BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035K11

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796337.1|  PREDICTED: aminoacylase-1                          232   5e-70   Nicotiana sylvestris
dbj|BAQ00430.1|  putative aminoacylase                                  232   6e-70   Nicotiana tabacum [American tobacco]
ref|XP_009620561.1|  PREDICTED: aminoacylase-1                          231   2e-69   Nicotiana tomentosiformis
ref|XP_011092917.1|  PREDICTED: aminoacylase-1 isoform X2               229   7e-69   Sesamum indicum [beniseed]
ref|XP_011092916.1|  PREDICTED: aminoacylase-1 isoform X1               229   7e-69   
dbj|BAO98754.1|  putative aminoacylase                                  229   9e-69   Nicotiana benthamiana
gb|EYU40489.1|  hypothetical protein MIMGU_mgv1a005945mg                229   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_004231104.1|  PREDICTED: aminoacylase-1                          223   2e-66   
ref|XP_006364339.1|  PREDICTED: aminoacylase-1-like                     222   4e-66   Solanum tuberosum [potatoes]
ref|XP_010093337.1|  hypothetical protein L484_002939                   220   5e-65   
ref|XP_010690576.1|  PREDICTED: aminoacylase-1-like isoform X2          218   5e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690575.1|  PREDICTED: aminoacylase-1-like isoform X1          218   2e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010645690.1|  PREDICTED: aminoacylase-1 isoform X2               218   3e-64   Vitis vinifera
ref|XP_002283140.2|  PREDICTED: aminoacylase-1 isoform X1               218   3e-64   Vitis vinifera
emb|CDP14501.1|  unnamed protein product                                216   2e-63   Coffea canephora [robusta coffee]
ref|XP_008448158.1|  PREDICTED: aminoacylase-1                          215   2e-63   Cucumis melo [Oriental melon]
ref|XP_010690579.1|  PREDICTED: aminoacylase-1-like isoform X2          215   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690578.1|  PREDICTED: aminoacylase-1-like isoform X1          214   4e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004139978.1|  PREDICTED: aminoacylase-1-like                     213   1e-62   Cucumis sativus [cucumbers]
ref|XP_010690577.1|  PREDICTED: aminoacylase-1-like                     212   3e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008382744.1|  PREDICTED: aminoacylase-1-like                     211   1e-61   
ref|XP_010690574.1|  PREDICTED: aminoacylase-1-like                     211   1e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010431749.1|  PREDICTED: aminoacylase-1-like                     208   8e-61   
gb|EPS64004.1|  hypothetical protein M569_10775                         207   1e-60   Genlisea aurea
ref|XP_009358898.1|  PREDICTED: aminoacylase-1-like isoform X2          207   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_010436914.1|  PREDICTED: aminoacylase-1-like isoform X2          207   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009358896.1|  PREDICTED: aminoacylase-1-like isoform X1          207   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_010436913.1|  PREDICTED: aminoacylase-1-like isoform X1          207   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010431748.1|  PREDICTED: aminoacylase-1-like isoform X2          207   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010431747.1|  PREDICTED: aminoacylase-1-like isoform X1          207   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009340791.1|  PREDICTED: aminoacylase-1-like isoform X1          207   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_009340792.1|  PREDICTED: aminoacylase-1-like isoform X2          207   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_010270552.1|  PREDICTED: aminoacylase-1                          207   3e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010446323.1|  PREDICTED: aminoacylase-1-like                     206   6e-60   
ref|XP_006284995.1|  hypothetical protein CARUB_v10006302mg             204   2e-59   Capsella rubella
ref|XP_008235829.1|  PREDICTED: aminoacylase-1 isoform X2               202   1e-58   Prunus mume [ume]
ref|XP_007201041.1|  hypothetical protein PRUPE_ppa005858mg             202   1e-58   Prunus persica
ref|XP_006384867.1|  aminoacylase family protein                        203   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011040830.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     203   1e-58   Populus euphratica
ref|XP_008235828.1|  PREDICTED: aminoacylase-1 isoform X1               202   1e-58   Prunus mume [ume]
gb|KDO68371.1|  hypothetical protein CISIN_1g013216mg                   200   1e-58   Citrus sinensis [apfelsine]
gb|KJB79747.1|  hypothetical protein B456_013G064900                    198   1e-58   Gossypium raimondii
dbj|BAH56753.1|  AT4G38220                                              201   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KDP47023.1|  hypothetical protein JCGZ_10750                         202   2e-58   Jatropha curcas
gb|ABK94846.1|  unknown                                                 202   2e-58   Populus trichocarpa [western balsam poplar]
ref|NP_849516.1|  peptidase M20/M25/M40 family protein                  201   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002312793.2|  aminoacylase family protein                        202   3e-58   Populus trichocarpa [western balsam poplar]
ref|NP_568036.2|  peptidase M20/M25/M40 family protein                  201   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422413.1|  hypothetical protein CICLE_v10028440mg             201   7e-58   Citrus clementina [clementine]
ref|XP_006486586.1|  PREDICTED: aminoacylase-1-like isoform X2          201   7e-58   Citrus sinensis [apfelsine]
ref|XP_006486585.1|  PREDICTED: aminoacylase-1-like isoform X1          201   7e-58   Citrus sinensis [apfelsine]
ref|XP_006422412.1|  hypothetical protein CICLE_v10028440mg             200   8e-58   Citrus clementina [clementine]
ref|XP_008347555.1|  PREDICTED: aminoacylase-1-like                     200   1e-57   
gb|KJB79749.1|  hypothetical protein B456_013G064900                    199   1e-57   Gossypium raimondii
gb|KFK30433.1|  hypothetical protein AALP_AA7G260300                    199   2e-57   Arabis alpina [alpine rockcress]
gb|KFK30432.1|  hypothetical protein AALP_AA7G260300                    199   2e-57   Arabis alpina [alpine rockcress]
gb|KJB79748.1|  hypothetical protein B456_013G064900                    198   3e-57   Gossypium raimondii
ref|XP_011000859.1|  PREDICTED: aminoacylase-1-like                     200   3e-57   Populus euphratica
gb|KJB79746.1|  hypothetical protein B456_013G064900                    198   7e-57   Gossypium raimondii
ref|XP_010932091.1|  PREDICTED: aminoacylase-1                          198   7e-57   Elaeis guineensis
gb|KHG04612.1|  Aminoacylase-1                                          198   9e-57   Gossypium arboreum [tree cotton]
ref|XP_007043101.1|  Peptidase M20/M25/M40 family protein isoform 2     197   1e-56   
ref|XP_007043100.1|  Peptidase M20/M25/M40 family protein isoform 1     197   2e-56   
emb|CDY59101.1|  BnaCnng34250D                                          196   3e-56   Brassica napus [oilseed rape]
emb|CDY71051.1|  BnaCnng71090D                                          196   3e-56   Brassica napus [oilseed rape]
gb|KJB77467.1|  hypothetical protein B456_012G138500                    194   3e-56   Gossypium raimondii
ref|XP_006849977.1|  hypothetical protein AMTR_s00022p00154990          192   3e-56   
emb|CAB37562.1|  putative protein                                       201   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011458107.1|  PREDICTED: aminoacylase-1 isoform X2               196   4e-56   Fragaria vesca subsp. vesca
ref|XP_004290084.1|  PREDICTED: aminoacylase-1 isoform X1               196   5e-56   Fragaria vesca subsp. vesca
ref|XP_009132387.1|  PREDICTED: aminoacylase-1B-like isoform X2         195   5e-56   Brassica rapa
ref|XP_009125879.1|  PREDICTED: aminoacylase-1B-like isoform X1         195   6e-56   Brassica rapa
ref|XP_010555164.1|  PREDICTED: aminoacylase-1 isoform X1               197   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_010555165.1|  PREDICTED: aminoacylase-1 isoform X2               197   6e-56   Tarenaya hassleriana [spider flower]
ref|XP_009101955.1|  PREDICTED: aminoacylase-1B                         194   2e-55   Brassica rapa
emb|CDY54793.1|  BnaA06g40880D                                          194   2e-55   Brassica napus [oilseed rape]
ref|XP_006411609.1|  hypothetical protein EUTSA_v10025205mg             194   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_006411610.1|  hypothetical protein EUTSA_v10025205mg             194   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_002866787.1|  hypothetical protein ARALYDRAFT_327784             199   2e-55   
gb|KJB77468.1|  hypothetical protein B456_012G138500                    194   2e-55   Gossypium raimondii
gb|KJB77466.1|  hypothetical protein B456_012G138500                    194   3e-55   Gossypium raimondii
ref|XP_002514407.1|  Aminoacylase-1, putative                           194   3e-55   Ricinus communis
gb|KHG17235.1|  Aminoacylase-1                                          193   6e-55   Gossypium arboreum [tree cotton]
ref|XP_010028870.1|  PREDICTED: aminoacylase-1                          192   1e-54   Eucalyptus grandis [rose gum]
gb|KJB31968.1|  hypothetical protein B456_005G216200                    192   1e-54   Gossypium raimondii
gb|KHG16687.1|  Aminoacylase-1                                          192   2e-54   Gossypium arboreum [tree cotton]
ref|XP_009114684.1|  PREDICTED: aminoacylase-1-like                     182   4e-54   
ref|XP_006659580.1|  PREDICTED: aminoacylase-1-like                     191   4e-54   Oryza brachyantha
ref|XP_009390654.1|  PREDICTED: aminoacylase-1                          191   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879550.1|  hypothetical protein ARALYDRAFT_345276             189   6e-54   
ref|XP_004973884.1|  PREDICTED: aminoacylase-1-like                     190   8e-54   Setaria italica
ref|XP_006830441.1|  hypothetical protein AMTR_s00351p00009890          190   9e-54   
ref|XP_008787044.1|  PREDICTED: aminoacylase-1 isoform X2               188   1e-53   Phoenix dactylifera
ref|XP_006605409.1|  PREDICTED: aminoacylase-1 isoform X2               189   1e-53   Glycine max [soybeans]
ref|XP_003556753.1|  PREDICTED: aminoacylase-1 isoform X1               189   2e-53   Glycine max [soybeans]
gb|EEC83866.1|  hypothetical protein OsI_29850                          189   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_008787043.1|  PREDICTED: aminoacylase-1 isoform X1               188   8e-53   Phoenix dactylifera
ref|XP_007153022.1|  hypothetical protein PHAVU_003G001200g             187   1e-52   Phaseolus vulgaris [French bean]
ref|XP_010505050.1|  PREDICTED: aminoacylase-1-like isoform X2          186   1e-52   
ref|XP_010505049.1|  PREDICTED: aminoacylase-1-like isoform X1          186   2e-52   Camelina sativa [gold-of-pleasure]
ref|XP_006410701.1|  hypothetical protein EUTSA_v10016717mg             185   4e-52   
emb|CDX79602.1|  BnaC03g19380D                                          184   4e-52   
ref|NP_001148589.1|  aminoacylase-1 precursor                           185   7e-52   Zea mays [maize]
tpg|DAA47999.1|  TPA: aminoacylase-1                                    184   9e-52   
ref|XP_002444759.1|  hypothetical protein SORBIDRAFT_07g027550          185   9e-52   Sorghum bicolor [broomcorn]
ref|XP_006295657.1|  hypothetical protein CARUB_v10024772mg             183   2e-51   
emb|CDY65765.1|  BnaA03g56420D                                          182   2e-51   Brassica napus [oilseed rape]
ref|XP_010509616.1|  PREDICTED: aminoacylase-1-like                     182   3e-51   Camelina sativa [gold-of-pleasure]
dbj|BAD10058.1|  putative aminoacylase                                  182   9e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003589763.1|  Aminoacylase-1                                     179   7e-50   Medicago truncatula
ref|XP_003572375.1|  PREDICTED: aminoacylase-1                          179   1e-49   Brachypodium distachyon [annual false brome]
dbj|BAK06600.1|  predicted protein                                      178   2e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADE76225.1|  unknown                                                 178   3e-49   Picea sitchensis
ref|XP_004498100.1|  PREDICTED: aminoacylase-1-like isoform X1          177   9e-49   Cicer arietinum [garbanzo]
ref|XP_004498101.1|  PREDICTED: aminoacylase-1-like isoform X2          177   9e-49   Cicer arietinum [garbanzo]
ref|XP_001760477.1|  predicted protein                                  172   6e-47   
ref|XP_002879551.1|  hypothetical protein ARALYDRAFT_902649             170   3e-46   
ref|XP_010479044.1|  PREDICTED: aminoacylase-1                          169   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010500137.1|  PREDICTED: aminoacylase-1-like                     169   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006307424.1|  hypothetical protein CARUB_v10009048mg             167   4e-45   
ref|XP_010500161.1|  PREDICTED: aminoacylase-1-like                     166   7e-45   Camelina sativa [gold-of-pleasure]
gb|KFK35784.1|  hypothetical protein AALP_AA4G036200                    166   1e-44   Arabis alpina [alpine rockcress]
gb|KFK42003.1|  hypothetical protein AALP_AA2G199700                    166   1e-44   Arabis alpina [alpine rockcress]
ref|XP_004964909.1|  PREDICTED: aminoacylase-1-like                     166   1e-44   Setaria italica
ref|XP_002893983.1|  hypothetical protein ARALYDRAFT_473806             164   3e-44   
ref|XP_004292687.1|  PREDICTED: aminoacylase-1                          164   4e-44   Fragaria vesca subsp. vesca
ref|XP_004138118.1|  PREDICTED: aminoacylase-1-like                     164   4e-44   
ref|XP_004166496.1|  PREDICTED: aminoacylase-1-like                     164   5e-44   
ref|XP_010091376.1|  hypothetical protein L484_020178                   163   6e-44   
ref|XP_002965773.1|  hypothetical protein SELMODRAFT_406809             164   7e-44   Selaginella moellendorffii
ref|XP_002984445.1|  hypothetical protein SELMODRAFT_120255             164   7e-44   Selaginella moellendorffii
gb|KDO80708.1|  hypothetical protein CISIN_1g013641mg                   163   8e-44   Citrus sinensis [apfelsine]
ref|XP_010461453.1|  PREDICTED: aminoacylase-1-like                     163   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002891296.1|  hypothetical protein ARALYDRAFT_473822             163   1e-43   
dbj|BAE99837.1|  aminoacylase like protein                              162   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472753.1|  PREDICTED: aminoacylase-1-like                     163   1e-43   Citrus sinensis [apfelsine]
ref|NP_175103.2|  peptidase M20/M25/M40 family protein                  162   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002285843.1|  PREDICTED: aminoacylase-1                          163   1e-43   Vitis vinifera
ref|XP_010063988.1|  PREDICTED: aminoacylase-1 isoform X2               162   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010063989.1|  PREDICTED: aminoacylase-1 isoform X3               162   3e-43   Eucalyptus grandis [rose gum]
gb|ACN33832.1|  unknown                                                 161   4e-43   Zea mays [maize]
ref|XP_007019016.1|  Peptidase M20/M25/M40 family protein isoform 2     159   4e-43   
ref|NP_001150325.1|  aminoacylase-1 precursor                           161   4e-43   
ref|XP_007141069.1|  hypothetical protein PHAVU_008G164800g             159   4e-43   Phaseolus vulgaris [French bean]
ref|XP_007222264.1|  hypothetical protein PRUPE_ppa005883mg             161   5e-43   Prunus persica
ref|XP_006393703.1|  hypothetical protein EUTSA_v10011489mg             161   6e-43   Eutrema salsugineum [saltwater cress]
ref|XP_010063986.1|  PREDICTED: aminoacylase-1 isoform X1               161   6e-43   Eucalyptus grandis [rose gum]
ref|XP_002300996.2|  aminoacylase family protein                        160   9e-43   
ref|XP_002436680.1|  hypothetical protein SORBIDRAFT_10g006970          160   1e-42   Sorghum bicolor [broomcorn]
ref|XP_007019015.1|  Peptidase M20/M25/M40 family protein isoform 1     159   3e-42   
ref|XP_008777203.1|  PREDICTED: aminoacylase-1-like                     159   3e-42   Phoenix dactylifera
dbj|BAK07394.1|  predicted protein                                      158   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009123186.1|  PREDICTED: aminoacylase-1-like                     158   7e-42   Brassica rapa
ref|XP_006307525.1|  hypothetical protein CARUB_v10009148mg             158   7e-42   
ref|NP_175082.1|  peptidase M20/M25/M40 family protein                  157   1e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543794.1|  PREDICTED: aminoacylase-1-like                     157   1e-41   Glycine max [soybeans]
ref|XP_010272799.1|  PREDICTED: aminoacylase-1                          157   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010544624.1|  PREDICTED: aminoacylase-1                          155   7e-41   Tarenaya hassleriana [spider flower]
gb|ESA17742.1|  hypothetical protein GLOINDRAFT_334950                  154   8e-41   
gb|KJB16266.1|  hypothetical protein B456_002G221000                    155   8e-41   Gossypium raimondii
gb|AFK34969.1|  unknown                                                 155   9e-41   Medicago truncatula
ref|XP_002020143.1|  GL13664                                            154   1e-40   Drosophila persimilis
gb|AES60010.2|  N-acyl-L-amino-acid amidohydrolase                      155   1e-40   Medicago truncatula
ref|XP_001357831.2|  GA19818                                            154   1e-40   Drosophila pseudoobscura pseudoobscura
gb|KEH40951.1|  N-acyl-L-amino-acid amidohydrolase                      155   1e-40   Medicago truncatula
ref|XP_006386375.1|  hypothetical protein POPTR_0002s08590g             155   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_003589759.1|  Aminoacylase-1                                     155   1e-40   
ref|XP_003564110.1|  PREDICTED: aminoacylase-1-like                     154   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_011405330.1|  PREDICTED: aminoacylase-1A-like                    153   2e-40   
gb|ELT90864.1|  hypothetical protein CAPTEDRAFT_184037                  153   2e-40   Capitella teleta
ref|XP_008464599.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase...    152   3e-40   
ref|NP_001057113.1|  Os06g0210200                                       154   3e-40   
ref|XP_009344110.1|  PREDICTED: aminoacylase-1-like                     154   3e-40   
ref|XP_010943121.1|  PREDICTED: aminoacylase-1                          153   5e-40   
emb|CDY65424.1|  BnaC06g40730D                                          153   6e-40   Brassica napus [oilseed rape]
ref|XP_010694046.1|  PREDICTED: aminoacylase-1-like                     152   8e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP32782.1|  hypothetical protein JCGZ_12074                         152   9e-40   Jatropha curcas
ref|XP_001953964.1|  GF16977                                            151   2e-39   Drosophila ananassae
ref|XP_001994316.1|  GH23814                                            151   2e-39   Drosophila grimshawi
emb|CBI37723.3|  unnamed protein product                                150   3e-39   Vitis vinifera
ref|XP_001999544.1|  GI23017                                            150   4e-39   Drosophila mojavensis
ref|XP_006845931.1|  hypothetical protein AMTR_s00157p00064680          151   4e-39   
ref|XP_008547538.1|  PREDICTED: aminoacylase-1-like                     150   4e-39   Microplitis demolitor
ref|XP_001357832.1|  GA19815                                            149   1e-38   Drosophila pseudoobscura pseudoobscura
ref|XP_002054731.1|  GJ24611                                            149   1e-38   Drosophila virilis
ref|XP_002020145.1|  GL13662                                            148   1e-38   Drosophila persimilis
dbj|BAN21243.1|  aminoacylase, putative                                 148   2e-38   Riptortus pedestris
ref|XP_011139461.1|  PREDICTED: aminoacylase-1-like                     148   2e-38   Harpegnathos saltator
ref|XP_002054733.1|  GJ24614                                            148   2e-38   Drosophila virilis
gb|EMT02607.1|  Aminoacylase-1A                                         149   3e-38   
ref|XP_002074011.1|  GK14410                                            147   3e-38   Drosophila willistoni
gb|KFH63616.1|  hypothetical protein MVEG_10310                         147   7e-38   Mortierella verticillata NRRL 6337
ref|XP_001982187.1|  GG11184                                            146   8e-38   Drosophila erecta
ref|XP_001999543.1|  GI23018                                            146   8e-38   Drosophila mojavensis
ref|XP_392498.1|  PREDICTED: aminoacylase-1-like                        146   8e-38   Apis mellifera [bee]
ref|XP_002104512.1|  GD20996                                            146   1e-37   
ref|XP_001994315.1|  GH23872                                            146   1e-37   Drosophila grimshawi
ref|XP_011297555.1|  PREDICTED: aminoacylase-1-like                     145   2e-37   Fopius arisanus
ref|XP_001953966.1|  GF16975                                            145   2e-37   Drosophila ananassae
ref|XP_002032300.1|  GM26483                                            145   2e-37   Drosophila sechellia
ref|XP_002098383.1|  GE10351                                            145   2e-37   Drosophila yakuba
ref|XP_002074012.1|  GK14412                                            145   2e-37   Drosophila willistoni
ref|XP_001994317.1|  GH23739                                            145   3e-37   Drosophila grimshawi
ref|NP_651120.1|  CG6726, isoform A                                     145   3e-37   Drosophila melanogaster
gb|AAM50281.2|  RE13549p                                                145   3e-37   Drosophila melanogaster
ref|XP_001752334.1|  predicted protein                                  145   4e-37   
ref|XP_006655902.1|  PREDICTED: aminoacylase-1-like                     145   4e-37   
ref|NP_651121.1|  CG17110, isoform A                                    144   5e-37   Drosophila melanogaster
ref|XP_006609856.1|  PREDICTED: aminoacylase-1-like                     144   6e-37   Apis dorsata [rock honeybee]
ref|XP_009406638.1|  PREDICTED: aminoacylase-1-like                     144   7e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001982186.1|  GG11185                                            144   9e-37   Drosophila erecta
gb|EHJ78690.1|  hypothetical protein KGM_00092                          144   9e-37   
gb|KDR16327.1|  Aminoacylase-1                                          144   9e-37   Zootermopsis nevadensis
ref|XP_002020144.1|  GL13663                                            143   1e-36   Drosophila persimilis
gb|AEE63015.1|  unknown                                                 142   1e-36   Dendroctonus ponderosae
ref|XP_003694085.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase...    143   1e-36   Apis florea [dwarf honeybee]
ref|XP_002098387.1|  GE10355                                            143   1e-36   Drosophila yakuba
ref|XP_002137025.1|  GA26984                                            143   2e-36   Drosophila pseudoobscura pseudoobscura
ref|XP_011260966.1|  PREDICTED: aminoacylase-1-like                     142   2e-36   
ref|XP_001999541.1|  GI23020                                            142   2e-36   Drosophila mojavensis
ref|XP_011257812.1|  PREDICTED: aminoacylase-1-like                     142   2e-36   
ref|XP_001953963.1|  GF16978                                            142   3e-36   Drosophila ananassae
emb|CDP15803.1|  unnamed protein product                                143   3e-36   Coffea canephora [robusta coffee]
ref|XP_001746582.1|  hypothetical protein                               142   3e-36   Monosiga brevicollis MX1
ref|XP_002103973.1|  GD20717                                            142   3e-36   Drosophila simulans
ref|XP_002423294.1|  Aminoacylase-1, putative                           142   3e-36   Pediculus humanus corporis [human body lice]
