR + GT  LH E+
Sbjct  263  GPCADITEETIRKYGITPVSTRAEVGTQDLHVEL  296



>gb|KFX90109.1| hypothetical protein V490_06649 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX99522.1| hypothetical protein O988_03823 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY48651.1| hypothetical protein V495_01164 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY67183.1| hypothetical protein V497_00523 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=680

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L  FG  RDFF K F   H  +L+   GYA +    ++FY R
Sbjct  151  MDEPPYYYLLTTYLSYLILIVFGHVRDFFGKRFRPLHYKHLKSANGYAALNSDFDNFYVR  210

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL +RI DCF RP    P  +  +++R S+D N + + T   T+ LN+ SYNYLGFA S+
Sbjct  211  RLKMRINDCFSRPTTGVPGRYITLIDRKSDDFNLSFQFTGTFTETLNMSSYNYLGFAQSE  270

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C   V +++K++  S  S R D GT  L  E+
Sbjct  271  GPCADAVEETVKKYGISVASPRADAGTSDLVIEV  304



>ref|XP_001392526.1| serine palmitoyltransferase 2 [Aspergillus niger CBS 513.88]
 emb|CAK39912.1| unnamed protein product [Aspergillus niger]
Length=676

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  149  MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPQNGYGALNSDFDNFYVR  208

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  209  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYFTGTTTDTLNLSSYNYLGFAQSE  268

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     DS++++   + STR + G+  LH E+
Sbjct  269  GPCADIAEDSIRKYGIVSPSTRAEVGSQDLHVEV  302



>ref|XP_004349889.1| serine palmitoyltransferase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89979.1| serine palmitoyltransferase [Capsaspora owczarzaki ATCC 30864]
Length=508

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 90/156 (58%), Gaps = 10/156 (6%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWC-------HSSNLQGYAPICLGLEDFY  361
            E P  TA+ T+  Y +L  FG FRDF R   DW          + +QG+ P+    E FY
Sbjct  23   ETPLRTAIWTYLGYAILILFGHFRDFLR---DWGIEKTKFKRETGMQGFVPLFADFEAFY  79

Query  362  TRRLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAA  541
            TR LY+RI+DC+ RPI S P + FDV+ER ++D N   + T +    LNLGSYNYLGFA 
Sbjct  80   TRNLYMRIRDCWNRPISSVPGSHFDVLERATDDYNWNFRMTGRKIPLLNLGSYNYLGFAQ  139

Query  542  SDEYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
            ++  C      +++ +  ++ S+R + GT  LH ++
Sbjct  140  NEGPCADAAAQAIREYGVASASSRTELGTSELHVKL  175



>ref|XP_008712701.1| hypothetical protein HMPREF1541_09806 [Cyphellophora europaea 
CBS 101466]
 gb|ETN44931.1| hypothetical protein HMPREF1541_09806 [Cyphellophora europaea 
CBS 101466]
Length=684

 Score =   127 bits (319),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 87/151 (58%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  EIPYFTALTTFFSYILLFAFGQFRDFFRKIFDWCHSSNLQ---GYAPICLGLEDFYTRRL  373
            E PYF  LTT+ SY++L  FG  RDFF   F      NL+   GYA +    ++FY RRL
Sbjct  153  EPPYFYLLTTYISYLILIIFGHVRDFFGMKFKEDKYRNLKARNGYAALNSDFDNFYVRRL  212

Query  374  YLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEY  553
             +RI DCF RP    P  + ++++R S+D N   K T   T+ LN+ SYNYLGFA S+  
Sbjct  213  KMRINDCFNRPTTGVPGRYINLLDRTSDDGNFHFKMTGTTTETLNVSSYNYLGFAQSEGP  272

Query  554  CTPRVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
            C   V + ++R   STCS+R D GT  +  E
Sbjct  273  CADAVEEVIRRNGLSTCSSRADAGTTDMAIE  303



>gb|EHA18026.1| hypothetical protein ASPNIDRAFT_208165 [Aspergillus niger ATCC 
1015]
Length=578

 Score =   126 bits (317),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +2

Query  197  MIEIPYFTALTTFFSYILLFAFGQFRDFFRKIF---DWCHSSNLQGYAPICLGLEDFYTR  367
            M E PY+  LTT+ SY++L AFG  RDFF K F   ++ H     GY  +    ++FY R
Sbjct  51   MDEPPYYYLLTTYISYLILIAFGHVRDFFGKRFREENYRHLKPQNGYGALNSDFDNFYVR  110

Query  368  RLYLRIQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASD  547
            RL LRI DCF RP+   P  +  +++R ++D+NK    T   T  LNL SYNYLGFA S+
Sbjct  111  RLKLRINDCFERPVTGVPGRYITLIDRATDDHNKHFYFTGTTTDTLNLSSYNYLGFAQSE  170

Query  548  EYCTPRVIDSLKRFSPSTCSTRVDGGTLSLHTEI  649
              C     DS++++   + STR + G+  LH E+
Sbjct  171  GPCADIAEDSIRKYGIVSPSTRAEVGSQDLHVEV  204



>emb|CCJ29014.1| unnamed protein product [Pneumocystis jirovecii]
Length=665

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 85/148 (57%), Gaps = 3/148 (2%)
 Frame = +2

Query  212  YFTALTTFFSYILLFAFGQFRDFFRKIFD---WCHSSNLQGYAPICLGLEDFYTRRLYLR  382
            Y+  +TT+FSY++L   G  RDFF K F    +CH     GYA +    ++FY RRL +R
Sbjct  152  YYYLITTYFSYLILIILGHIRDFFGKRFKKQKYCHLRAHDGYAALNSDFDNFYIRRLKMR  211

Query  383  IQDCFGRPICSPPDAWFDVVERVSNDNNKTLKRTTKITKCLNLGSYNYLGFAASDEYCTP  562
            + DCF RP    P     ++ERVS D N+T   T    +CLNL SYNYLGFA S   C  
Sbjct  212  LNDCFSRPTTGVPGRMITLIERVSYDYNETFTFTGNFVECLNLSSYNYLGFAQSSGPCAD  271

Query  563  RVIDSLKRFSPSTCSTRVDGGTLSLHTE  646
             V + +K++  S+C  R D GTL LH +
Sbjct  272  FVEEVIKKWKFSSCGARSDAGTLDLHVQ  299



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500