gb|EFN67390.1|  Aminoacylase-1                                          142   4e-36   Camponotus floridanus
ref|XP_011139459.1|  PREDICTED: aminoacylase-1A-like                    142   4e-36   
ref|XP_004926560.1|  PREDICTED: aminoacylase-1-like                     142   5e-36   Bombyx mori [silk moth]
ref|XP_002074014.1|  GK14414                                            140   6e-36   
ref|XP_011175804.1|  PREDICTED: aminoacylase-1                          141   6e-36   Solenopsis invicta [imported red fire ant]
gb|EFN84446.1|  Aminoacylase-1A                                         142   6e-36   Harpegnathos saltator
ref|XP_006169396.1|  PREDICTED: aminoacylase-1A-like                    141   6e-36   Tupaia chinensis
ref|XP_002097104.1|  GE24683                                            141   7e-36   Drosophila yakuba
emb|CDS31047.1|  aminoacylase 1                                         141   7e-36   Hymenolepis microstoma
ref|XP_002713420.1|  PREDICTED: aminoacylase-1                          141   8e-36   Oryctolagus cuniculus [domestic rabbit]
ref|XP_006106513.1|  PREDICTED: aminoacylase-1B isoform X3              140   8e-36   
ref|XP_002594432.1|  hypothetical protein BRAFLDRAFT_262219             141   8e-36   Branchiostoma floridae
ref|XP_008153375.1|  PREDICTED: aminoacylase-1 isoform X3               140   9e-36   
ref|XP_007950231.1|  PREDICTED: aminoacylase-1 isoform X3               139   1e-35   Orycteropus afer afer
ref|XP_001380469.3|  PREDICTED: aminoacylase-1A-like isoform X1         140   1e-35   Monodelphis domestica
ref|XP_009861814.1|  PREDICTED: aminoacylase-1-like                     139   1e-35   
ref|XP_003642034.1|  PREDICTED: aminoacylase-1 isoformX2                139   2e-35   
ref|XP_011332735.1|  PREDICTED: aminoacylase-1-like                     140   2e-35   Ooceraea biroi
ref|XP_006978456.1|  PREDICTED: aminoacylase-1A-like isoform X1         140   2e-35   Peromyscus maniculatus bairdii
ref|XP_001863762.1|  aminoacylase                                       140   2e-35   Culex quinquefasciatus
ref|XP_006106511.1|  PREDICTED: aminoacylase-1B isoform X1              140   2e-35   Myotis lucifugus
gb|ERL86650.1|  hypothetical protein D910_04056                         142   2e-35   Dendroctonus ponderosae
ref|XP_008153360.1|  PREDICTED: aminoacylase-1 isoform X1               140   2e-35   Eptesicus fuscus
emb|CBY18015.1|  unnamed protein product                                140   2e-35   Oikopleura dioica
ref|XP_002031735.1|  GM26166                                            140   2e-35   Drosophila sechellia
ref|XP_007950229.1|  PREDICTED: aminoacylase-1 isoform X1               140   2e-35   Orycteropus afer afer
ref|XP_006682055.1|  hypothetical protein BATDEDRAFT_91704              140   3e-35   Batrachochytrium dendrobatidis JAM81
ref|XP_003642033.1|  PREDICTED: aminoacylase-1 isoformX1                140   3e-35   
pdb|1Q7L|A  Chain A, Zn-binding Domain Of The T347g Mutant Of Hum...    135   3e-35   Homo sapiens [man]
ref|XP_008197976.1|  PREDICTED: aminoacylase-1 isoform X2               138   3e-35   
ref|XP_001952932.1|  GF17519                                            139   4e-35   Drosophila ananassae
ref|XP_004715315.1|  PREDICTED: aminoacylase-1                          139   4e-35   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004944531.1|  PREDICTED: aminoacylase-1 isoform X8               140   4e-35   
ref|XP_002071948.1|  GK22579                                            139   4e-35   Drosophila willistoni
ref|XP_002098384.1|  GE10352                                            139   4e-35   Drosophila yakuba
ref|XP_002032301.1|  GM26485                                            139   4e-35   Drosophila sechellia
ref|XP_002074013.1|  GK14413                                            139   5e-35   
ref|XP_005368551.1|  PREDICTED: aminoacylase-1A-like isoform X4         137   6e-35   
ref|XP_004465801.1|  PREDICTED: aminoacylase-1 isoform 4                134   6e-35   
ref|NP_651124.1|  CG6738                                                138   7e-35   Drosophila melanogaster
ref|XP_001506809.2|  PREDICTED: aminoacylase-1                          139   8e-35   
ref|XP_002104516.1|  GD21001                                            138   8e-35   Drosophila simulans
ref|XP_002104515.1|  GD21000                                            138   8e-35   Drosophila simulans
ref|XP_001953965.1|  GF16976                                            138   8e-35   
ref|XP_969136.1|  PREDICTED: aminoacylase-1 isoform X1                  138   8e-35   Tribolium castaneum [rust-red flour beetle]
gb|ERE76105.1|  aminoacylase-1A-like protein                            137   8e-35   Cricetulus griseus [Chinese hamsters]
ref|XP_002104513.1|  GD20998                                            138   8e-35   
ref|XP_004411558.1|  PREDICTED: aminoacylase-1 isoform 4                137   9e-35   Odobenus rosmarus divergens
ref|XP_011068264.1|  PREDICTED: aminoacylase-1-like isoform X2          138   1e-34   Acromyrmex echinatior
ref|XP_005368548.1|  PREDICTED: aminoacylase-1A-like isoform X1         138   1e-34   Microtus ochrogaster [prairie voles]
ref|XP_011177301.1|  PREDICTED: aminoacylase-1B-like                    138   1e-34   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_007639263.1|  PREDICTED: aminoacylase-1 isoform X1               138   1e-34   
gb|EGW08874.1|  Aminoacylase-1A                                         137   1e-34   Cricetulus griseus [Chinese hamsters]
ref|XP_008583259.1|  PREDICTED: aminoacylase-1 isoform X3               137   1e-34   
ref|XP_005074914.1|  PREDICTED: aminoacylase-1A-like isoform X3         137   1e-34   
ref|XP_003701246.1|  PREDICTED: aminoacylase-1-like                     139   1e-34   
ref|XP_008583260.1|  PREDICTED: aminoacylase-1 isoform X4               137   1e-34   
ref|XP_001980666.1|  GG17282                                            137   2e-34   
ref|XP_001863763.1|  aminoacylase                                       137   2e-34   
ref|XP_001982184.1|  GG11187                                            137   2e-34   
ref|XP_006731795.1|  PREDICTED: aminoacylase-1 isoform X1               137   2e-34   
ref|XP_001982185.1|  GG11186                                            137   2e-34   
ref|XP_004664365.1|  PREDICTED: aminoacylase-1A isoform X3              136   2e-34   
ref|XP_004944528.1|  PREDICTED: aminoacylase-1 isoform X5               139   2e-34   
ref|XP_004411555.1|  PREDICTED: aminoacylase-1 isoform 1                137   2e-34   
ref|XP_003210064.2|  PREDICTED: aminoacylase-1                          137   2e-34   
ref|XP_002104514.1|  GD20999                                            137   2e-34   
ref|XP_002098385.1|  GE10353                                            137   2e-34   
ref|XP_008583258.1|  PREDICTED: aminoacylase-1 isoform X2               137   2e-34   
gb|KFP85458.1|  Aminoacylase-1                                          137   2e-34   
gb|AAM52007.1|  RE32110p                                                137   2e-34   
ref|XP_002513788.1|  Aminoacylase-1, putative                           137   3e-34   
ref|XP_003936643.1|  PREDICTED: aminoacylase-1                          137   3e-34   
ref|XP_009078004.1|  PREDICTED: aminoacylase-1 isoform X2               136   3e-34   
ref|XP_005074912.1|  PREDICTED: aminoacylase-1A-like isoform X1         137   3e-34   
ref|NP_651122.2|  CG17109, isoform A                                    137   3e-34   
gb|EGI69428.1|  Aminoacylase-1B                                         137   3e-34   
ref|XP_003762644.1|  PREDICTED: aminoacylase-1A-like                    137   3e-34   
ref|XP_004529657.1|  PREDICTED: aminoacylase-1B-like                    137   3e-34   
gb|ACK77613.1|  FI09240p                                                137   3e-34   
ref|XP_008583257.1|  PREDICTED: aminoacylase-1 isoform X1               137   3e-34   
ref|XP_007082016.1|  PREDICTED: aminoacylase-1 isoform X2               137   3e-34   
ref|XP_009580384.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     136   3e-34   
ref|XP_004664363.1|  PREDICTED: aminoacylase-1A isoform X1              137   4e-34   
gb|KFW78700.1|  Aminoacylase-1                                          136   4e-34   
ref|XP_011277721.1|  PREDICTED: aminoacylase-1 isoform X2               136   4e-34   
emb|CAA48565.1|  aminoacylase I                                         136   4e-34   
ref|XP_001655181.1|  AAEL011206-PA                                      136   4e-34   
ref|XP_001655182.1|  AAEL011206-PB                                      136   4e-34   
ref|NP_999061.1|  aminoacylase-1                                        136   4e-34   
ref|XP_005234603.1|  PREDICTED: aminoacylase-1 isoform X2               135   4e-34   
ref|XP_969212.1|  PREDICTED: aminoacylase-1                             136   4e-34   
ref|XP_009078003.1|  PREDICTED: aminoacylase-1 isoform X1               137   4e-34   
dbj|BAG60535.1|  unnamed protein product                                135   4e-34   
ref|XP_010588065.1|  PREDICTED: aminoacylase-1 isoform X2               136   4e-34   
ref|XP_004780127.1|  PREDICTED: aminoacylase-1                          136   4e-34   
sp|Q99JW2.1|ACY1_MOUSE  RecName: Full=Aminoacylase-1; Short=ACY-1...    136   5e-34   
ref|NP_079647.1|  aminoacylase-1                                        136   5e-34   
ref|XP_004368646.1|  PREDICTED: alpha/beta hydrolase domain-conta...    137   5e-34   
ref|XP_006892321.1|  PREDICTED: aminoacylase-1 isoform X3               135   5e-34   
ref|XP_008919452.1|  PREDICTED: aminoacylase-1                          136   5e-34   
ref|XP_002032302.1|  GM26486                                            136   5e-34   
ref|XP_010571264.1|  PREDICTED: aminoacylase-1                          136   6e-34   
ref|XP_010363342.1|  PREDICTED: aminoacylase-1                          136   6e-34   
gb|KFM04518.1|  Aminoacylase-1                                          136   6e-34   
emb|CDS18901.1|  aminoacylase 1                                         136   6e-34   
ref|XP_003410117.1|  PREDICTED: aminoacylase-1 isoform X1               136   6e-34   
emb|CDS18900.1|  aminoacylase 1                                         136   6e-34   
ref|XP_005485542.1|  PREDICTED: aminoacylase-1 isoform X3               135   6e-34   
ref|XP_005053128.1|  PREDICTED: aminoacylase-1 isoform X3               135   7e-34   
ref|XP_003257188.1|  PREDICTED: alpha/beta hydrolase domain-conta...    135   7e-34   
ref|XP_011494772.1|  PREDICTED: aminoacylase-1-like                     135   7e-34   
ref|XP_002119752.2|  PREDICTED: aminoacylase-1                          135   7e-34   
ref|XP_008980012.1|  PREDICTED: aminoacylase-1 isoform X3               135   8e-34   
ref|XP_009097762.1|  PREDICTED: aminoacylase-1                          135   8e-34   
gb|KFQ36529.1|  Aminoacylase-1                                          135   8e-34   
ref|XP_005422486.1|  PREDICTED: aminoacylase-1                          135   8e-34   
ref|XP_007082015.1|  PREDICTED: aminoacylase-1 isoform X1               136   8e-34   
ref|XP_011277719.1|  PREDICTED: aminoacylase-1 isoform X1               136   8e-34   
gb|EFB13632.1|  hypothetical protein PANDA_007594                       135   8e-34   
ref|XP_011222955.1|  PREDICTED: aminoacylase-1                          135   8e-34   
ref|XP_002032303.1|  GM26487                                            135   9e-34   
ref|XP_005234602.1|  PREDICTED: aminoacylase-1 isoform X1               135   9e-34   
ref|XP_004925487.1|  PREDICTED: aminoacylase-1-like isoform X1          135   9e-34   
ref|XP_004925488.1|  PREDICTED: aminoacylase-1-like isoform X2          135   9e-34   
ref|XP_009273045.1|  PREDICTED: aminoacylase-1                          135   9e-34   
ref|XP_008630401.1|  PREDICTED: aminoacylase-1 isoform X2               134   9e-34   
gb|KFQ93528.1|  Aminoacylase-1                                          135   9e-34   
ref|XP_004615165.1|  PREDICTED: aminoacylase-1                          136   9e-34   
ref|XP_004368645.1|  PREDICTED: alpha/beta hydrolase domain-conta...    136   9e-34   
ref|XP_006892319.1|  PREDICTED: aminoacylase-1 isoform X1               135   9e-34   
ref|XP_008945704.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_004676157.1|  PREDICTED: aminoacylase-1 isoform X1               135   1e-33   
ref|XP_005435995.1|  PREDICTED: aminoacylase-1                          135   1e-33   
gb|KFV71761.1|  Aminoacylase-1                                          135   1e-33   
ref|XP_002098386.1|  GE10354                                            135   1e-33   
ref|XP_005522205.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_009695812.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_004034295.1|  PREDICTED: abhydrolase domain-containing pro...    134   1e-33   
ref|XP_005485540.1|  PREDICTED: aminoacylase-1 isoform X1               135   1e-33   
gb|KFO57991.1|  Aminoacylase-1                                          135   1e-33   
ref|XP_005053126.1|  PREDICTED: aminoacylase-1 isoform X1               135   1e-33   
gb|KFW89595.1|  Aminoacylase-1                                          135   1e-33   
gb|KFP63720.1|  Aminoacylase-1                                          135   1e-33   
ref|NP_001185826.1|  aminoacylase-1 isoform c                           134   1e-33   
ref|XP_008848074.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_003401737.1|  PREDICTED: aminoacylase-1-like                     135   1e-33   
ref|NP_001040228.1|  aminoacylase                                       135   1e-33   
gb|EUB60739.1|  Aminoacylase-1                                          136   1e-33   
gb|KFO93961.1|  Aminoacylase-1                                          135   1e-33   
gb|KFU88246.1|  Aminoacylase-1                                          135   1e-33   
ref|XP_009904590.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_009458865.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_004925489.1|  PREDICTED: aminoacylase-1-like                     135   1e-33   
ref|XP_003257187.1|  PREDICTED: alpha/beta hydrolase domain-conta...    135   1e-33   
ref|XP_009500350.1|  PREDICTED: aminoacylase-1                          135   1e-33   
ref|XP_003492928.1|  PREDICTED: aminoacylase-1-like                     135   1e-33   
ref|NP_651123.1|  CG6733                                                135   1e-33   
ref|XP_004529661.1|  PREDICTED: aminoacylase-1-like                     135   2e-33   
gb|KFP04889.1|  Aminoacylase-1                                          135   2e-33   
ref|XP_010388288.1|  PREDICTED: aminoacylase-1                          135   2e-33   
ref|XP_008630400.1|  PREDICTED: aminoacylase-1 isoform X1               135   2e-33   
ref|XP_010141195.1|  PREDICTED: aminoacylase-1                          135   2e-33   
ref|XP_002012860.1|  GL23826                                            134   2e-33   
gb|KFO82386.1|  Aminoacylase-1                                          134   2e-33   
sp|Q5RFB0.2|ACY1_PONAB  RecName: Full=Aminoacylase-1; Short=ACY-1...    134   2e-33   
gb|KFB41911.1|  AGAP000679-PA-like protein                              134   2e-33   
gb|KFO09618.1|  Aminoacylase-1                                          134   2e-33   
ref|XP_004465798.1|  PREDICTED: aminoacylase-1 isoform 1                134   2e-33   
ref|XP_008497203.1|  PREDICTED: aminoacylase-1                          134   2e-33   
ref|XP_004034294.1|  PREDICTED: abhydrolase domain-containing pro...    134   2e-33   
ref|NP_000657.1|  aminoacylase-1 isoform a                              134   2e-33   
ref|XP_002136271.1|  GA29129                                            134   2e-33   
ref|XP_011208502.1|  PREDICTED: aminoacylase-1B                         134   2e-33   
ref|XP_002012859.1|  GL23825                                            134   2e-33   
ref|XP_010298191.1|  PREDICTED: aminoacylase-1                          134   2e-33   
ref|XP_009237215.1|  PREDICTED: aminoacylase-1 isoform X1               134   2e-33   
ref|NP_001124673.1|  aminoacylase-1                                     134   2e-33   
ref|XP_001492888.2|  PREDICTED: aminoacylase-1 isoformX1                134   3e-33   
ref|XP_008511306.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     134   3e-33   
ref|XP_002137185.1|  GA27068                                            134   3e-33   
ref|XP_006180041.1|  PREDICTED: aminoacylase-1 isoform X6               133   3e-33   
ref|XP_009567656.1|  PREDICTED: aminoacylase-1                          134   3e-33   
ref|XP_009994129.1|  PREDICTED: aminoacylase-1                          134   3e-33   
gb|AAM29547.1|  RE61589p                                                134   3e-33   
ref|XP_001953962.1|  GF16979                                            134   3e-33   
ref|XP_004925510.1|  PREDICTED: aminoacylase-1-like                     134   3e-33   
ref|XP_005142319.1|  PREDICTED: aminoacylase-1                          134   3e-33   
ref|XP_001599353.1|  PREDICTED: aminoacylase-1-like                     134   3e-33   
gb|KFW65596.1|  Aminoacylase-1                                          134   3e-33   
ref|XP_004087930.1|  PREDICTED: alpha/beta hydrolase domain-conta...    135   3e-33   
ref|XP_007174860.1|  PREDICTED: aminoacylase-1                          134   4e-33   
ref|XP_009320072.1|  PREDICTED: aminoacylase-1                          134   4e-33   
ref|XP_002191980.2|  PREDICTED: aminoacylase-1                          134   4e-33   
gb|KFP16362.1|  Aminoacylase-1                                          133   5e-33   
ref|XP_005898173.1|  PREDICTED: aminoacylase-1 isoform X4               132   5e-33   
ref|XP_004465800.1|  PREDICTED: aminoacylase-1 isoform 3                134   5e-33   
dbj|BAG60372.1|  unnamed protein product                                134   5e-33   
ref|XP_006180036.1|  PREDICTED: aminoacylase-1 isoform X1               133   5e-33   
ref|XP_007451903.1|  PREDICTED: aminoacylase-1 isoform X4               132   6e-33   
ref|XP_010090715.1|  hypothetical protein L484_013737                   133   6e-33   
ref|XP_004267922.1|  PREDICTED: aminoacylase-1 isoform 4                132   6e-33   
ref|XP_004034296.1|  PREDICTED: abhydrolase domain-containing pro...    134   6e-33   
ref|XP_003894383.1|  PREDICTED: aminoacylase-1                          133   7e-33   
ref|XP_007982642.1|  PREDICTED: aminoacylase-1 isoform X4               133   7e-33   
ref|XP_008055991.1|  PREDICTED: aminoacylase-1 isoform X1               133   8e-33   
ref|XP_009637639.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     133   8e-33   
ref|XP_004315910.1|  PREDICTED: aminoacylase-1 isoform 4                132   8e-33   
ref|XP_001870752.1|  aminoacylase                                       133   8e-33   
emb|CDJ01970.1|  unnamed protein product                                133   9e-33   
ref|XP_004018460.1|  PREDICTED: aminoacylase-1 isoform 1                132   9e-33   
ref|XP_002054732.1|  GJ24612                                            132   1e-32   
emb|CDJ01969.1|  aminoacylase 1                                         133   1e-32   
ref|XP_007982640.1|  PREDICTED: aminoacylase-1 isoform X2               133   1e-32   
gb|KFQ10905.1|  Aminoacylase-1                                          132   1e-32   
ref|XP_005898170.1|  PREDICTED: aminoacylase-1 isoform X1               132   1e-32   
ref|XP_005222999.1|  PREDICTED: aminoacylase-1 isoform X1               132   1e-32   
ref|XP_010850067.1|  PREDICTED: aminoacylase-1                          132   1e-32   
ref|XP_004267919.1|  PREDICTED: aminoacylase-1 isoform 1                132   1e-32   
ref|XP_007451900.1|  PREDICTED: aminoacylase-1 isoform X1               132   1e-32   
ref|XP_007106004.1|  PREDICTED: aminoacylase-1                          132   1e-32   
ref|XP_006045080.1|  PREDICTED: aminoacylase-1 isoform X1               132   1e-32   
ref|XP_311208.4|  AGAP000679-PA                                         132   1e-32   
ref|XP_011177294.1|  PREDICTED: aminoacylase-1-like                     132   1e-32   
ref|XP_004529658.1|  PREDICTED: aminoacylase-1-like                     132   1e-32   
ref|XP_005285315.1|  PREDICTED: aminoacylase-1                          132   1e-32   
ref|XP_009949041.1|  PREDICTED: aminoacylase-1                          132   2e-32   
ref|XP_004315907.1|  PREDICTED: aminoacylase-1 isoform 1                132   2e-32   
ref|XP_783286.3|  PREDICTED: aminoacylase-1A-like                       132   2e-32   
sp|Q6PTT0.1|ACY1B_RAT  RecName: Full=Aminoacylase-1B; Short=ACY-1...    132   2e-32   
ref|XP_006196436.1|  PREDICTED: aminoacylase-1 isoform X5               130   2e-32   
ref|XP_004419834.1|  PREDICTED: aminoacylase-1 isoform 4                130   2e-32   
ref|XP_003789410.1|  PREDICTED: aminoacylase-1 isoform 1                132   3e-32   
ref|XP_009172178.1|  hypothetical protein T265_14495                    128   3e-32   
gb|KFQ53232.1|  Aminoacylase-1                                          131   3e-32   
ref|XP_533806.2|  PREDICTED: aminoacylase-1 isoform 3                   131   3e-32   
gb|ETN67605.1|  aminoacylase                                            131   3e-32   
ref|XP_006876108.1|  PREDICTED: aminoacylase-1                          131   3e-32   
ref|XP_006275196.1|  PREDICTED: aminoacylase-1A-like                    131   3e-32   
ref|XP_005089280.1|  PREDICTED: aminoacylase-1-like                     131   3e-32   
ref|XP_002003849.1|  GI18128                                            131   4e-32   
ref|XP_004250324.1|  PREDICTED: aminoacylase-1                          131   4e-32   
ref|XP_008181414.1|  PREDICTED: aminoacylase-1-like isoform X1          131   4e-32   
ref|NP_001280378.1|  aminoacylase-1-like                                131   4e-32   
ref|XP_009484667.1|  PREDICTED: aminoacylase-1                          131   4e-32   
ref|XP_004419831.1|  PREDICTED: aminoacylase-1 isoform 1                131   4e-32   
gb|ACO12680.1|  Aminoacylase-1                                          131   4e-32   
ref|XP_006196432.1|  PREDICTED: aminoacylase-1 isoform X1               131   4e-32   
ref|XP_001999542.1|  GI23019                                            130   5e-32   
ref|XP_006243777.1|  PREDICTED: aminoacylase-1A isoform X1              130   5e-32   
ref|XP_011177293.1|  PREDICTED: aminoacylase-1-like                     130   6e-32   
gb|KFQ31525.1|  Aminoacylase-1                                          130   6e-32   
ref|XP_010178411.1|  PREDICTED: aminoacylase-1                          130   9e-32   
ref|XP_009869340.1|  PREDICTED: aminoacylase-1                          129   9e-32   
ref|XP_001863764.1|  aminoacylase                                       130   1e-31   
ref|XP_004920595.1|  PREDICTED: aminoacylase-1-like isoform X2          127   1e-31   
dbj|GAA30793.2|  aminoacylase                                           130   1e-31   
ref|XP_002136270.1|  GA29130                                            129   1e-31   
ref|XP_009065682.1|  hypothetical protein LOTGIDRAFT_197114             129   1e-31   
ref|XP_002935660.2|  PREDICTED: aminoacylase-1-like isoform X1          127   1e-31   
ref|XP_003217685.1|  PREDICTED: aminoacylase-1                          129   2e-31   
ref|XP_010623722.1|  PREDICTED: aminoacylase-1                          129   2e-31   
ref|XP_006909218.1|  PREDICTED: aminoacylase-1 isoform X1               129   2e-31   
ref|XP_002137186.1|  GA27069                                            129   3e-31   
ref|XP_010080600.1|  PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1     126   3e-31   
ref|XP_002071947.1|  GK22580                                            129   3e-31   
ref|XP_011074859.1|  PREDICTED: aminoacylase-1                          129   3e-31   
ref|XP_006351890.1|  PREDICTED: aminoacylase-1-like isoform X1          129   3e-31   
ref|NP_001005383.1|  aminoacylase-1A                                    128   4e-31   
gb|EPS66024.1|  hypothetical protein M569_08749                         129   4e-31   
gb|KGL83712.1|  Aminoacylase-1                                          127   4e-31   
ref|XP_007425958.1|  PREDICTED: aminoacylase-1                          128   5e-31   
ref|XP_009065681.1|  hypothetical protein LOTGIDRAFT_222505             128   5e-31   
ref|XP_011362951.1|  PREDICTED: aminoacylase-1                          128   6e-31   



>ref|XP_009796337.1| PREDICTED: aminoacylase-1 [Nicotiana sylvestris]
Length=452

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P Y EAA+FI SQAKSL+LE+Q +E VKGKPL++LKWAGKD +
Sbjct  37   IISRFQQYLQINTAQPQPNYYEAAEFITSQAKSLNLESQTLELVKGKPLILLKWAGKDPS  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSE HKW+HPPF A +DPATGNIYARGSQDMKCVGLQYLEAIR LKA
Sbjct  97   LPSVLLNSHTDVVPSEHHKWAHPPFSAHLDPATGNIYARGSQDMKCVGLQYLEAIRKLKA  156

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYLSF
Sbjct  157  SGFQPTRTVYLSF  169



>dbj|BAQ00430.1| putative aminoacylase [Nicotiana tabacum]
Length=452

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P Y EAA+FI SQAKSL+LE+Q +E VKGKPL++LKWAGKD +
Sbjct  37   IISRFQQYLQINTAQPQPNYYEAAEFITSQAKSLNLESQTLELVKGKPLILLKWAGKDPS  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSE HKW+HPPF A +DPATGNIYARGSQDMKCVGLQYLEAIR LKA
Sbjct  97   LPSVLLNSHTDVVPSEHHKWAHPPFSAHLDPATGNIYARGSQDMKCVGLQYLEAIRKLKA  156

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYLSF
Sbjct  157  SGFQPTRTVYLSF  169



>ref|XP_009620561.1| PREDICTED: aminoacylase-1 [Nicotiana tomentosiformis]
Length=452

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P Y EAA+FI SQAKSL+LE+Q +E VKGKPL++LKWAGKD +
Sbjct  37   IISRFQQYLQINTAQPQPNYYEAAEFITSQAKSLNLESQTLELVKGKPLILLKWAGKDPS  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSE HKW+HPPF A +DPA+GNIYARGSQDMKCVGLQYLEAIR LKA
Sbjct  97   LPSVLLNSHTDVVPSEHHKWAHPPFSAHLDPASGNIYARGSQDMKCVGLQYLEAIRKLKA  156

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYLSF
Sbjct  157  SGFQPTRTVYLSF  169



>ref|XP_011092917.1| PREDICTED: aminoacylase-1 isoform X2 [Sesamum indicum]
Length=455

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TA P P Y EAADFI SQAKSLSL+ Q++EFVKGKPLV+LKWAGK+  
Sbjct  40   IISRFQEYLRINTAHPGPNYNEAADFIASQAKSLSLDFQILEFVKGKPLVLLKWAGKNPA  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P+EPHKW HPPF A IDP++G+IYARGSQDMKCVGLQYLEAIR L+A
Sbjct  100  LPSVLLNSHTDVVPAEPHKWDHPPFQAHIDPSSGHIYARGSQDMKCVGLQYLEAIRKLQA  159

Query  640  SGFQPIRTVYLSF  678
            SGF+P+RTVYLSF
Sbjct  160  SGFRPLRTVYLSF  172



>ref|XP_011092916.1| PREDICTED: aminoacylase-1 isoform X1 [Sesamum indicum]
Length=458

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TA P P Y EAADFI SQAKSLSL+ Q++EFVKGKPLV+LKWAGK+  
Sbjct  40   IISRFQEYLRINTAHPGPNYNEAADFIASQAKSLSLDFQILEFVKGKPLVLLKWAGKNPA  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P+EPHKW HPPF A IDP++G+IYARGSQDMKCVGLQYLEAIR L+A
Sbjct  100  LPSVLLNSHTDVVPAEPHKWDHPPFQAHIDPSSGHIYARGSQDMKCVGLQYLEAIRKLQA  159

Query  640  SGFQPIRTVYLSF  678
            SGF+P+RTVYLSF
Sbjct  160  SGFRPLRTVYLSF  172



>dbj|BAO98754.1| putative aminoacylase [Nicotiana benthamiana]
Length=452

 Score =   229 bits (584),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P Y EAA+FI SQAKSL+LE+Q +E VKGKPL++LKWAGKD +
Sbjct  37   IISRFQQYLQINTAQPQPNYYEAAEFITSQAKSLNLESQTLELVKGKPLILLKWAGKDPS  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSE HKW+HPPF A +DP +GNIYARGSQDMKCVGLQYLEAIR LKA
Sbjct  97   LPSVLLNSHTDVVPSEHHKWAHPPFSAHLDPTSGNIYARGSQDMKCVGLQYLEAIRKLKA  156

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYLSF
Sbjct  157  SGFQPTRTVYLSF  169



>gb|EYU40489.1| hypothetical protein MIMGU_mgv1a005945mg [Erythranthe guttata]
Length=463

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TA PNP Y EAADFI S+AKSLSL++Q++EFVKGKPLV+LKWAG++ +
Sbjct  48   IISRFQEYLRINTAHPNPSYNEAADFITSEAKSLSLDSQILEFVKGKPLVLLKWAGENPS  107

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E HKW HPPFDA +DP++G+IYARGSQDMKCVGLQYLEAIR+L++
Sbjct  108  LPSILLNSHTDVVPAEFHKWDHPPFDAHLDPSSGHIYARGSQDMKCVGLQYLEAIRNLQS  167

Query  640  SGFQPIRTVYLSF  678
            SGF+P+RTVYLSF
Sbjct  168  SGFRPLRTVYLSF  180



>ref|XP_004231104.1| PREDICTED: aminoacylase-1 [Solanum lycopersicum]
Length=448

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQQYL+I+TAQP+P Y EAA+FIISQAK LSLE+Q +EFVKGKPL++LKW GKD T
Sbjct  33   ILSRFQQYLQINTAQPHPNYYEAAEFIISQAKLLSLESQTLEFVKGKPLILLKWPGKDPT  92

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE HKW+HPPF A +D  TGNI+ARGSQDMKCVGLQYLEAIR LK+
Sbjct  93   LPSILLNSHTDVVPSEHHKWTHPPFSAHLDSTTGNIFARGSQDMKCVGLQYLEAIRKLKS  152

Query  640  SGFQPIRTVYLSF  678
             GF+P+RT+YLSF
Sbjct  153  YGFRPLRTLYLSF  165



>ref|XP_006364339.1| PREDICTED: aminoacylase-1-like [Solanum tuberosum]
Length=452

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQQYL+I+TAQP+P Y EAA+FIISQAK LSLE+Q +EFVKGKPL++LKW G D T
Sbjct  37   ILSRFQQYLQINTAQPHPNYYEAAEFIISQAKLLSLESQTLEFVKGKPLILLKWPGNDPT  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE HKW+HPPF A +D  TGNI+ARGSQDMKCVGLQYLEAIR LKA
Sbjct  97   LPSILLNSHTDVVPSEHHKWTHPPFSAHLDSTTGNIFARGSQDMKCVGLQYLEAIRKLKA  156

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R +YLSF
Sbjct  157  SGFRPLRNLYLSF  169



>ref|XP_010093337.1| hypothetical protein L484_002939 [Morus notabilis]
 gb|EXB53900.1| hypothetical protein L484_002939 [Morus notabilis]
Length=469

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYLRI+TAQP+P Y EAADFI++QAKSLSLE+Q +EFV GKPLV+LKW G D +
Sbjct  36   IISRFQQYLRINTAQPSPDYAEAADFILAQAKSLSLESQTLEFVNGKPLVLLKWPGSDPS  95

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L +ILLNSHTDV P+EP KW+HPPF A +D + GN+YARGSQDMKCVGLQYLEAIR LKA
Sbjct  96   LASILLNSHTDVVPAEPEKWTHPPFSAHLD-SRGNVYARGSQDMKCVGLQYLEAIRRLKA  154

Query  640  SGFQPIRTVYLSF  678
            SGF+PIR+VYLSF
Sbjct  155  SGFRPIRSVYLSF  167



>ref|XP_010690576.1| PREDICTED: aminoacylase-1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=406

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQ+YLRI+TA PNP+Y EA +FI+SQAKSLSLE+Q++EFVK KPLV+LKW GKDS LP+
Sbjct  41   RFQEYLRINTAYPNPKYYEAVEFILSQAKSLSLESQIIEFVKDKPLVLLKWPGKDSKLPS  100

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            +LLNSHTDV P+EPHKW+H PF A ID + GNIYARGSQDMKCVG+QYLEAIR LKASGF
Sbjct  101  VLLNSHTDVVPAEPHKWTHHPFSAHID-SHGNIYARGSQDMKCVGMQYLEAIRKLKASGF  159

Query  649  QPIRTVYLSF  678
            +P RT+YLSF
Sbjct  160  EPTRTIYLSF  169



>ref|XP_010690575.1| PREDICTED: aminoacylase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=452

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 116/130 (89%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQ+YLRI+TA PNP+Y EA +FI+SQAKSLSLE+Q++EFVK KPLV+LKW GKDS LP+
Sbjct  41   RFQEYLRINTAYPNPKYYEAVEFILSQAKSLSLESQIIEFVKDKPLVLLKWPGKDSKLPS  100

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            +LLNSHTDV P+EPHKW+H PF A ID + GNIYARGSQDMKCVG+QYLEAIR LKASGF
Sbjct  101  VLLNSHTDVVPAEPHKWTHHPFSAHID-SHGNIYARGSQDMKCVGMQYLEAIRKLKASGF  159

Query  649  QPIRTVYLSF  678
            +P RT+YLSF
Sbjct  160  EPTRTIYLSF  169



>ref|XP_010645690.1| PREDICTED: aminoacylase-1 isoform X2 [Vitis vinifera]
Length=478

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YL+I+TAQPNP Y EAADFI+SQA+S+SL +Q +EFVKGKP+V+LKW G +  
Sbjct  64   IVSRFQRYLQINTAQPNPNYYEAADFIVSQAQSISLHSQTLEFVKGKPIVLLKWPGSNPN  123

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E HKW+HPPFDA +D   G+IYARGSQDMKCVGLQYLEAIR LK+
Sbjct  124  LPSILLNSHTDVVPAEHHKWTHPPFDAHVD-GNGDIYARGSQDMKCVGLQYLEAIRRLKS  182

Query  640  SGFQPIRTVYLSF  678
            SGFQP+RTVYLSF
Sbjct  183  SGFQPLRTVYLSF  195



>ref|XP_002283140.2| PREDICTED: aminoacylase-1 isoform X1 [Vitis vinifera]
Length=481

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YL+I+TAQPNP Y EAADFI+SQA+S+SL +Q +EFVKGKP+V+LKW G +  
Sbjct  64   IVSRFQRYLQINTAQPNPNYYEAADFIVSQAQSISLHSQTLEFVKGKPIVLLKWPGSNPN  123

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E HKW+HPPFDA +D   G+IYARGSQDMKCVGLQYLEAIR LK+
Sbjct  124  LPSILLNSHTDVVPAEHHKWTHPPFDAHVD-GNGDIYARGSQDMKCVGLQYLEAIRRLKS  182

Query  640  SGFQPIRTVYLSF  678
            SGFQP+RTVYLSF
Sbjct  183  SGFQPLRTVYLSF  195



>emb|CDP14501.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RF+QYL+I+TAQP P Y EAADF+ISQA SLSLE+QV+EFV+GKPLV+LKW GK+  LP+
Sbjct  42   RFRQYLQINTAQPKPNYHEAADFLISQANSLSLESQVLEFVQGKPLVLLKWPGKNPALPS  101

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS-G  645
            ILLNSHTDV PSE HKW+HPPFDA +D ATGNIYARGSQDMKCVG+QYLEAIR LKAS  
Sbjct  102  ILLNSHTDVVPSEHHKWAHPPFDAHLDSATGNIYARGSQDMKCVGMQYLEAIRKLKASPS  161

Query  646  F-QPIRTVYLSF  678
            F QP+RTVYLSF
Sbjct  162  FRQPLRTVYLSF  173



>ref|XP_008448158.1| PREDICTED: aminoacylase-1 [Cucumis melo]
Length=448

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T QP+P+Y EAADFIISQAKSLSLE+  +EFV+GKPL+ILKW G +  
Sbjct  34   IISRFQQYLQINTVQPSPQYYEAADFIISQAKSLSLESHTIEFVEGKPLIILKWPGSNLD  93

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E HKW+HPP  A ID + GNIYARGSQDMKCVG+QYLEAIR LKA
Sbjct  94   LPSILLNSHTDVVPAEHHKWTHPPLGAHID-SHGNIYARGSQDMKCVGMQYLEAIRRLKA  152

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  153  SGFQPLRSVYLSF  165



>ref|XP_010690579.1| PREDICTED: aminoacylase-1-like isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=453

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQ+YLRI+TAQPNP+Y EAADFI+SQAKSLSLE+Q +EFVK KPL++LKW GK+  LP+
Sbjct  40   RFQEYLRINTAQPNPKYYEAADFILSQAKSLSLESQTIEFVKNKPLILLKWPGKNPKLPS  99

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            +LLNSHTDV P E HKWSH PF A ID + GNIYARGSQDMKCVGLQYLEAIR LK SGF
Sbjct  100  VLLNSHTDVVPVESHKWSHDPFAAHID-SHGNIYARGSQDMKCVGLQYLEAIRKLKNSGF  158

Query  649  QPIRTVYLSF  678
            +P RT+YLSF
Sbjct  159  EPTRTIYLSF  168



>ref|XP_010690578.1| PREDICTED: aminoacylase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQ+YLRI+TAQPNP+Y EAADFI+SQAKSLSLE+Q +EFVK KPL++LKW GK+  LP+
Sbjct  40   RFQEYLRINTAQPNPKYYEAADFILSQAKSLSLESQTIEFVKNKPLILLKWPGKNPKLPS  99

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            +LLNSHTDV P E HKWSH PF A ID + GNIYARGSQDMKCVGLQYLEAIR LK SGF
Sbjct  100  VLLNSHTDVVPVESHKWSHDPFAAHID-SHGNIYARGSQDMKCVGLQYLEAIRKLKNSGF  158

Query  649  QPIRTVYLSF  678
            +P RT+YLSF
Sbjct  159  EPTRTIYLSF  168



>ref|XP_004139978.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
 ref|XP_004154523.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
 gb|KGN46643.1| hypothetical protein Csa_6G117740 [Cucumis sativus]
Length=448

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T QP+P+Y EAADFIISQAKSLSLE+  +EFV+GKPLVILKW G +  
Sbjct  34   IISRFQQYLQINTVQPSPQYYEAADFIISQAKSLSLESHTIEFVEGKPLVILKWPGSNPE  93

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E  KW+HPP  A ID + GNIYARGSQDMKCVG+QYLEAIR LKA
Sbjct  94   LPSILLNSHTDVVPAEHKKWTHPPLGAHID-SHGNIYARGSQDMKCVGMQYLEAIRRLKA  152

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  153  SGFQPLRSVYLSF  165



>ref|XP_010690577.1| PREDICTED: aminoacylase-1-like [Beta vulgaris subsp. vulgaris]
Length=452

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            +ISRFQ+YL+I+TA PNP+Y EAADFIISQAKSLSLE+Q +EFVK KPLV+LKW GK+  
Sbjct  38   VISRFQEYLQINTAHPNPKYYEAADFIISQAKSLSLESQTIEFVKNKPLVLLKWPGKNPK  97

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P E HKW+H PFDA ID + GNIYARGSQDMKCVG+ YLEAIR LK 
Sbjct  98   LPSVLLNSHTDVVPVELHKWTHHPFDAHID-SDGNIYARGSQDMKCVGMLYLEAIRKLKD  156

Query  640  SGFQPIRTVYLSF  678
            SGF+P RT+YLS+
Sbjct  157  SGFEPTRTIYLSY  169



>ref|XP_008382744.1| PREDICTED: aminoacylase-1-like, partial [Malus domestica]
Length=485

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TA PNPRY EAADFI+S+A+SLSL++Q +EFV GKPLV+LKW G D +
Sbjct  71   IISRFQRYLQINTAHPNPRYREAADFILSEAESLSLQSQTLEFVPGKPLVLLKWPGSDPS  130

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P+E  KW+HPPF A +DP  GN+YARGSQDMKCVG+QYLEAIR LKA
Sbjct  131  LPSVLLNSHTDVVPAEHDKWAHPPFSANLDP-NGNVYARGSQDMKCVGIQYLEAIRRLKA  189

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  190  SGFKPKRSVYLSF  202



>ref|XP_010690574.1| PREDICTED: aminoacylase-1-like [Beta vulgaris subsp. vulgaris]
Length=449

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TAQPNP Y EAA+FI+SQAKSLSLE+Q +EFVK KPL++LKW GK S 
Sbjct  35   IISRFQEYLRINTAQPNPSYYEAANFILSQAKSLSLESQTIEFVKNKPLILLKWPGKISK  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P E HKW H PFDA ID + GNI+ARG+QDMK VG+QYLEAIR LK 
Sbjct  95   LPSVLLNSHTDVVPVESHKWVHHPFDAHID-SDGNIHARGTQDMKSVGMQYLEAIRKLKD  153

Query  640  SGFQPIRTVYLSF  678
            SGF+P RTVYLSF
Sbjct  154  SGFEPTRTVYLSF  166



>ref|XP_010431749.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=435

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  28   IVSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIELVKGKPLLLLKWVGSDPT  87

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A +D  TGNIYARGSQDMKCVG+QYLEAIR L++
Sbjct  88   LPAFLLNSHTDVVPFEESKWTHHPLQAHVDHTTGNIYARGSQDMKCVGMQYLEAIRKLQS  147

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  148  SGFQPLRSVYLSF  160



>gb|EPS64004.1| hypothetical protein M569_10775, partial [Genlisea aurea]
Length=439

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II RF++YLR++TAQPNP Y EAADF+ +Q +++ LETQ++EF  GKPLV+L W GKD +
Sbjct  23   IIGRFREYLRVNTAQPNPNYREAADFLAAQGRAVGLETQILEFAAGKPLVLLGWIGKDPS  82

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P+E HKW+HPPF A +D ++G+IYARGSQDMKCVG+QYLEAIR L+ 
Sbjct  83   LPAILLNSHTDVVPAEDHKWNHPPFAAHLDESSGHIYARGSQDMKCVGIQYLEAIRKLEV  142

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VYLSF
Sbjct  143  SGFRPLRSVYLSF  155



>ref|XP_009358898.1| PREDICTED: aminoacylase-1-like isoform X2 [Pyrus x bretschneideri]
Length=443

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TA PNP+Y EAADFI+S+AKSLSLE+Q +EFV GKPLV+LKW+G D +
Sbjct  29   IISRFQRYLRINTAHPNPQYREAADFILSEAKSLSLESQTLEFVPGKPLVLLKWSGSDPS  88

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L ++LLNSHTDV P+E  KW HPPF A +D + G++YARGSQDMKCVG+QYLEAIR LKA
Sbjct  89   LHSVLLNSHTDVVPAEHDKWVHPPFSANLD-SNGDVYARGSQDMKCVGMQYLEAIRRLKA  147

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  148  SGFKPKRSVYLSF  160



>ref|XP_010436914.1| PREDICTED: aminoacylase-1-like isoform X2 [Camelina sativa]
Length=439

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  32   IVSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIELVKGKPLLLLKWVGSDPT  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P  A +D  TGNIYARGSQDMKCVG+QYLEAIR L++
Sbjct  92   LPALLLNSHTDVVPFEESKWTHHPLQAHVDHTTGNIYARGSQDMKCVGMQYLEAIRKLQS  151

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  152  SGFHPLRSVYLSF  164



>ref|XP_009358896.1| PREDICTED: aminoacylase-1-like isoform X1 [Pyrus x bretschneideri]
Length=446

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TA PNP+Y EAADFI+S+AKSLSLE+Q +EFV GKPLV+LKW+G D +
Sbjct  29   IISRFQRYLRINTAHPNPQYREAADFILSEAKSLSLESQTLEFVPGKPLVLLKWSGSDPS  88

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L ++LLNSHTDV P+E  KW HPPF A +D + G++YARGSQDMKCVG+QYLEAIR LKA
Sbjct  89   LHSVLLNSHTDVVPAEHDKWVHPPFSANLD-SNGDVYARGSQDMKCVGMQYLEAIRRLKA  147

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  148  SGFKPKRSVYLSF  160



>ref|XP_010436913.1| PREDICTED: aminoacylase-1-like isoform X1 [Camelina sativa]
Length=442

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  32   IVSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIELVKGKPLLLLKWVGSDPT  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P  A +D  TGNIYARGSQDMKCVG+QYLEAIR L++
Sbjct  92   LPALLLNSHTDVVPFEESKWTHHPLQAHVDHTTGNIYARGSQDMKCVGMQYLEAIRKLQS  151

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  152  SGFHPLRSVYLSF  164



>ref|XP_010431748.1| PREDICTED: aminoacylase-1-like isoform X2 [Camelina sativa]
Length=439

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  32   IVSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIELVKGKPLLLLKWVGSDPT  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P  A +D  TGNIYARGSQDMKCVG+QYLEAIR L++
Sbjct  92   LPALLLNSHTDVVPFEESKWTHHPLQAHVDHTTGNIYARGSQDMKCVGMQYLEAIRKLQS  151

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  152  SGFHPLRSVYLSF  164



>ref|XP_010431747.1| PREDICTED: aminoacylase-1-like isoform X1 [Camelina sativa]
Length=442

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  32   IVSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIELVKGKPLLLLKWVGSDPT  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P  A +D  TGNIYARGSQDMKCVG+QYLEAIR L++
Sbjct  92   LPALLLNSHTDVVPFEESKWTHHPLQAHVDHTTGNIYARGSQDMKCVGMQYLEAIRKLQS  151

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  152  SGFHPLRSVYLSF  164



>ref|XP_009340791.1| PREDICTED: aminoacylase-1-like isoform X1 [Pyrus x bretschneideri]
Length=445

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TA PNP+Y EAADFI+S+A+SLSL++Q +EFV GKPLV+LKW G D +
Sbjct  28   IISRFQRYLQINTAHPNPQYREAADFILSEAESLSLQSQTLEFVPGKPLVLLKWPGSDPS  87

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P+E  KW HPPF A +DP  G++YARGSQDMKCVG+QYLEAIR LKA
Sbjct  88   LPSVLLNSHTDVVPAEHDKWVHPPFSANLDP-NGDVYARGSQDMKCVGIQYLEAIRRLKA  146

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  147  SGFKPKRSVYLSF  159



>ref|XP_009340792.1| PREDICTED: aminoacylase-1-like isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TA PNP+Y EAADFI+S+A+SLSL++Q +EFV GKPLV+LKW G D +
Sbjct  28   IISRFQRYLQINTAHPNPQYREAADFILSEAESLSLQSQTLEFVPGKPLVLLKWPGSDPS  87

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P+E  KW HPPF A +DP  G++YARGSQDMKCVG+QYLEAIR LKA
Sbjct  88   LPSVLLNSHTDVVPAEHDKWVHPPFSANLDP-NGDVYARGSQDMKCVGIQYLEAIRRLKA  146

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  147  SGFKPKRSVYLSF  159



>ref|XP_010270552.1| PREDICTED: aminoacylase-1 [Nelumbo nucifera]
Length=450

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YL+I+TA PNP Y  AA+FI+SQAK+L+LE Q +EF+KGKP+++LKW GK+  L
Sbjct  41   ITRFQKYLQINTAHPNPDYSAAANFILSQAKALALEYQTLEFIKGKPVILLKWPGKNPDL  100

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV P+E  KW+HPPFDA +D A GNIYARGSQDMKCVG+QYLEAIR LK S
Sbjct  101  PSILLNSHTDVVPAELQKWNHPPFDAHLDQA-GNIYARGSQDMKCVGMQYLEAIRRLKDS  159

Query  643  GFQPIRTVYLSF  678
            GF P+RTVYLSF
Sbjct  160  GFHPVRTVYLSF  171



>ref|XP_010446323.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=436

 Score =   206 bits (523),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  29   IVSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIELVKGKPLLLLKWLGSDPT  88

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A +D  TGNIYARGSQDMKCVG+QYLEAIR L++
Sbjct  89   LPAFLLNSHTDVVPFEESKWTHHPLQAHVDHTTGNIYARGSQDMKCVGMQYLEAIRKLQS  148

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  149  SGFHPLRSVYLSF  161



>ref|XP_006284995.1| hypothetical protein CARUB_v10006302mg [Capsella rubella]
 gb|EOA17893.1| hypothetical protein CARUB_v10006302mg [Capsella rubella]
Length=436

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +E VKGKPL++LKW G D TL
Sbjct  30   VSRFQEYLRINTVQPNPDYYKAVDFIISQAKPLSLESQTIEHVKGKPLLLLKWVGSDPTL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSHTDV P E  KW+H P  A ID  +GNIYARGSQDMKCVG+QYLEAIR L+AS
Sbjct  90   PAILLNSHTDVVPFEDSKWTHHPLLAHIDHTSGNIYARGSQDMKCVGMQYLEAIRKLQAS  149

Query  643  GFQPIRTVYLSF  678
            GF P+R+VYLSF
Sbjct  150  GFHPLRSVYLSF  161



>ref|XP_008235829.1| PREDICTED: aminoacylase-1 isoform X2 [Prunus mume]
Length=440

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TAQP P Y EAADFI+S+A SLSLE+Q +EFV GKPLV+LKW G D +
Sbjct  26   IISRFQRYLQINTAQPKPLYREAADFILSEAASLSLESQTLEFVPGKPLVLLKWPGSDPS  85

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L ++LLNSHTDV P+E  KW+HPPF A +D + G+IYARGSQDMKCVG+QYLEAIR LKA
Sbjct  86   LSSVLLNSHTDVVPAEHDKWTHPPFSAHLD-SNGDIYARGSQDMKCVGIQYLEAIRRLKA  144

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  145  SGFEPKRSVYLSF  157



>ref|XP_007201041.1| hypothetical protein PRUPE_ppa005858mg [Prunus persica]
 gb|EMJ02240.1| hypothetical protein PRUPE_ppa005858mg [Prunus persica]
Length=440

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TAQP P Y EAADFI+S+A SLSLE+Q +EFV GKPLV+LKW G D +
Sbjct  26   IISRFQRYLQINTAQPKPLYREAADFILSEAASLSLESQTLEFVPGKPLVLLKWPGSDPS  85

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L ++LLNSHTDV P+E  KW+HPPF A +D + G+IYARGSQDMKCVG+QYLEAIR LKA
Sbjct  86   LSSVLLNSHTDVVPAEHDKWTHPPFSAHLD-SNGDIYARGSQDMKCVGIQYLEAIRRLKA  144

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  145  SGFEPKRSVYLSF  157



>ref|XP_006384867.1| aminoacylase family protein [Populus trichocarpa]
 gb|ERP62664.1| aminoacylase family protein [Populus trichocarpa]
Length=456

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP+P Y ++ADF+ISQAKS+ LE Q +EF + KPLV+LKW G D T
Sbjct  39   IISRFQQYLQINTAQPSPLYQQSADFLISQAKSIGLEFQSIEFAQNKPLVLLKWPGSDPT  98

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P E HKW+H PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LK+
Sbjct  99   LPSILLNSHTDVVPVEQHKWAHHPFGAHVD-SDGNIFARGSQDMKCVGMQYLEAIRRLKS  157

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  158  SGFHPLRSVYLSF  170



>ref|XP_011040830.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1 [Populus euphratica]
Length=456

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP+P+Y ++ADF+ISQAKS+ LE Q +EF + KPLV+LKW G D +
Sbjct  39   IISRFQQYLQINTAQPSPQYQQSADFLISQAKSIGLEFQSIEFAQDKPLVLLKWPGSDQS  98

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P E HKW+H PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LK+
Sbjct  99   LPSILLNSHTDVVPVEQHKWAHHPFGAHVD-SDGNIFARGSQDMKCVGMQYLEAIRRLKS  157

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  158  SGFHPLRSVYLSF  170



>ref|XP_008235828.1| PREDICTED: aminoacylase-1 isoform X1 [Prunus mume]
Length=443

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TAQP P Y EAADFI+S+A SLSLE+Q +EFV GKPLV+LKW G D +
Sbjct  26   IISRFQRYLQINTAQPKPLYREAADFILSEAASLSLESQTLEFVPGKPLVLLKWPGSDPS  85

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L ++LLNSHTDV P+E  KW+HPPF A +D + G+IYARGSQDMKCVG+QYLEAIR LKA
Sbjct  86   LSSVLLNSHTDVVPAEHDKWTHPPFSAHLD-SNGDIYARGSQDMKCVGIQYLEAIRRLKA  144

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  145  SGFEPKRSVYLSF  157



>gb|KDO68371.1| hypothetical protein CISIN_1g013216mg [Citrus sinensis]
Length=356

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II RF+ YL+IDT+QPNP Y  A+ FI++QA++LSLE+Q +EF K KPL++LKW G +  
Sbjct  30   IIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQ  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSEP KWSH PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LKA
Sbjct  90   LPSILLNSHTDVVPSEPSKWSHHPFGAHLD-SQGNIFARGSQDMKCVGMQYLEAIRRLKA  148

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  149  SGFQPVRSVYLSF  161



>gb|KJB79747.1| hypothetical protein B456_013G064900 [Gossypium raimondii]
Length=300

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+T+QP+P Y ++  FI++ A+SLSLETQV+EFV+GKPLVILKW G D +
Sbjct  40   IISRFQEYLRINTSQPSPDYKKSTQFILTLAESLSLETQVIEFVQGKPLVILKWPGSDLS  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW + PF A ID   GNI+ARGSQDMKCVG+QY+EA+R LKA
Sbjct  100  LPSILLNSHTDVVPSESSKWDYHPFGAHID-ENGNIFARGSQDMKCVGMQYMEAVRRLKA  158

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  159  SGFQPKRSLYLSF  171



>dbj|BAH56753.1| AT4G38220 [Arabidopsis thaliana]
Length=400

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +EFVKGKPL++LKW G D T
Sbjct  24   IVSRFQEYLRINTVQPNPEYYKAVDFIISQAKPLSLESQTIEFVKGKPLLLLKWVGSDPT  83

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  84   LPAFLLNSHTDVVPFEDSKWTHHPLQAHMD-HHGDIYARGSQDMKCVGMQYLEAIRKLQA  142

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VYLSF
Sbjct  143  SGFKPLRSVYLSF  155



>gb|KDP47023.1| hypothetical protein JCGZ_10750 [Jatropha curcas]
Length=446

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQQYL+IDTAQPNP Y E ADF++SQAKS+ LE+Q +EFVKGKPLV+LKWAG   +
Sbjct  32   IVSRFQQYLQIDTAQPNPHYYEVADFLLSQAKSIGLESQSIEFVKGKPLVLLKWAGAIPS  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILL SHTDV P E  KW +P F AQ+D + GNIYARGSQDMKCVG+QYLEAIR LK+
Sbjct  92   LPSILLYSHTDVVPVEQDKWDYPAFGAQLD-SNGNIYARGSQDMKCVGMQYLEAIRRLKS  150

Query  640  SGFQPIRTVYLSF  678
            SG+QP+R++Y++F
Sbjct  151  SGYQPLRSIYVAF  163



>gb|ABK94846.1| unknown [Populus trichocarpa]
Length=448

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P+Y ++ADF+ISQAK + LE+Q +EFV+ KPL++LKW G D T
Sbjct  34   IISRFQQYLQINTAQPTPQYQQSADFLISQAKFIGLESQSIEFVQNKPLILLKWPGSDPT  93

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P E HKW+H PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LK+
Sbjct  94   LPSILLNSHTDVVPVEHHKWTHHPFGAHVD-SHGNIFARGSQDMKCVGMQYLEAIRRLKS  152

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  153  SGFVPLRSVYLSF  165



>ref|NP_849516.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AEE86895.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=433

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +EFVKGKPL++LKW G D T
Sbjct  24   IVSRFQEYLRINTVQPNPEYYKAVDFIISQAKPLSLESQTIEFVKGKPLLLLKWVGSDPT  83

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  84   LPAFLLNSHTDVVPFEDSKWTHHPLQAHMD-HHGDIYARGSQDMKCVGMQYLEAIRKLQA  142

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VYLSF
Sbjct  143  SGFKPLRSVYLSF  155



>ref|XP_002312793.2| aminoacylase family protein [Populus trichocarpa]
 gb|EEE86748.2| aminoacylase family protein [Populus trichocarpa]
Length=448

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P+Y ++ADF+ISQAK + LE+Q +EFV+ KPL++LKW G D T
Sbjct  34   IISRFQQYLQINTAQPTPQYQQSADFLISQAKFIGLESQSIEFVQNKPLILLKWPGSDPT  93

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P E HKW+H PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LK+
Sbjct  94   LPSILLNSHTDVVPVEHHKWTHHPFGAHVD-SHGNIFARGSQDMKCVGMQYLEAIRRLKS  152

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  153  SGFVPLRSVYLSF  165



>ref|NP_568036.2| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AAL75900.1| AT4g38220/F20D10_340 [Arabidopsis thaliana]
 gb|AEE86894.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=430

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +EFVKGKPL++LKW G D T
Sbjct  24   IVSRFQEYLRINTVQPNPEYYKAVDFIISQAKPLSLESQTIEFVKGKPLLLLKWVGSDPT  83

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  84   LPAFLLNSHTDVVPFEDSKWTHHPLQAHMD-HHGDIYARGSQDMKCVGMQYLEAIRKLQA  142

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VYLSF
Sbjct  143  SGFKPLRSVYLSF  155



>ref|XP_006422413.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|ESR35653.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|KDO68369.1| hypothetical protein CISIN_1g013216mg [Citrus sinensis]
Length=447

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II RF+ YL+IDT+QPNP Y  A+ FI++QA++LSLE+Q +EF K KPL++LKW G +  
Sbjct  30   IIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQ  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSEP KWSH PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LKA
Sbjct  90   LPSILLNSHTDVVPSEPSKWSHHPFGAHLD-SQGNIFARGSQDMKCVGMQYLEAIRRLKA  148

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  149  SGFQPVRSVYLSF  161



>ref|XP_006486586.1| PREDICTED: aminoacylase-1-like isoform X2 [Citrus sinensis]
Length=444

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II RF+ YL+IDT+QPNP Y  A+ FI++QA++LSLE+Q +EF K KPL++LKW G +  
Sbjct  30   IIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQ  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSEP KWSH PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LKA
Sbjct  90   LPSILLNSHTDVVPSEPSKWSHHPFGAHLD-SQGNIFARGSQDMKCVGMQYLEAIRRLKA  148

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  149  SGFQPVRSVYLSF  161



>ref|XP_006486585.1| PREDICTED: aminoacylase-1-like isoform X1 [Citrus sinensis]
Length=447

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II RF+ YL+IDT+QPNP Y  A+ FI++QA++LSLE+Q +EF K KPL++LKW G +  
Sbjct  30   IIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQ  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSEP KWSH PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LKA
Sbjct  90   LPSILLNSHTDVVPSEPSKWSHHPFGAHLD-SQGNIFARGSQDMKCVGMQYLEAIRRLKA  148

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  149  SGFQPVRSVYLSF  161



>ref|XP_006422412.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|ESR35652.1| hypothetical protein CICLE_v10028440mg [Citrus clementina]
 gb|KDO68370.1| hypothetical protein CISIN_1g013216mg [Citrus sinensis]
Length=444

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II RF+ YL+IDT+QPNP Y  A+ FI++QA++LSLE+Q +EF K KPL++LKW G +  
Sbjct  30   IIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQ  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSEP KWSH PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LKA
Sbjct  90   LPSILLNSHTDVVPSEPSKWSHHPFGAHLD-SQGNIFARGSQDMKCVGMQYLEAIRRLKA  148

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  149  SGFQPVRSVYLSF  161



>ref|XP_008347555.1| PREDICTED: aminoacylase-1-like [Malus domestica]
Length=446

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+TA PNP+Y EAADFI+S+A+SLSLE+Q +EFV GK LV+LKW G + +
Sbjct  29   IISRFQRYLRINTAHPNPQYREAADFILSEAESLSLESQTLEFVPGKHLVLLKWPGSEPS  88

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L ++LLNSHTDV P+E  KW HPPF A +D + G++YARGSQDMKCVG+QYLEAIR LKA
Sbjct  89   LSSVLLNSHTDVVPAEHDKWVHPPFSANLD-SNGDVYARGSQDMKCVGIQYLEAIRRLKA  147

Query  640  SGFQPIRTVYLSF  678
            SGF+P R+VYLSF
Sbjct  148  SGFKPKRSVYLSF  160



>gb|KJB79749.1| hypothetical protein B456_013G064900 [Gossypium raimondii]
Length=400

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+T+QP+P Y ++  FI++ A+SLSLETQV+EFV+GKPLVILKW G D +
Sbjct  40   IISRFQEYLRINTSQPSPDYKKSTQFILTLAESLSLETQVIEFVQGKPLVILKWPGSDLS  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW + PF A ID   GNI+ARGSQDMKCVG+QY+EA+R LKA
Sbjct  100  LPSILLNSHTDVVPSESSKWDYHPFGAHID-ENGNIFARGSQDMKCVGMQYMEAVRRLKA  158

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  159  SGFQPKRSLYLSF  171



>gb|KFK30433.1| hypothetical protein AALP_AA7G260300 [Arabis alpina]
Length=436

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT QP P Y +A DF+ SQA+SLSLE+Q +E VKGKPL++LKW G D +
Sbjct  30   IVSRFQEYLRIDTVQPKPDYYKAVDFLNSQAQSLSLESQTIELVKGKPLLLLKWPGSDPS  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A IDP  GNIYARGSQDMKCVG+QYLEAIR L+A
Sbjct  90   LPAFLLNSHTDVVPFEDSKWTHHPLHAHIDP-HGNIYARGSQDMKCVGMQYLEAIRKLQA  148

Query  640  SGFQPIRTVYLSF  678
            SGF+PIR+VYLSF
Sbjct  149  SGFKPIRSVYLSF  161



>gb|KFK30432.1| hypothetical protein AALP_AA7G260300 [Arabis alpina]
Length=437

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT QP P Y +A DF+ SQA+SLSLE+Q +E VKGKPL++LKW G D +
Sbjct  30   IVSRFQEYLRIDTVQPKPDYYKAVDFLNSQAQSLSLESQTIELVKGKPLLLLKWPGSDPS  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A IDP  GNIYARGSQDMKCVG+QYLEAIR L+A
Sbjct  90   LPAFLLNSHTDVVPFEDSKWTHHPLHAHIDP-HGNIYARGSQDMKCVGMQYLEAIRKLQA  148

Query  640  SGFQPIRTVYLSF  678
            SGF+PIR+VYLSF
Sbjct  149  SGFKPIRSVYLSF  161



>gb|KJB79748.1| hypothetical protein B456_013G064900 [Gossypium raimondii]
Length=408

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+T+QP+P Y ++  FI++ A+SLSLETQV+EFV+GKPLVILKW G D +
Sbjct  40   IISRFQEYLRINTSQPSPDYKKSTQFILTLAESLSLETQVIEFVQGKPLVILKWPGSDLS  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW + PF A ID   GNI+ARGSQDMKCVG+QY+EA+R LKA
Sbjct  100  LPSILLNSHTDVVPSESSKWDYHPFGAHID-ENGNIFARGSQDMKCVGMQYMEAVRRLKA  158

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  159  SGFQPKRSLYLSF  171



>ref|XP_011000859.1| PREDICTED: aminoacylase-1-like [Populus euphratica]
Length=486

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 114/133 (86%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+TAQP P+Y ++A+F++SQAK + LE+Q +EFV+ KPL++LKW G D T
Sbjct  72   IISRFQQYLQINTAQPTPQYQQSAEFLVSQAKFIGLESQSIEFVQNKPLILLKWPGSDPT  131

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P E HKW+H PF A +D + GNI+ARGSQDMKCVG+QYLEAIR LK+
Sbjct  132  LPSILLNSHTDVVPVENHKWAHHPFGAHVD-SDGNIFARGSQDMKCVGMQYLEAIRRLKS  190

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  191  SGFVPLRSVYLSF  203



>gb|KJB79746.1| hypothetical protein B456_013G064900 [Gossypium raimondii]
Length=454

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+T+QP+P Y ++  FI++ A+SLSLETQV+EFV+GKPLVILKW G D +
Sbjct  40   IISRFQEYLRINTSQPSPDYKKSTQFILTLAESLSLETQVIEFVQGKPLVILKWPGSDLS  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW + PF A ID   GNI+ARGSQDMKCVG+QY+EA+R LKA
Sbjct  100  LPSILLNSHTDVVPSESSKWDYHPFGAHID-ENGNIFARGSQDMKCVGMQYMEAVRRLKA  158

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  159  SGFQPKRSLYLSF  171



>ref|XP_010932091.1| PREDICTED: aminoacylase-1 [Elaeis guineensis]
Length=466

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRF++YLRI+T+QP+P Y  A  F+ +QA  L LE+ V+EFV GKPL++L+W G+  +L
Sbjct  52   VSRFREYLRINTSQPDPDYDAAVRFLRAQADDLGLESDVLEFVSGKPLLLLRWVGRIPSL  111

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P +LLNSHTDV P+EP KW+HPPF A +DPATGN+YARGSQDMKCVGLQYLEAIR L+A+
Sbjct  112  PALLLNSHTDVVPTEPLKWAHPPFSAALDPATGNLYARGSQDMKCVGLQYLEAIRRLRAA  171

Query  643  GFQPIRTVYLSF  678
            GF P RT+YLSF
Sbjct  172  GFAPDRTIYLSF  183



>gb|KHG04612.1| Aminoacylase-1 [Gossypium arboreum]
Length=454

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+T+QP+P Y ++  FI+S A+SLSLETQV+EFV+GKPLVILKW G D  
Sbjct  40   IISRFQEYLRINTSQPSPNYKKSTQFILSLAESLSLETQVIEFVQGKPLVILKWPGSDLF  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW + PF A ID   GNI+ARGSQDMKCVG+QY+EA+R LKA
Sbjct  100  LPSILLNSHTDVVPSERSKWDYHPFGAHID-ENGNIFARGSQDMKCVGMQYMEAVRRLKA  158

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  159  SGFQPKRSLYLSF  171



>ref|XP_007043101.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOX98932.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
Length=434

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TAQP+P Y ++  FI+SQA S+SLE+QV+EFVKGKP+V+LKW G D +
Sbjct  40   IISRFQEYLQINTAQPSPDYQKSTHFILSQANSISLESQVIEFVKGKPVVLLKWPGSDPS  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSE  KW HPP  A ID   GNI+ARG+QDMKCVG+QYLEAIR LK+
Sbjct  100  LPSVLLNSHTDVVPSEYSKWVHPPLGAHID-GEGNIFARGTQDMKCVGMQYLEAIRRLKS  158

Query  640  SGFQPIRTVYLSF  678
            SGF P R++YLSF
Sbjct  159  SGFHPKRSLYLSF  171



>ref|XP_007043100.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOX98931.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=454

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 112/133 (84%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+TAQP+P Y ++  FI+SQA S+SLE+QV+EFVKGKP+V+LKW G D +
Sbjct  40   IISRFQEYLQINTAQPSPDYQKSTHFILSQANSISLESQVIEFVKGKPVVLLKWPGSDPS  99

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSE  KW HPP  A ID   GNI+ARG+QDMKCVG+QYLEAIR LK+
Sbjct  100  LPSVLLNSHTDVVPSEYSKWVHPPLGAHID-GEGNIFARGTQDMKCVGMQYLEAIRRLKS  158

Query  640  SGFQPIRTVYLSF  678
            SGF P R++YLSF
Sbjct  159  SGFHPKRSLYLSF  171



>emb|CDY59101.1| BnaCnng34250D [Brassica napus]
Length=447

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT QP P Y +A DFI SQAKSLSLE+Q  EFVKGKP ++LKW G D T
Sbjct  41   IVSRFQEYLRIDTVQPKPDYYKAVDFINSQAKSLSLESQTNEFVKGKPHLLLKWVGSDPT  100

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QY+EAIR L+A
Sbjct  101  LPAILLNSHTDVVPFEESKWTHHPLHAHMD-NQGDIYARGSQDMKCVGMQYIEAIRKLQA  159

Query  640  SGFQPIRTVYLSF  678
            SGF PIR+VYLSF
Sbjct  160  SGFHPIRSVYLSF  172



>emb|CDY71051.1| BnaCnng71090D [Brassica napus]
Length=432

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT QP P Y +A DF+ SQAKSLSLE+Q  EFVKGKP ++LKW G D T
Sbjct  26   IVSRFQEYLRIDTVQPKPDYYKAVDFLNSQAKSLSLESQTNEFVKGKPHLLLKWVGSDPT  85

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  86   LPAILLNSHTDVVPFEESKWTHHPLHAHMD-NQGDIYARGSQDMKCVGMQYLEAIRKLQA  144

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  145  SGFHPVRSVYLSF  157



>gb|KJB77467.1| hypothetical protein B456_012G138500 [Gossypium raimondii]
Length=373

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T QP+P Y  +  F++SQA SLSLE+QV+EFVKGKP+++LKW G D +
Sbjct  39   IISRFQQYLQINTTQPSPDYQSSTQFLLSQANSLSLESQVIEFVKGKPVILLKWPGSDLS  98

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P EP KW+HPP  A ID   GNI+ RGSQDMK VG+QYLEAIR LK 
Sbjct  99   LPSILLNSHTDVVPFEPSKWTHPPLGAYIDEG-GNIFGRGSQDMKSVGMQYLEAIRRLKL  157

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  158  SGFQPKRSLYLSF  170



>ref|XP_006849977.1| hypothetical protein AMTR_s00022p00154990 [Amborella trichopoda]
 gb|ERN11558.1| hypothetical protein AMTR_s00022p00154990 [Amborella trichopoda]
Length=309

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+IDTA PNP Y  +  FI+S A+S+ L+ + +EF KGKP+VILKW G+ + 
Sbjct  32   IISRFQQYLQIDTAHPNPNYSLSTTFILSLAESIGLQYETLEFAKGKPVVILKWPGEKTQ  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L +ILLNSHTDV PSE HKW HPP  A ID   G+IYARGSQDMKCVGLQYLEAI+ LK 
Sbjct  92   LSSILLNSHTDVVPSENHKWVHPPLSAHID-FNGDIYARGSQDMKCVGLQYLEAIKRLKR  150

Query  640  SGFQPIRTVYLSF  678
            +GF+P+RTVYLSF
Sbjct  151  NGFKPVRTVYLSF  163



>emb|CAB37562.1| putative protein [Arabidopsis thaliana]
 emb|CAB80487.1| putative protein [Arabidopsis thaliana]
Length=753

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y +A DFIISQAK LSLE+Q +EFVKGKPL++LKW G D T
Sbjct  24   IVSRFQEYLRINTVQPNPEYYKAVDFIISQAKPLSLESQTIEFVKGKPLLLLKWVGSDPT  83

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  84   LPAFLLNSHTDVVPFEDSKWTHHPLQAHMD-HHGDIYARGSQDMKCVGMQYLEAIRKLQA  142

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VYLSF
Sbjct  143  SGFKPLRSVYLSF  155



>ref|XP_011458107.1| PREDICTED: aminoacylase-1 isoform X2 [Fragaria vesca subsp. vesca]
Length=443

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            +IS FQ+YL+I+TA P P Y EAADFI+++A SLSL++Q +EFV GKPLV+LKW G D +
Sbjct  30   VISMFQKYLQINTAHPKPLYQEAADFILTEANSLSLQSQTLEFVPGKPLVLLKWPGSDPS  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E  KW+H PF A +DP  G IYARGSQDMKCVGLQYLEAIR LK 
Sbjct  90   LPSILLNSHTDVVPAEHDKWAHHPFAAHVDP-NGKIYARGSQDMKCVGLQYLEAIRRLKT  148

Query  640  SGFQPIRTVYLSF  678
            SGF P R+VYLSF
Sbjct  149  SGFVPTRSVYLSF  161



>ref|XP_004290084.1| PREDICTED: aminoacylase-1 isoform X1 [Fragaria vesca subsp. vesca]
Length=446

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            +IS FQ+YL+I+TA P P Y EAADFI+++A SLSL++Q +EFV GKPLV+LKW G D +
Sbjct  30   VISMFQKYLQINTAHPKPLYQEAADFILTEANSLSLQSQTLEFVPGKPLVLLKWPGSDPS  89

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P+E  KW+H PF A +DP  G IYARGSQDMKCVGLQYLEAIR LK 
Sbjct  90   LPSILLNSHTDVVPAEHDKWAHHPFAAHVDP-NGKIYARGSQDMKCVGLQYLEAIRRLKT  148

Query  640  SGFQPIRTVYLSF  678
            SGF P R+VYLSF
Sbjct  149  SGFVPTRSVYLSF  161



>ref|XP_009132387.1| PREDICTED: aminoacylase-1B-like isoform X2 [Brassica rapa]
 emb|CDY61892.1| BnaAnng17940D [Brassica napus]
Length=432

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT QP P Y +A DF+ SQAKSLSLE+Q  EFVKGKP ++LKW G D T
Sbjct  26   IVSRFQEYLRIDTVQPKPDYYKAVDFLNSQAKSLSLESQTNEFVKGKPHLLLKWVGSDPT  85

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  86   LPAILLNSHTDVVPFEESKWTHHPLHAHMD-NQGDIYARGSQDMKCVGMQYLEAIRKLQA  144

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  145  SGFHPLRSVYLSF  157



>ref|XP_009125879.1| PREDICTED: aminoacylase-1B-like isoform X1 [Brassica rapa]
Length=439

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT QP P Y +A DF+ SQAKSLSLE+Q  EFVKGKP ++LKW G D T
Sbjct  26   IVSRFQEYLRIDTVQPKPDYYKAVDFLNSQAKSLSLESQTNEFVKGKPHLLLKWVGSDPT  85

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  86   LPAILLNSHTDVVPFEESKWTHHPLHAHMD-NQGDIYARGSQDMKCVGMQYLEAIRKLQA  144

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  145  SGFHPLRSVYLSF  157



>ref|XP_010555164.1| PREDICTED: aminoacylase-1 isoform X1 [Tarenaya hassleriana]
Length=500

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLR++T QPNP Y +A +FIISQAKSLSLE+Q +E VKGKPL++LKW G   T
Sbjct  83   IVSRFQEYLRVNTVQPNPDYHKAVEFIISQAKSLSLESQTIELVKGKPLLLLKWVGSHPT  142

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P    +DP  G I+ARGSQDMKCVG+QYLEAIR L+A
Sbjct  143  LPVVLLNSHTDVVPFEESKWNHHPLSGHVDP-DGKIFARGSQDMKCVGMQYLEAIRKLQA  201

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  202  SGFQPHRSIYLSF  214



>ref|XP_010555165.1| PREDICTED: aminoacylase-1 isoform X2 [Tarenaya hassleriana]
Length=497

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLR++T QPNP Y +A +FIISQAKSLSLE+Q +E VKGKPL++LKW G   T
Sbjct  83   IVSRFQEYLRVNTVQPNPDYHKAVEFIISQAKSLSLESQTIELVKGKPLLLLKWVGSHPT  142

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P    +DP  G I+ARGSQDMKCVG+QYLEAIR L+A
Sbjct  143  LPVVLLNSHTDVVPFEESKWNHHPLSGHVDP-DGKIFARGSQDMKCVGMQYLEAIRKLQA  201

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  202  SGFQPHRSIYLSF  214



>ref|XP_009101955.1| PREDICTED: aminoacylase-1B [Brassica rapa]
Length=433

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT  P P Y +A DF+ SQAKSLSLE+Q  EFVKGKP ++LKW G D T
Sbjct  27   IVSRFQEYLRIDTVHPKPDYYKAVDFLNSQAKSLSLESQTNEFVKGKPHLLLKWVGSDPT  86

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  87   LPAILLNSHTDVVPFEESKWTHHPLHAHMD-NQGDIYARGSQDMKCVGMQYLEAIRKLQA  145

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  146  SGFHPLRSVYLSF  158



>emb|CDY54793.1| BnaA06g40880D [Brassica napus]
Length=433

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRIDT  P P Y +A DF+ SQAKSLSLE+Q  EFVKGKP ++LKW G D T
Sbjct  27   IVSRFQEYLRIDTVHPKPDYYKAVDFLNSQAKSLSLESQTNEFVKGKPHLLLKWVGSDPT  86

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  87   LPAILLNSHTDVVPFEESKWTHHPLHAHMD-NQGDIYARGSQDMKCVGMQYLEAIRKLQA  145

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VYLSF
Sbjct  146  SGFHPLRSVYLSF  158



>ref|XP_006411609.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
 gb|ESQ53062.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
Length=441

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QP P Y +A DFI SQAKSLSLE+Q +E VKGKPL++LKW G D T
Sbjct  35   IVSRFQEYLRINTVQPKPDYYKAVDFINSQAKSLSLESQTIELVKGKPLLLLKWVGSDPT  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  95   LPALLLNSHTDVVPFEESKWTHHPLHAHVD-HRGDIYARGSQDMKCVGMQYLEAIRKLQA  153

Query  640  SGFQPIRTVYLSF  678
            S F+P+R+VYLSF
Sbjct  154  SAFRPLRSVYLSF  166



>ref|XP_006411610.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
 gb|ESQ53063.1| hypothetical protein EUTSA_v10025205mg [Eutrema salsugineum]
Length=444

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QP P Y +A DFI SQAKSLSLE+Q +E VKGKPL++LKW G D T
Sbjct  35   IVSRFQEYLRINTVQPKPDYYKAVDFINSQAKSLSLESQTIELVKGKPLLLLKWVGSDPT  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSHTDV P E  KW+H P  A +D   G+IYARGSQDMKCVG+QYLEAIR L+A
Sbjct  95   LPALLLNSHTDVVPFEESKWTHHPLHAHVD-HRGDIYARGSQDMKCVGMQYLEAIRKLQA  153

Query  640  SGFQPIRTVYLSF  678
            S F+P+R+VYLSF
Sbjct  154  SAFRPLRSVYLSF  166



>ref|XP_002866787.1| hypothetical protein ARALYDRAFT_327784 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43046.1| hypothetical protein ARALYDRAFT_327784 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YLRI+T QPNP Y +A DFI SQAK LSLE+Q +E VKGKPL++LKW G D T
Sbjct  27   IISRFQEYLRINTVQPNPDYYKAVDFINSQAKPLSLESQTIELVKGKPLLLLKWVGSDPT  86

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP  LLNSHTDV P E  KW+H P  A ID   G+IYARGSQDMKCVGLQYLEAIR L+A
Sbjct  87   LPAFLLNSHTDVVPFEDSKWTHHPLQAHID-HHGHIYARGSQDMKCVGLQYLEAIRKLQA  145

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VYLSF
Sbjct  146  SGFQPLRSVYLSF  158



>gb|KJB77468.1| hypothetical protein B456_012G138500 [Gossypium raimondii]
Length=453

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T QP+P Y  +  F++SQA SLSLE+QV+EFVKGKP+++LKW G D +
Sbjct  39   IISRFQQYLQINTTQPSPDYQSSTQFLLSQANSLSLESQVIEFVKGKPVILLKWPGSDLS  98

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P EP KW+HPP  A ID   GNI+ RGSQDMK VG+QYLEAIR LK 
Sbjct  99   LPSILLNSHTDVVPFEPSKWTHPPLGAYIDEG-GNIFGRGSQDMKSVGMQYLEAIRRLKL  157

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  158  SGFQPKRSLYLSF  170



>gb|KJB77466.1| hypothetical protein B456_012G138500 [Gossypium raimondii]
Length=446

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T QP+P Y  +  F++SQA SLSLE+QV+EFVKGKP+++LKW G D +
Sbjct  39   IISRFQQYLQINTTQPSPDYQSSTQFLLSQANSLSLESQVIEFVKGKPVILLKWPGSDLS  98

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P EP KW+HPP  A ID   GNI+ RGSQDMK VG+QYLEAIR LK 
Sbjct  99   LPSILLNSHTDVVPFEPSKWTHPPLGAYIDEG-GNIFGRGSQDMKSVGMQYLEAIRRLKL  157

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  158  SGFQPKRSLYLSF  170



>ref|XP_002514407.1| Aminoacylase-1, putative [Ricinus communis]
 gb|EEF48003.1| Aminoacylase-1, putative [Ricinus communis]
Length=459

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 108/130 (83%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQQYL+I+TAQPNP Y EAA+FIIS+AKS+ LE Q +E VKGKPLV+LKW G + TLP+
Sbjct  48   RFQQYLQINTAQPNPHYQEAAEFIISEAKSIGLEFQCIELVKGKPLVLLKWQGSNPTLPS  107

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            ILL SHTDV P E HKWS+P F A +D + GNIYARGSQDMKCVG+QYLEA+R L +SGF
Sbjct  108  ILLYSHTDVVPVEQHKWSYPAFGAHLD-SDGNIYARGSQDMKCVGMQYLEAVRRLMSSGF  166

Query  649  QPIRTVYLSF  678
             P+R+VY+ F
Sbjct  167  HPLRSVYILF  176



>gb|KHG17235.1| Aminoacylase-1 [Gossypium arboreum]
Length=451

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ+YL+I+T+QP+P Y ++  FI+SQA SLSL++QV+EFV+GKP+V+L+W G D +
Sbjct  37   IISRFQRYLQINTSQPSPDYQKSTHFILSQADSLSLQSQVIEFVQGKPIVLLQWPGSDPS  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW HPPF A ID   GNI+ARGSQDMKCVG+QYLEAIR L++
Sbjct  97   LPSILLNSHTDVVPSEYSKWVHPPFGAHID-EQGNIFARGSQDMKCVGMQYLEAIRRLRS  155

Query  640  SGFQPIRTVYLSF  678
            SGF P R++YLSF
Sbjct  156  SGFCPKRSLYLSF  168



>ref|XP_010028870.1| PREDICTED: aminoacylase-1 [Eucalyptus grandis]
 gb|KCW55690.1| hypothetical protein EUGRSUZ_I01541 [Eucalyptus grandis]
Length=449

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I++RFQ+YLRI+TAQP+P Y ++ DF++S+AKSL+LE + VEFV GKP+V+L+W G D +
Sbjct  35   IVARFQRYLRINTAQPSPDYAQSTDFLLSEAKSLALEGRAVEFVPGKPVVLLRWPGSDPS  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV P+E  KWS PPF A+ D A G IYARGSQDMKCVG+QYLEAIR LK 
Sbjct  95   LPSVLLNSHTDVQPAEDGKWSLPPFAARAD-AEGRIYARGSQDMKCVGMQYLEAIRRLKR  153

Query  640  SGFQPIRTVYLSF  678
            SGF P+R VYLSF
Sbjct  154  SGFAPLRDVYLSF  166



>gb|KJB31968.1| hypothetical protein B456_005G216200 [Gossypium raimondii]
Length=451

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 113/133 (85%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T+QP+P Y ++  FI+SQA SLSL++QV+EFV+GKP+V+L+W G D +
Sbjct  37   IISRFQQYLQINTSQPSPDYQKSTHFILSQADSLSLQSQVIEFVQGKPIVLLQWPGSDPS  96

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV PSE  KW +PPF A ID   GNI+ARGSQDMKCVG+QYLEAIR L++
Sbjct  97   LPSILLNSHTDVVPSEYSKWVYPPFGAHID-EQGNIFARGSQDMKCVGMQYLEAIRRLRS  155

Query  640  SGFQPIRTVYLSF  678
            SGF P R++YLSF
Sbjct  156  SGFCPKRSLYLSF  168



>gb|KHG16687.1| Aminoacylase-1 [Gossypium arboreum]
Length=463

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I+T QP+P Y  +  F++SQA SLSLE+QV+EFVKGKP+++LKW G D +
Sbjct  49   IISRFQQYLQINTTQPSPDYQSSTQFLLSQANSLSLESQVIEFVKGKPVILLKWPGSDLS  108

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSH DV P EP KW+HPP  A ID   GNI+ RGSQDMK VG+QYLEAIR LK 
Sbjct  109  LPSILLNSHMDVVPFEPSKWTHPPLGAYIDEG-GNIFGRGSQDMKSVGMQYLEAIRRLKL  167

Query  640  SGFQPIRTVYLSF  678
            SGFQP R++YLSF
Sbjct  168  SGFQPKRSLYLSF  180



>ref|XP_009114684.1| PREDICTED: aminoacylase-1-like [Brassica rapa]
Length=163

 Score =   182 bits (463),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ YLRI+T QPNP Y  AA+FI  QA+S+SL+ Q +EFV+GKP+V+LKWAG + +
Sbjct  8    IISRFQDYLRINTVQPNPDYYAAANFIKLQAQSISLQYQPIEFVQGKPIVLLKWAGSEPS  67

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV P E  KW HPP  A+ID   G IYARG+QDMK VG+QYLEAIR L A
Sbjct  68   LPAILLNSHVDVVPFEAEKWDHPPLGAEID-EDGRIYARGTQDMKSVGMQYLEAIRKLVA  126

Query  640  SGFQPIRTVYLSF  678
            SG++P+R+VY++F
Sbjct  127  SGYKPLRSVYVTF  139



>ref|XP_006659580.1| PREDICTED: aminoacylase-1-like [Oryza brachyantha]
Length=454

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            +ISRFQ+YLRIDTAQP P Y  A  F+  QA +  LE   +E V GKPL++L+W G+  +
Sbjct  39   VISRFQEYLRIDTAQPAPDYAAAVAFLRGQADAAGLEASTLELVAGKPLLLLRWPGRRPS  98

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSEPHKW HPPF A +D A+G IYARGSQDMKCVG+QYLEAIR L++
Sbjct  99   LPSVLLNSHTDVVPSEPHKWEHPPFSAALDEASGRIYARGSQDMKCVGMQYLEAIRRLRS  158

Query  640  SGFQPIRTVYLSF  678
            +GF P R +YL+F
Sbjct  159  AGFIPDRDIYLTF  171



>ref|XP_009390654.1| PREDICTED: aminoacylase-1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQ+YLRIDTA P+P Y  AA F+ SQA SLSL+ + +EFV GKPL++LKW G+  +L
Sbjct  58   ISRFQEYLRIDTAHPSPDYAAAAAFLRSQADSLSLKHETLEFVAGKPLLLLKWPGRRPSL  117

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSHTDV P+EPHKW HPPF A +  + GNIYARGSQDMKCVG+QYLEAIR LKA+
Sbjct  118  PSLLLNSHTDVVPAEPHKWVHPPFSAALG-SEGNIYARGSQDMKCVGIQYLEAIRRLKAA  176

Query  643  GFQPIRTVYLSF  678
             F P RT+Y+SF
Sbjct  177  RFVPDRTIYISF  188



>ref|XP_002879550.1| hypothetical protein ARALYDRAFT_345276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55809.1| hypothetical protein ARALYDRAFT_345276 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 109/133 (82%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II+RFQ YLRI+T QP+P Y  AA+FIISQAKS+SLE+Q +EFV GKP+V+L+W+G D +
Sbjct  11   IITRFQTYLRINTVQPDPDYIAAANFIISQAKSISLESQSIEFVPGKPIVLLRWSGTDPS  70

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP +LLNSH DV   E  KW+HPP  A+ID   G IYARG+QDMK VG+QYLEAIR LKA
Sbjct  71   LPAVLLNSHVDVVTFEEEKWTHPPLGAEID-EEGKIYARGTQDMKSVGMQYLEAIRKLKA  129

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VY++F
Sbjct  130  SGFEPLRSVYVTF  142



>ref|XP_004973884.1| PREDICTED: aminoacylase-1-like [Setaria italica]
Length=456

 Score =   190 bits (483),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQ+YLRIDTAQP P Y  A  F+  QA    LE + +E V GKPL++L+W G+ S+L
Sbjct  43   ISRFQEYLRIDTAQPAPDYAAAVAFLRGQASEAGLEARTLELVAGKPLLLLRWPGRRSSL  102

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV PSEPHKW HPPF A +D A+G IYARGSQDMKCVG+QYLEAIR L+++
Sbjct  103  PSILLNSHTDVVPSEPHKWDHPPFSAALDEASGRIYARGSQDMKCVGMQYLEAIRRLRSA  162

Query  643  GFQPIRTVYLSF  678
            GF P R +Y+ F
Sbjct  163  GFVPDRNIYIIF  174



>ref|XP_006830441.1| hypothetical protein AMTR_s00351p00009890 [Amborella trichopoda]
 gb|ERM97857.1| hypothetical protein AMTR_s00351p00009890 [Amborella trichopoda]
Length=459

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+IDTA PNP Y  +  FI+S A+++ LE++ +EFV+GKP+VILKW GK + 
Sbjct  50   IISRFQQYLQIDTAHPNPNYSLSTAFILSLAQAIGLESETLEFVEGKPVVILKWPGKKTH  109

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L +ILL+SHTD+ PSE  KW HPP  A ID   G+IYARGSQDMKCVGLQYLEAI+ LK 
Sbjct  110  LSSILLSSHTDIVPSENQKWVHPPLSAHID-HNGDIYARGSQDMKCVGLQYLEAIKRLKI  168

Query  640  SGFQPIRTVYLSF  678
            +GF+P+RTVYLSF
Sbjct  169  NGFEPVRTVYLSF  181



>ref|XP_008787044.1| PREDICTED: aminoacylase-1 isoform X2 [Phoenix dactylifera]
Length=386

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRI+T+QP+P Y  A  F+ +QA +LSLE+ V EF  GKPL++L+W G+  +L
Sbjct  52   VSRFQEYLRINTSQPDPDYATAVRFLRAQADALSLESDVFEFAPGKPLLLLRWPGRIPSL  111

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
              +LLNSHTDV P+EP KW +PPF A +DP+TGNIYARGSQDMKCVGLQYLEA+R L+A+
Sbjct  112  HALLLNSHTDVVPAEPLKWVYPPFSAALDPSTGNIYARGSQDMKCVGLQYLEALRRLRAA  171

Query  643  GFQPIRTVYLSF  678
             F P RT+YLSF
Sbjct  172  DFAPDRTIYLSF  183



>ref|XP_006605409.1| PREDICTED: aminoacylase-1 isoform X2 [Glycine max]
Length=446

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQQYL+I+TAQP PRY EAADF+ISQ K+LSLE+Q +EFV GKPLV+LKW G +  LP+
Sbjct  35   RFQQYLKINTAQPTPRYHEAADFLISQGKALSLESQSIEFVAGKPLVLLKWEGSNPNLPS  94

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            ILL SHTDV PSE  KW+H PF A +D ++G I++RGSQDMKCVG+QYLEA+R LK+  F
Sbjct  95   ILLYSHTDVVPSEHSKWTHHPFSAHLD-SSGRIFSRGSQDMKCVGMQYLEALRLLKSHNF  153

Query  649  QPIRTVYLSF  678
            +P+R++YL+F
Sbjct  154  RPLRSLYLAF  163



>ref|XP_003556753.1| PREDICTED: aminoacylase-1 isoform X1 [Glycine max]
Length=449

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQQYL+I+TAQP PRY EAADF+ISQ K+LSLE+Q +EFV GKPLV+LKW G +  LP+
Sbjct  35   RFQQYLKINTAQPTPRYHEAADFLISQGKALSLESQSIEFVAGKPLVLLKWEGSNPNLPS  94

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            ILL SHTDV PSE  KW+H PF A +D ++G I++RGSQDMKCVG+QYLEA+R LK+  F
Sbjct  95   ILLYSHTDVVPSEHSKWTHHPFSAHLD-SSGRIFSRGSQDMKCVGMQYLEALRLLKSHNF  153

Query  649  QPIRTVYLSF  678
            +P+R++YL+F
Sbjct  154  RPLRSLYLAF  163



>gb|EEC83866.1| hypothetical protein OsI_29850 [Oryza sativa Indica Group]
Length=457

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            ++SRF++YLRIDTAQP P Y  A  F+  QA +  LE + +E V GKPL++L+W G+  +
Sbjct  42   VVSRFREYLRIDTAQPAPDYAAAVAFLRGQAGAAGLEARTLELVAGKPLLLLRWPGRRPS  101

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSEPHKW HPPF A +D A+G IYARGSQDMKCVG+QYLEAIR L++
Sbjct  102  LPSLLLNSHTDVVPSEPHKWDHPPFSAALDEASGRIYARGSQDMKCVGMQYLEAIRRLRS  161

Query  640  SGFQPIRTVYLSF  678
            +GF P R +YL+F
Sbjct  162  AGFIPDRNIYLTF  174



>ref|XP_008787043.1| PREDICTED: aminoacylase-1 isoform X1 [Phoenix dactylifera]
Length=466

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRI+T+QP+P Y  A  F+ +QA +LSLE+ V EF  GKPL++L+W G+  +L
Sbjct  52   VSRFQEYLRINTSQPDPDYATAVRFLRAQADALSLESDVFEFAPGKPLLLLRWPGRIPSL  111

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
              +LLNSHTDV P+EP KW +PPF A +DP+TGNIYARGSQDMKCVGLQYLEA+R L+A+
Sbjct  112  HALLLNSHTDVVPAEPLKWVYPPFSAALDPSTGNIYARGSQDMKCVGLQYLEALRRLRAA  171

Query  643  GFQPIRTVYLSF  678
             F P RT+YLSF
Sbjct  172  DFAPDRTIYLSF  183



>ref|XP_007153022.1| hypothetical protein PHAVU_003G001200g [Phaseolus vulgaris]
 gb|ESW25016.1| hypothetical protein PHAVU_003G001200g [Phaseolus vulgaris]
Length=452

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 107/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQQYL+I+TAQPNP Y EAA+F+IS+ K LSLE+Q +EFV+GKPLV+LKW G +  LP+
Sbjct  41   RFQQYLKINTAQPNPGYKEAAEFLISEGKELSLESQSIEFVEGKPLVLLKWEGTNPHLPS  100

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            ILL SHTDV PSE  KW H PF A +D + G I+ARGSQDMKCVG+QYLEA+R LKA  F
Sbjct  101  ILLYSHTDVVPSEHAKWDHHPFSAHLD-SHGRIFARGSQDMKCVGMQYLEALRRLKARNF  159

Query  649  QPIRTVYLSF  678
            +P+R++YL+F
Sbjct  160  RPLRSLYLAF  169



>ref|XP_010505050.1| PREDICTED: aminoacylase-1-like isoform X2 [Camelina sativa]
Length=414

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II+RFQ YLRI+T QP P Y  AA FIIS+AKS+SLETQ +E V GKP+V+LKW G D +
Sbjct  17   IITRFQNYLRINTVQPTPDYIAAARFIISEAKSISLETQPIELVLGKPIVLLKWIGSDPS  76

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV   E  KW HPP  A+ID   G IYARG+QDMK VG+QY+EAIR LKA
Sbjct  77   LPAILLNSHVDVVAFEEEKWDHPPLGAEID-EQGRIYARGTQDMKSVGMQYIEAIRKLKA  135

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VY++F
Sbjct  136  SGFQPVRSVYVTF  148



>ref|XP_010505049.1| PREDICTED: aminoacylase-1-like isoform X1 [Camelina sativa]
Length=420

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II+RFQ YLRI+T QP P Y  AA FIIS+AKS+SLETQ +E V GKP+V+LKW G D +
Sbjct  17   IITRFQNYLRINTVQPTPDYIAAARFIISEAKSISLETQPIELVLGKPIVLLKWIGSDPS  76

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV   E  KW HPP  A+ID   G IYARG+QDMK VG+QY+EAIR LKA
Sbjct  77   LPAILLNSHVDVVAFEEEKWDHPPLGAEID-EQGRIYARGTQDMKSVGMQYIEAIRKLKA  135

Query  640  SGFQPIRTVYLSF  678
            SGFQP+R+VY++F
Sbjct  136  SGFQPVRSVYVTF  148



>ref|XP_006410701.1| hypothetical protein EUTSA_v10016717mg [Eutrema salsugineum]
 gb|ESQ52154.1| hypothetical protein EUTSA_v10016717mg [Eutrema salsugineum]
Length=420

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ YLRI+T  PNP Y  AADFI SQA+S+SLE+Q +EFV+GKP+V+LKW G D +
Sbjct  17   IVSRFQTYLRINTVHPNPDYRAAADFIKSQAQSISLESQSIEFVEGKPIVLLKWIGSDPS  76

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV P E  KW HPP  A+ID   G IYARG+QDMK VG+QY+EAIR L A
Sbjct  77   LPAILLNSHIDVVPFEADKWDHPPLGAEID-EDGKIYARGTQDMKSVGMQYIEAIRKLIA  135

Query  640  SGFQPIRTVYLSF  678
            SGF P R+VY+SF
Sbjct  136  SGFVPRRSVYVSF  148



>emb|CDX79602.1| BnaC03g19380D [Brassica napus]
Length=410

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ YLRI+T QPNP Y  AA+FI  QA+S+SL+ Q +EFV+GKP+V+LKWAG D +
Sbjct  8    IISRFQDYLRINTVQPNPDYYAAANFIKLQAQSISLQYQSIEFVQGKPIVLLKWAGSDPS  67

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV P E  KW HPP  A+ID   G IYARG+QDMK VG+QYLEAIR L A
Sbjct  68   LPAILLNSHVDVVPFEAEKWDHPPLGAEID-EDGRIYARGTQDMKSVGMQYLEAIRKLVA  126

Query  640  SGFQPIRTVYLSF  678
            SG++P+R+VY++F
Sbjct  127  SGYKPLRSVYVTF  139



>ref|NP_001148589.1| aminoacylase-1 precursor [Zea mays]
 gb|ACG32149.1| aminoacylase-1 [Zea mays]
Length=457

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQ+YLRIDTAQP P Y  A  F+  QA    LE + +E V GKPL++L+W G+  +L
Sbjct  43   ISRFQEYLRIDTAQPAPDYAAAVAFLRKQAAEAGLEARTLELVAGKPLLLLRWPGRRPSL  102

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV PSEP+KW HPPF A +D  +G IYARGSQDMKCVG+QYLEAIR L+++
Sbjct  103  PSILLNSHTDVVPSEPNKWDHPPFSAALDEPSGRIYARGSQDMKCVGMQYLEAIRRLRSA  162

Query  643  GFQPIRTVYLSF  678
            GF P R +Y++F
Sbjct  163  GFVPDRNIYITF  174



>tpg|DAA47999.1| TPA: aminoacylase-1 [Zea mays]
Length=446

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQ+YLRIDTAQP P Y  A  F+  QA    LE + +E V GKPL++L+W G+  +L
Sbjct  32   ISRFQEYLRIDTAQPAPDYAAAVAFLRKQAADAGLEARTLELVAGKPLLLLRWPGRRPSL  91

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV PSEP+KW HPPF A +D  +G IYARGSQDMKCVG+QYLEAIR L+++
Sbjct  92   PSILLNSHTDVVPSEPNKWDHPPFSAALDEPSGRIYARGSQDMKCVGMQYLEAIRRLRSA  151

Query  643  GFQPIRTVYLSF  678
            GF P R +Y++F
Sbjct  152  GFVPDRNIYITF  163



>ref|XP_002444759.1| hypothetical protein SORBIDRAFT_07g027550 [Sorghum bicolor]
 gb|EES14254.1| hypothetical protein SORBIDRAFT_07g027550 [Sorghum bicolor]
Length=457

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQ+YLRIDTAQP P Y  A  F+ +QA    LE + +E V GKPL++L+W G+  +L
Sbjct  43   ISRFQEYLRIDTAQPAPDYAAAVAFLRNQASEAGLEARTLELVAGKPLLLLRWPGRRPSL  102

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSHTDV PSEP KW HPPF A +D A+G IYARGSQDMKCVG+QYLEAIR L++S
Sbjct  103  PSVLLNSHTDVVPSEPSKWDHPPFSAALDEASGRIYARGSQDMKCVGMQYLEAIRRLRSS  162

Query  643  GFQPIRTVYLSF  678
            GF P RT+++ F
Sbjct  163  GFIPDRTIHVIF  174



>ref|XP_006295657.1| hypothetical protein CARUB_v10024772mg [Capsella rubella]
 gb|EOA28555.1| hypothetical protein CARUB_v10024772mg [Capsella rubella]
Length=423

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 104/135 (77%), Gaps = 3/135 (2%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSL--ETQVVEFVKGKPLVILKWAGKD  453
            II+RFQ YLRIDT  P P Y  AADFIISQAKS+SL  E+  +EFV GKP+V+LKW G D
Sbjct  15   IITRFQNYLRIDTVHPTPDYTAAADFIISQAKSISLHLESHSIEFVPGKPVVLLKWIGSD  74

Query  454  STLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSL  633
             +LP ILLNSH DV P E  KW HPP  A+ID   G IYARG+QDMK VG+QYLE+IR L
Sbjct  75   PSLPAILLNSHVDVVPFEEDKWDHPPLGAEID-QDGKIYARGTQDMKSVGMQYLESIRKL  133

Query  634  KASGFQPIRTVYLSF  678
             ASGF+P+R+VY++F
Sbjct  134  IASGFEPVRSVYVTF  148



>emb|CDY65765.1| BnaA03g56420D [Brassica napus]
Length=387

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQ YLRI+T QPNP Y  AA+FI  QA+S+SL+ Q +EFV+GKP+V+LKWAG + +
Sbjct  8    IISRFQDYLRINTVQPNPDYYAAANFIKLQAQSISLQYQPIEFVQGKPIVLLKWAGSEPS  67

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV P E  KW HPP  A+ID   G IYARG+QDMK VG+QYLEAIR L A
Sbjct  68   LPAILLNSHVDVVPFEAEKWDHPPLGAEID-EDGRIYARGTQDMKSVGMQYLEAIRKLVA  126

Query  640  SGFQPIRTVYLSF  678
            SG++P+R+VY++F
Sbjct  127  SGYKPLRSVYVTF  139



>ref|XP_010509616.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=420

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II+RFQ YLRI+T  P P Y  AA FIIS+AKS+SLETQ +E V GKP+V+LKW G D +
Sbjct  17   IITRFQTYLRINTVHPTPDYIAAARFIISEAKSISLETQPIELVLGKPIVLLKWIGSDPS  76

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV   E  KW HPP  A+ID   G IYARG+QDMK VG+QYLEAIR LKA
Sbjct  77   LPAILLNSHVDVVAFEEDKWDHPPLGAEID-EQGRIYARGTQDMKSVGMQYLEAIRKLKA  135

Query  640  SGFQPIRTVYLSF  678
            SGF+P+R+VY++F
Sbjct  136  SGFEPVRSVYVTF  148



>dbj|BAD10058.1| putative aminoacylase [Oryza sativa Japonica Group]
Length=456

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            ++SRF++YLRIDTAQP P Y  A  F+  QA +  LE + +E V GKPL++L+W G+  +
Sbjct  42   VVSRFREYLRIDTAQPAPDYAAAVAFLRGQAGAAGLEARTLELVAGKPLLLLRWPGRRPS  101

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP++LLNSHTDV PSEPHKW HPPF A +D A+G IYARGS DMKCVG+QYLEAIR L++
Sbjct  102  LPSLLLNSHTDVVPSEPHKWDHPPFSAALDEASGRIYARGS-DMKCVGMQYLEAIRRLRS  160

Query  640  SGFQPIRTVYLSF  678
            +GF P R +YL+F
Sbjct  161  AGFIPDRNIYLTF  173



>ref|XP_003589763.1| Aminoacylase-1 [Medicago truncatula]
 gb|AES60014.1| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=446

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+  T  P P Y ++ +F+ +QA SLSL++Q +EFV GKPL++LKW G +S 
Sbjct  32   IISRFQQYLQTRTDHPTPNYTQSTNFLTTQANSLSLQSQTIEFVSGKPLILLKWTGTNSN  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+L SHTDV P+E  KW H PF+A +D   G IYARGSQDMKCVG+QYLEA+R+LK 
Sbjct  92   LPSIMLYSHTDVVPAEHDKWDHHPFEAHVDDE-GRIYARGSQDMKCVGMQYLEAVRNLKG  150

Query  640  SGFQPIRTVYLSF  678
              FQP RTVYL F
Sbjct  151  WDFQPKRTVYLVF  163



>ref|XP_003572375.1| PREDICTED: aminoacylase-1 [Brachypodium distachyon]
Length=445

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRIDTAQP P Y  A  F+  QA +  LE + +E   GKPL++L+W G+  +L
Sbjct  31   VSRFQEYLRIDTAQPAPDYAAAVAFLRDQAAAAGLEARTLEPAAGKPLLVLRWLGRRPSL  90

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV PSEP KW H PF A +D A+G IYARGSQDMKCVG+QYLEAIR L+ +
Sbjct  91   PSILLNSHTDVVPSEPKKWEHAPFSAALDEASGRIYARGSQDMKCVGMQYLEAIRRLRDA  150

Query  643  GFQPIRTVYLSF  678
            GF P R +Y++F
Sbjct  151  GFVPDRNIYITF  162



>dbj|BAK06600.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92000.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRIDTAQP P Y  A  F+  QA    LE + +EF  GKPL++L+W G+  +L
Sbjct  35   VSRFQEYLRIDTAQPTPDYAAAVAFLRDQAAPAGLEARTLEFAAGKPLLLLRWPGRRPSL  94

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV PSEP KW H P  A +D A+G IYARGSQDMKCVG+QYLEAIR L+ +
Sbjct  95   PSILLNSHTDVVPSEPKKWEHAPLSATLDEASGRIYARGSQDMKCVGMQYLEAIRRLRNA  154

Query  643  GFQPIRTVYLSF  678
            GF P R +Y+ F
Sbjct  155  GFVPDRNIYIIF  166



>gb|ADE76225.1| unknown [Picea sitchensis]
Length=446

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IIS FQQYLR  TA PNP Y  A +FI+S+AKS+ L TQ++EF KGKP+++L W GK+ +
Sbjct  32   IISEFQQYLRFPTAHPNPNYKPAQEFIVSKAKSIGLNTQLLEFAKGKPIILLTWTGKNPS  91

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
             P+ILLNSH D  P+EP KW H PF A I    GNIYARGSQD KC+G+QYLEAI  LK 
Sbjct  92   WPSILLNSHLDSVPAEPEKWVHDPFQA-IKDIKGNIYARGSQDDKCIGMQYLEAINRLKT  150

Query  640  SGFQPIRTVYLSF  678
             G+QP+RTV++SF
Sbjct  151  KGYQPLRTVHVSF  163



>ref|XP_004498100.1| PREDICTED: aminoacylase-1-like isoform X1 [Cicer arietinum]
Length=456

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQ YL+I T QPNP Y ++ +F+ SQAKSLSL++Q +E V GKPLV+LKWAG    LP+
Sbjct  42   RFQTYLQIKTDQPNPNYTQSTNFLTSQAKSLSLQSQTIELVSGKPLVLLKWAGTSPNLPS  101

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            I+L SHTDV P+E  KW+H PF+A ID + G IYARGSQDMKCVG+QYLEA+R LK  GF
Sbjct  102  IMLYSHTDVVPAEHDKWAHHPFEAHID-SRGRIYARGSQDMKCVGMQYLEAVRKLKGWGF  160

Query  649  QPIRTVYLSF  678
             P R VYL F
Sbjct  161  VPKRDVYLVF  170



>ref|XP_004498101.1| PREDICTED: aminoacylase-1-like isoform X2 [Cicer arietinum]
Length=453

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +1

Query  289  RFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLPT  468
            RFQ YL+I T QPNP Y ++ +F+ SQAKSLSL++Q +E V GKPLV+LKWAG    LP+
Sbjct  42   RFQTYLQIKTDQPNPNYTQSTNFLTSQAKSLSLQSQTIELVSGKPLVLLKWAGTSPNLPS  101

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            I+L SHTDV P+E  KW+H PF+A ID + G IYARGSQDMKCVG+QYLEA+R LK  GF
Sbjct  102  IMLYSHTDVVPAEHDKWAHHPFEAHID-SRGRIYARGSQDMKCVGMQYLEAVRKLKGWGF  160

Query  649  QPIRTVYLSF  678
             P R VYL F
Sbjct  161  VPKRDVYLVF  170



>ref|XP_001760477.1| predicted protein [Physcomitrella patens]
 gb|EDQ74868.1| predicted protein [Physcomitrella patens]
Length=443

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            + RF+ +LRI T  P P Y    +F+++QAK + LE + +E+VKGKP+V+L W GKD +L
Sbjct  33   VGRFKTFLRIATVHPLPDYQPPTEFLLAQAKEIGLEARTLEYVKGKPVVLLTWMGKDPSL  92

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH DV P+E  KW H PF A ++   GNI+ARGSQDMKCVGLQYLEAIR+LKA 
Sbjct  93   PSVLLNSHVDVVPAEKSKWKHDPF-AAVEDEEGNIFARGSQDMKCVGLQYLEAIRNLKAQ  151

Query  643  GFQPIRTVYLSF  678
            GF+P RT+Y+S+
Sbjct  152  GFEPTRTIYISY  163



>ref|XP_002879551.1| hypothetical protein ARALYDRAFT_902649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55810.1| hypothetical protein ARALYDRAFT_902649 [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YLRI+T QPNP Y EA  FI  +A  + L+ + +EFV  KP+V+LKW G D +
Sbjct  10   IVSRFQEYLRINTVQPNPNYMEAVQFIFREAHLIGLQAESIEFVAAKPIVLLKWTGSDES  69

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP ILLNSH DV   E   W  PP  A+ID   G IYA+G+QDMK VG+QYLEAIR LKA
Sbjct  70   LPAILLNSHIDVVSFEEDNWDRPPLGAEID-GEGKIYAKGTQDMKSVGMQYLEAIRMLKA  128

Query  640  SGFQPIRTVYLSF  678
            SGF P+R+VY+ F
Sbjct  129  SGFNPLRSVYVLF  141



>ref|XP_010479044.1| PREDICTED: aminoacylase-1 [Camelina sativa]
Length=445

 Score =   169 bits (429),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y  A  F++ QA+S+ L ++ +EFV GKP+++L W G +S L
Sbjct  36   ITRFQQYLRINTAHPNPNYTAAVSFLLDQARSIGLTSRTIEFVPGKPVLLLTWLGSNSNL  95

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G+IYARG+QD KC+G+QYLEAI++LK+ 
Sbjct  96   PSILFNSHLDSVPAESEKWIHPPFSAH-RTVDGHIYARGAQDDKCIGIQYLEAIKNLKSR  154

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  155  GFSPLRTVHISY  166



>ref|XP_010500137.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=444

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y  A  F++ QA+S+ L ++ +EFV GKP+++L W G +S L
Sbjct  35   ITRFQQYLRINTAHPNPNYTAAVSFLLDQARSIGLTSRTIEFVPGKPVLLLTWLGSNSNL  94

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G+IYARG+QD KCVG+QYLEAI++LK+ 
Sbjct  95   PSILFNSHLDSVPAESEKWIHPPFSAH-RTVDGHIYARGAQDDKCVGVQYLEAIKNLKSR  153

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  154  GFSPLRTVHVSY  165



>ref|XP_006307424.1| hypothetical protein CARUB_v10009048mg [Capsella rubella]
 gb|EOA40322.1| hypothetical protein CARUB_v10009048mg [Capsella rubella]
Length=469

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 99/134 (74%), Gaps = 5/134 (4%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y     F+I+QAKS+ L  +  EFV GKP+++L W G +  L
Sbjct  61   ITRFQQYLRINTAHPNPNYTAPVSFLINQAKSIGLTAKTFEFVSGKPVLLLTWLGSNPNL  120

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQ--IDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            P+IL NSH D  P+E  KW HPPF A   ID   G IYARG+QD KC+G+QYLEAIR+LK
Sbjct  121  PSILFNSHLDSVPAESDKWIHPPFSAHRTID---GRIYARGAQDDKCIGVQYLEAIRNLK  177

Query  637  ASGFQPIRTVYLSF  678
            +SGF P+RTV++S+
Sbjct  178  SSGFVPLRTVHISY  191



>ref|XP_010500161.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=444

 Score =   166 bits (421),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y     F+I+QA+S+ L ++  EFV GKP+++L W G +  L
Sbjct  35   ITRFQQYLRINTAHPNPNYTAPVSFLINQAQSIGLTSKTFEFVSGKPVLLLTWLGSNPNL  94

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G+IYARG+QD KC+G+QYLEAIR+LK+ 
Sbjct  95   PSILFNSHLDSVPAESEKWIHPPFSAH-RTTDGHIYARGAQDDKCIGVQYLEAIRNLKSR  153

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  154  GFSPLRTVHISY  165



>gb|KFK35784.1| hypothetical protein AALP_AA4G036200 [Arabis alpina]
Length=440

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YL+  T  PNP Y     F+I+Q+KSL+L ++ +EFV  KP++I+ W G +  L
Sbjct  30   ITRFQRYLQFKTTHPNPNYTAPITFLINQSKSLNLTSRTIEFVSNKPVLIITWIGSNPKL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH D  P+E  KW +PPF A  D   GNIYARG+QD KC+G+QYLEAIR LK+ 
Sbjct  90   PSILLNSHLDSVPAESEKWIYPPFSAHYDSNNGNIYARGAQDDKCIGVQYLEAIRYLKSK  149

Query  643  GFQPIRTVYLSF  678
            GF PIRTV++S+
Sbjct  150  GFVPIRTVHVSY  161



>gb|KFK42003.1| hypothetical protein AALP_AA2G199700 [Arabis alpina]
Length=438

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YLRI+TA PNP Y     F++ QA+SL L T+ +EFVKGKPL+IL W G +  L
Sbjct  30   ITRFQRYLRINTAHPNPNYTAPISFLVDQARSLGLTTRTIEFVKGKPLLILTWLGSNPKL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G IYARG+QD KC+G+QYLEAI++LK+ 
Sbjct  90   PSILFNSHLDSVPAEADKWLHPPFSAH-RTDDGRIYARGAQDDKCIGVQYLEAIKNLKSR  148

Query  643  GFQPIRTVYLSF  678
            GF P+R V++S+
Sbjct  149  GFSPLRNVHVSY  160



>ref|XP_004964909.1| PREDICTED: aminoacylase-1-like [Setaria italica]
Length=441

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 97/134 (72%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I+RFQ+YLRI TA P+P Y  AA F++  A SL L T  + F   K KPL++L W G D 
Sbjct  36   IARFQEYLRIRTAHPSPDYAGAAAFLLPYAASLGLHTTTLHFTPCKTKPLLLLTWPGTDP  95

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP  WSHPPF A  DPATG IYARG+QD KC+ +QYLEAIR L+
Sbjct  96   SLPSVLLNSHMDSVPAEPELWSHPPFAAHRDPATGRIYARGAQDDKCLPVQYLEAIRGLR  155

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RTV++S 
Sbjct  156  AAGFAPARTVHISL  169



>ref|XP_002893983.1| hypothetical protein ARALYDRAFT_473806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70242.1| hypothetical protein ARALYDRAFT_473806 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR +TA PNP Y     F++ QA+S+ L ++ +EFV GKP+++L W G +  L
Sbjct  31   ITRFQQYLRFNTAHPNPNYTAPISFLLDQARSIGLTSRTIEFVHGKPVLLLTWLGSNLNL  90

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF AQ     G+IYARG+QD KC+G+QYLEAIR+LK+ 
Sbjct  91   PSILFNSHLDSVPAESEKWIHPPFSAQ-RTVDGHIYARGAQDDKCIGVQYLEAIRNLKSR  149

Query  643  GFQPIRTVYLSF  678
            GF P+RT+++S+
Sbjct  150  GFVPLRTIHISY  161



>ref|XP_004292687.1| PREDICTED: aminoacylase-1 [Fragaria vesca subsp. vesca]
Length=435

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++RFQ YLRI TA PNP Y  A  F+ SQA+S+ L+T+ + +   KPL++L W G D TL
Sbjct  33   VTRFQTYLRIKTAHPNPDYASAVSFLKSQAESIGLKTRTLHYAPNKPLLLLTWPGSDPTL  92

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH D  P+EP KW+HPPF A   P  G I+ARG+QD KC+ +QYLEAIR+LK S
Sbjct  93   PSLLLNSHLDSVPAEPSKWAHPPFSAHRTP-DGLIFARGAQDDKCIAVQYLEAIRNLKGS  151

Query  643  GFQPIRTVYLSF  678
             F PIRTV++S+
Sbjct  152  NFNPIRTVHVSY  163



>ref|XP_004138118.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
 gb|KGN63599.1| hypothetical protein Csa_1G005600 [Cucumis sativus]
Length=451

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRI TA P+P Y  A  F+ SQA+ + L TQ++EFV GKPL+++ W G D +L
Sbjct  44   VSRFQRYLRIKTAHPDPDYASAVAFLRSQAQEIGLHTQILEFVTGKPLLLVTWYGLDPSL  103

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH D  P+EP KW HPPF A +  + G I+ARGSQD KC+ +QYLEAIR+L+  
Sbjct  104  PSILLNSHMDSVPAEPSKWVHPPFSA-VRTSDGKIFARGSQDDKCIAIQYLEAIRNLRNR  162

Query  643  GFQPIRTVYLSF  678
             F P+RT+++S+
Sbjct  163  DFVPVRTIHISY  174



>ref|XP_004166496.1| PREDICTED: aminoacylase-1-like [Cucumis sativus]
Length=451

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRFQ+YLRI TA P+P Y  A  F+ SQA+ + L TQ++EFV GKPL+++ W G D +L
Sbjct  44   VSRFQRYLRIKTAHPDPDYASAVAFLRSQAQEIGLHTQILEFVTGKPLLLVTWYGLDPSL  103

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH D  P+EP KW HPPF A +  + G I+ARGSQD KC+ +QYLEAIR+L+  
Sbjct  104  PSILLNSHMDSVPAEPSKWVHPPFSA-VRTSDGKIFARGSQDDKCIAIQYLEAIRNLRNR  162

Query  643  GFQPIRTVYLSF  678
             F P+RT+++S+
Sbjct  163  DFVPVRTIHISY  174



>ref|XP_010091376.1| hypothetical protein L484_020178 [Morus notabilis]
 gb|EXB44366.1| hypothetical protein L484_020178 [Morus notabilis]
Length=425

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 3/134 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV--KGKPLVILKWAGKDS  456
            I+RF+ YLRI+TA PNP Y  A  +++S+A  L L +Q++ F   K KPL++L W G D 
Sbjct  46   ITRFRNYLRINTAHPNPDYSSAVSYLLSEANLLGLHSQILHFTPSKSKPLLLLSWPGSDP  105

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP+ILLNSH D  P+EP KW+HPPF A   P  G I+ARG+QD KC+G+QYLEAIR+LK
Sbjct  106  SLPSILLNSHLDSVPAEPSKWAHPPFSAAKSP-DGRIFARGAQDDKCIGIQYLEAIRNLK  164

Query  637  ASGFQPIRTVYLSF  678
            +  F PIRTV+LS+
Sbjct  165  SKNFWPIRTVHLSY  178



>ref|XP_002965773.1| hypothetical protein SELMODRAFT_406809 [Selaginella moellendorffii]
 gb|EFJ33193.1| hypothetical protein SELMODRAFT_406809 [Selaginella moellendorffii]
Length=453

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            + RF++YL+I +  PNP Y    DF+++ A  L L ++V+EFV GKP+++  W G D +L
Sbjct  35   LDRFKRYLQIPSVHPNPDYSATTDFLLAIAGELGLASRVLEFVPGKPVLLFTWQGSDPSL  94

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH DV P+EP KWS PPF A  D + GN+ ARGSQDMKCVGLQYLEAIR LK +
Sbjct  95   PSLLLNSHVDVVPAEPSKWSSPPFAAAED-SRGNVLARGSQDMKCVGLQYLEAIRRLKRA  153

Query  643  GFQPIRTVYLSF  678
            GF+P R+V++SF
Sbjct  154  GFKPPRSVHVSF  165



>ref|XP_002984445.1| hypothetical protein SELMODRAFT_120255 [Selaginella moellendorffii]
 gb|EFJ14495.1| hypothetical protein SELMODRAFT_120255 [Selaginella moellendorffii]
Length=448

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            + RF++YL+I +  PNP Y    DF+++ A  L L ++V+EFV GKP+++  W G D +L
Sbjct  35   LDRFKRYLQIPSVHPNPDYSATTDFLLAIAGELGLASRVLEFVPGKPVLLFTWQGSDPSL  94

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH DV P+EP KWS PPF A  D + GN+ ARGSQDMKCVGLQYLEAIR LK +
Sbjct  95   PSLLLNSHVDVVPAEPSKWSSPPFAAAED-SRGNVLARGSQDMKCVGLQYLEAIRRLKRA  153

Query  643  GFQPIRTVYLSF  678
            GF+P R+V++SF
Sbjct  154  GFKPPRSVHVSF  165



>gb|KDO80708.1| hypothetical protein CISIN_1g013641mg [Citrus sinensis]
Length=439

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RF+QYLR +TA PNP Y     F+ISQA+S+ L+ + +EFV  KP+++L W G D +L
Sbjct  32   ITRFKQYLRFNTAHPNPNYTAPVSFLISQAQSIGLQFKTLEFVPNKPILLLTWPGSDPSL  91

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSL-KA  639
            P+IL NSH D  P+EP KWSHPPF A   P TG I+ARGSQD KC+ +QY+EAIR+L   
Sbjct  92   PSILFNSHLDSVPAEPDKWSHPPFSAFHSPETGQIFARGSQDDKCIAIQYIEAIRNLILV  151

Query  640  SGFQPIRTVYLSF  678
              F+PIRTV+ S+
Sbjct  152  KNFKPIRTVHASY  164



>ref|XP_010461453.1| PREDICTED: aminoacylase-1-like [Camelina sativa]
Length=438

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y     F++ QA+S+ L ++  EFV GKP+++L W G +  L
Sbjct  30   ITRFQQYLRINTAHPNPNYTAPVSFLLDQAQSIGLTSKTFEFVSGKPVLLLTWLGTNPHL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G+IYARG+QD KC+G+QYLEAIR+LK+ 
Sbjct  90   PSILFNSHLDSVPAESDKWIHPPFSAH-RTTDGHIYARGAQDDKCIGVQYLEAIRNLKSR  148

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  149  GFSPLRTVHISY  160



>ref|XP_002891296.1| hypothetical protein ARALYDRAFT_473822 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67555.1| hypothetical protein ARALYDRAFT_473822 [Arabidopsis lyrata subsp. 
lyrata]
Length=439

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR +TA PNP Y     F+I+QA+S+ L  + +EFV GKP+++L W G +  L
Sbjct  31   ITRFQQYLRFNTAHPNPNYTAPVSFLINQAQSIGLTAKTIEFVSGKPILLLTWLGSNPNL  90

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G+IYARG+QD KC+G+QYLE+IR+LK+ 
Sbjct  91   PSILFNSHLDSVPAESEKWIHPPFSAH-KTNDGHIYARGAQDDKCIGVQYLESIRNLKSR  149

Query  643  GFQPIRTVYLSF  678
            GF P+RT+++S+
Sbjct  150  GFVPLRTIHISY  161



>dbj|BAE99837.1| aminoacylase like protein [Arabidopsis thaliana]
Length=424

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 101/134 (75%), Gaps = 5/134 (4%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR +TA PNP Y     F+I+QA+S+ L T+ +EF+ GKP++++ W G +  L
Sbjct  16   ITRFQQYLRFNTAHPNPNYTAPISFLINQAQSIGLTTKTIEFISGKPILLITWLGSNPNL  75

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQ--IDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            P+IL NSH D  P+E  KW++PPF A   ID   G+IYARG+QD KC+G+QYLE+IR+LK
Sbjct  76   PSILFNSHLDSVPAESEKWTYPPFSAHKTID---GHIYARGAQDDKCIGVQYLESIRNLK  132

Query  637  ASGFQPIRTVYLSF  678
            + GF P+RT+++S+
Sbjct  133  SRGFSPLRTIHISY  146



>ref|XP_006472753.1| PREDICTED: aminoacylase-1-like [Citrus sinensis]
Length=475

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RF+QYLR +TA PNP Y     F+ISQA+S+ L+ + +EFV  KP+++L W G D +L
Sbjct  68   ITRFKQYLRFNTAHPNPNYTAPVSFLISQAQSIGLQFKTLEFVPNKPILLLTWPGSDPSL  127

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSL-KA  639
            P+IL NSH D  P+EP KWSHPPF A   P TG I+ARGSQD KC+ +QY+EAIR+L   
Sbjct  128  PSILFNSHLDSVPAEPDKWSHPPFSAFHSPETGQIFARGSQDDKCIAIQYIEAIRNLILV  187

Query  640  SGFQPIRTVYLSF  678
              F+PIRTV+ S+
Sbjct  188  KNFKPIRTVHASY  200



>ref|NP_175103.2| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AAF78265.1|AC020576_9 Contains similarity to aminoacylase from Sus scrofa domestica 
gi|S27010 and contains a peptidase M20 PF|01546 domain. ESTs 
gb|H76043, gb|AA394953, gb|AI995115, gb|AA651481 come from 
this gene [Arabidopsis thaliana]
 gb|ABG48486.1| At1g44820 [Arabidopsis thaliana]
 gb|AEE32055.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=438

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 101/134 (75%), Gaps = 5/134 (4%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR +TA PNP Y     F+I+QA+S+ L T+ +EF+ GKP++++ W G +  L
Sbjct  30   ITRFQQYLRFNTAHPNPNYTAPISFLINQAQSIGLTTKTIEFISGKPILLITWLGSNPNL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQ--IDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            P+IL NSH D  P+E  KW++PPF A   ID   G+IYARG+QD KC+G+QYLE+IR+LK
Sbjct  90   PSILFNSHLDSVPAESEKWTYPPFSAHKTID---GHIYARGAQDDKCIGVQYLESIRNLK  146

Query  637  ASGFQPIRTVYLSF  678
            + GF P+RT+++S+
Sbjct  147  SRGFSPLRTIHISY  160



>ref|XP_002285843.1| PREDICTED: aminoacylase-1 [Vitis vinifera]
 ref|XP_003634461.1| PREDICTED: aminoacylase-1 [Vitis vinifera]
 ref|XP_010664226.1| PREDICTED: aminoacylase-1 [Vitis vinifera]
Length=450

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ YLRI+T  PNP Y  A  F+ SQA  + L+T+ +EF + KPL++L W G D +L
Sbjct  45   ITRFQGYLRINTVHPNPDYASAVSFLKSQALYIGLQTKTLEFARSKPLLLLTWPGSDPSL  104

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH D  P EP KW HPPF A   P  G I+ARGSQD KC+ +QYLEAIR+L+A 
Sbjct  105  PSILLNSHLDSVPVEPSKWLHPPFSAYRSP-DGKIFARGSQDDKCIAMQYLEAIRNLRAQ  163

Query  643  GFQPIRTVYLSF  678
             FQP RT+++S+
Sbjct  164  NFQPTRTIHISY  175



>ref|XP_010063988.1| PREDICTED: aminoacylase-1 isoform X2 [Eucalyptus grandis]
 gb|KCW71276.1| hypothetical protein EUGRSUZ_F04363 [Eucalyptus grandis]
Length=450

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y  A  F+  QA+++SL+T ++EFV  KP+++L W G D +L
Sbjct  41   IARFQQYLRINTAHPNPDYAGAVSFLKDQAQAISLQTCILEFVPKKPVLVLTWLGSDPSL  100

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++L NSH D  P+EP KW HPPF A  D + G I+ARG+QD KC+ +QY+EAIR+LK  
Sbjct  101  PSVLFNSHMDSVPAEPSKWIHPPFSAFKD-SNGKIFARGAQDDKCIAVQYIEAIRNLKEK  159

Query  643  GFQPIRTVYLSF  678
             F P+RT+++S+
Sbjct  160  NFVPLRTIHVSY  171



>ref|XP_010063989.1| PREDICTED: aminoacylase-1 isoform X3 [Eucalyptus grandis]
Length=434

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y  A  F+  QA+++SL+T ++EFV  KP+++L W G D +L
Sbjct  41   IARFQQYLRINTAHPNPDYAGAVSFLKDQAQAISLQTCILEFVPKKPVLVLTWLGSDPSL  100

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++L NSH D  P+EP KW HPPF A  D + G I+ARG+QD KC+ +QY+EAIR+LK  
Sbjct  101  PSVLFNSHMDSVPAEPSKWIHPPFSAFKD-SNGKIFARGAQDDKCIAVQYIEAIRNLKEK  159

Query  643  GFQPIRTVYLSF  678
             F P+RT+++S+
Sbjct  160  NFVPLRTIHVSY  171



>gb|ACN33832.1| unknown [Zea mays]
 gb|AFW76694.1| aminoacylase-1 [Zea mays]
Length=439

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I+RFQ+YLRI TA P+P Y  A+ F++  A SL L T  + F   K KPL++L W G D 
Sbjct  34   IARFQEYLRIRTAHPSPDYAGASAFLLHYAASLGLHTTTLHFTPCKTKPLLLLTWRGSDP  93

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP  W+HPPF A  DP TG IYARG+QD KC+ +QYLEAIR L+
Sbjct  94   SLPSVLLNSHMDSVPAEPEHWAHPPFAAHRDPTTGRIYARGAQDDKCLPVQYLEAIRGLQ  153

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RT+++S 
Sbjct  154  AAGFAPARTIHISL  167



>ref|XP_007019016.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
 gb|EOY16241.1| Peptidase M20/M25/M40 family protein isoform 2 [Theobroma cacao]
Length=326

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RF++YL+ +TA PNP Y +   F++SQA S+ L++Q +E    KP+++L W G + +L
Sbjct  21   IARFRRYLQFNTAHPNPNYADPISFLVSQANSIGLQSQTLELTPSKPVLLLTWPGSNPSL  80

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++L NSH D  P+EP KWSHPPF A + P  G IYARG+QD KC+ +QYLEAIR+LKA 
Sbjct  81   HSVLFNSHLDSVPAEPSKWSHPPFAATLTP-DGKIYARGAQDDKCIAMQYLEAIRNLKAR  139

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  140  GFIPLRTVHISY  151



>ref|NP_001150325.1| aminoacylase-1 precursor [Zea mays]
 gb|ACG38652.1| aminoacylase-1 [Zea mays]
Length=439

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I+RFQ+YLRI TA P+P Y  A+ F++  A SL L T  + F   K KPL++L W G D 
Sbjct  34   IARFQEYLRIRTAHPSPDYAGASAFLLHYAASLGLHTTTLHFTPCKTKPLLLLTWRGSDP  93

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP  W+HPPF A  DP TG IYARG+QD KC+ +QYLEAIR L+
Sbjct  94   SLPSVLLNSHMDSVPAEPEHWAHPPFAAHRDPTTGRIYARGAQDDKCLPVQYLEAIRGLQ  153

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RT+++S 
Sbjct  154  AAGFAPARTIHISL  167



>ref|XP_007141069.1| hypothetical protein PHAVU_008G164800g, partial [Phaseolus vulgaris]
 gb|ESW13063.1| hypothetical protein PHAVU_008G164800g, partial [Phaseolus vulgaris]
Length=341

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YLRI+TA P P Y  A  F+ +QA SL L +  +EF  GKPL++L W G + +L
Sbjct  45   ITRFQRYLRINTAHPTPDYYSAVSFLKAQAHSLGLTSNTIEFTPGKPLLLLTWPGSNPSL  104

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH D  P+EP KW HPPF A    + GN++ARG+QD KC+ +QYLEAIR+LKA 
Sbjct  105  PSLLLNSHLDSVPAEPAKWLHPPFSAH-RTSDGNVFARGAQDDKCIAIQYLEAIRNLKAH  163

Query  643  GFQPIRTVYLSF  678
             F P+R+V++S 
Sbjct  164  AFSPLRSVHISL  175



>ref|XP_007222264.1| hypothetical protein PRUPE_ppa005883mg [Prunus persica]
 gb|EMJ23463.1| hypothetical protein PRUPE_ppa005883mg [Prunus persica]
Length=439

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 98/134 (73%), Gaps = 3/134 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV--KGKPLVILKWAGKDS  456
            ISRFQ YLRI+TA PNP Y     F+ + A++L+L+ Q + F   K KPL++L W G   
Sbjct  32   ISRFQNYLRINTAHPNPNYTAPVSFLTAIAQTLNLQIQTLHFTPSKSKPLLLLTWPGSRP  91

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EPHKW+HPPF A    A G I+ARG+QD KC+ +QYLEAIR+LK
Sbjct  92   SLPSLLLNSHLDSVPAEPHKWAHPPFSAH-RTADGRIFARGAQDDKCIAIQYLEAIRNLK  150

Query  637  ASGFQPIRTVYLSF  678
            A+ F PIRTV+LSF
Sbjct  151  AADFVPIRTVHLSF  164



>ref|XP_006393703.1| hypothetical protein EUTSA_v10011489mg [Eutrema salsugineum]
 gb|ESQ30989.1| hypothetical protein EUTSA_v10011489mg [Eutrema salsugineum]
Length=438

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR  TA PNP Y     F++ QA+S+ L T+  EFV GKP++++ W G +  L
Sbjct  30   ITRFQQYLRFKTAHPNPNYAAPVRFLVDQARSIGLSTRTFEFVSGKPVLLVTWLGSNPKL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G+IYARG+QD KC+G+QYLE+IR+LK+ 
Sbjct  90   PSILFNSHLDSVPAEAEKWIHPPFSAH-RTVDGHIYARGAQDDKCIGVQYLESIRNLKSR  148

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  149  GFSPLRTVHISY  160



>ref|XP_010063986.1| PREDICTED: aminoacylase-1 isoform X1 [Eucalyptus grandis]
 ref|XP_010063987.1| PREDICTED: aminoacylase-1 isoform X1 [Eucalyptus grandis]
Length=457

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLRI+TA PNP Y  A  F+  QA+++SL+T ++EFV  KP+++L W G D +L
Sbjct  41   IARFQQYLRINTAHPNPDYAGAVSFLKDQAQAISLQTCILEFVPKKPVLVLTWLGSDPSL  100

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++L NSH D  P+EP KW HPPF A  D + G I+ARG+QD KC+ +QY+EAIR+LK  
Sbjct  101  PSVLFNSHMDSVPAEPSKWIHPPFSAFKD-SNGKIFARGAQDDKCIAVQYIEAIRNLKEK  159

Query  643  GFQPIRTVYLSF  678
             F P+RT+++S+
Sbjct  160  NFVPLRTIHVSY  171



>ref|XP_002300996.2| aminoacylase family protein [Populus trichocarpa]
 gb|EEE80269.2| aminoacylase family protein [Populus trichocarpa]
Length=444

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+R+QQYLR +TA PNP Y     F+ S A+SL L+TQ +EF+  KP +++ W G + +L
Sbjct  38   ITRYQQYLRFNTAHPNPNYTAPVSFLTSLAQSLGLKTQTLEFISNKPTLLITWQGSNPSL  97

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++L NSH D  P+EP KW+HPPF A + P  G I+ARG+QD KC+ +QYLEAIR+LKA 
Sbjct  98   PSLLFNSHLDSVPAEPSKWTHPPFSATLTPE-GKIFARGAQDDKCIAIQYLEAIRNLKAR  156

Query  643  GFQPIRTVYLSF  678
             F P RT+++SF
Sbjct  157  NFVPTRTLHISF  168



>ref|XP_002436680.1| hypothetical protein SORBIDRAFT_10g006970 [Sorghum bicolor]
 gb|EER88047.1| hypothetical protein SORBIDRAFT_10g006970 [Sorghum bicolor]
Length=439

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 96/134 (72%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I+RFQ YLRI TA P+P Y  AA F++  A SL L+T  + F   K KPL++L W G D 
Sbjct  34   IARFQDYLRIRTAHPSPDYAGAAAFLLPYAASLGLDTTTLHFTPCKTKPLLLLTWRGSDP  93

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP  W+HPPF A  D ATG +YARG+QD KC+ +QYLEAIR L+
Sbjct  94   SLPSVLLNSHIDSVPAEPEHWAHPPFAAHRDAATGRVYARGAQDDKCLPVQYLEAIRGLQ  153

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RTV++S 
Sbjct  154  AAGFAPARTVHISL  167



>ref|XP_007019015.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
 gb|EOY16240.1| Peptidase M20/M25/M40 family protein isoform 1 [Theobroma cacao]
Length=426

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RF++YL+ +TA PNP Y +   F++SQA S+ L++Q +E    KP+++L W G + +L
Sbjct  21   IARFRRYLQFNTAHPNPNYADPISFLVSQANSIGLQSQTLELTPSKPVLLLTWPGSNPSL  80

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++L NSH D  P+EP KWSHPPF A + P  G IYARG+QD KC+ +QYLEAIR+LKA 
Sbjct  81   HSVLFNSHLDSVPAEPSKWSHPPFAATLTP-DGKIYARGAQDDKCIAMQYLEAIRNLKAR  139

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  140  GFIPLRTVHISY  151



>ref|XP_008777203.1| PREDICTED: aminoacylase-1-like [Phoenix dactylifera]
Length=440

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I RFQ+YLRI TA P+P Y  AA F+ S+A+S+ L+T  +EF +GKPL++L W G D +L
Sbjct  35   IQRFQKYLRIRTAHPDPDYASAAAFLSSEAQSIGLQTLTLEFARGKPLLLLSWPGSDPSL  94

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH D  P+EP KW HPPF A  D A G I+ RG+QD KC+ +QYLEA+R+L+A+
Sbjct  95   PSILLNSHIDSVPAEPAKWLHPPFAAARD-AAGRIFGRGAQDDKCLAVQYLEALRNLRAT  153

Query  643  GFQPIRTVYLSF  678
             F P R++++S 
Sbjct  154  SFVPRRSIHVSL  165



>dbj|BAK07394.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=439

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 93/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I RFQ YLRI TA P P Y  AA F++  A SL L T  + F   K KPL++L W G D 
Sbjct  34   IRRFQDYLRICTAHPAPDYAGAAAFLLPYAASLGLRTATLHFSPCKSKPLLLLTWPGTDP  93

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP+ILLNSH D  P+EP  W HPP+ A  DPATG +YARG+QD KC+ +QYLEAIR L+
Sbjct  94   SLPSILLNSHLDSVPAEPEHWIHPPYAAHRDPATGRVYARGAQDDKCLPVQYLEAIRGLQ  153

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RTV++S 
Sbjct  154  AAGFAPARTVHVSL  167



>ref|XP_009123186.1| PREDICTED: aminoacylase-1-like [Brassica rapa]
 emb|CDY14997.1| BnaA10g08590D [Brassica napus]
Length=437

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR  TA PNP Y     F++ QA+S+ L T+ +E+V GKP++++ W G +  L
Sbjct  29   ITRFQQYLRFKTAHPNPNYTAPISFLVDQAQSIGLTTRTIEYVSGKPVLLVTWLGSNPKL  88

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G IYARG+QD KC+G+QYLE+IR+LK+ 
Sbjct  89   PSILFNSHLDSVPAEADKWIHPPFSAH-RTVDGLIYARGAQDDKCIGVQYLESIRNLKSR  147

Query  643  GFQPIRTVYLSF  678
            GF P+RTV++S+
Sbjct  148  GFSPLRTVHISY  159



>ref|XP_006307525.1| hypothetical protein CARUB_v10009148mg [Capsella rubella]
 gb|EOA40423.1| hypothetical protein CARUB_v10009148mg [Capsella rubella]
Length=442

 Score =   158 bits (399),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 5/134 (4%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YLRI+TA PNP Y     F++ QA+ + L ++ +EFV GKP+++L W G +  L
Sbjct  34   ITRFQKYLRINTAHPNPNYTAPISFLLDQARLIGLTSRTIEFVPGKPILLLTWLGSNLNL  93

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQ--IDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            P+IL NSH D  P+E  KW HPPF A   ID   G IYARG+QD KC+G+QYLEAI++LK
Sbjct  94   PSILFNSHLDYVPAESEKWIHPPFSAHRTID---GLIYARGAQDDKCIGVQYLEAIKNLK  150

Query  637  ASGFQPIRTVYLSF  678
            + GF P+RT+++S+
Sbjct  151  SRGFSPLRTIHISY  164



>ref|NP_175082.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
 gb|AAG50548.1|AC074228_3 aminoacylase, putative [Arabidopsis thaliana]
 gb|AAK43484.1|AC084807_9 hypothetical protein [Arabidopsis thaliana]
 gb|AEE32028.1| peptidase M20/M25/M40 family protein [Arabidopsis thaliana]
Length=435

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 5/134 (4%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYLR +TA PNP Y     F++ QA+S+ L ++ +EFV GKP+++L W G +  L
Sbjct  32   ITRFQQYLRFNTAHPNPNYTAPISFLLDQARSIGLTSRTIEFVPGKPVLLLTWLGSNLNL  91

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQ--IDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
             +IL NSH D  P+E  KW HPPF A   ID   G+IYARG+QD KC+G+QYLEAIR+LK
Sbjct  92   SSILFNSHLDSVPAESEKWIHPPFSAHRTID---GHIYARGAQDDKCIGVQYLEAIRNLK  148

Query  637  ASGFQPIRTVYLSF  678
            +  F P+RT+++S+
Sbjct  149  SRSFSPLRTIHISY  162



>ref|XP_003543794.1| PREDICTED: aminoacylase-1-like [Glycine max]
Length=446

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+ FQ+YLRI+TA P P Y  A  F+ +QA+SL L+TQ +EFV+GKP+++L W G + +L
Sbjct  41   ITHFQRYLRINTAHPTPDYTSAVSFLKAQAQSLGLKTQTLEFVQGKPVLLLTWPGSNPSL  100

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH D  P+EP KW H PF A    A+G I+ARG+QD KC+ +QYLEAIR+LK+ 
Sbjct  101  PSLLLNSHLDSVPAEPEKWLHNPFSAH-RTASGAIFARGAQDDKCIAIQYLEAIRNLKSQ  159

Query  643  GFQPIRTVYLSF  678
             F P RT+++S 
Sbjct  160  SFTPHRTIHISL  171



>ref|XP_010272799.1| PREDICTED: aminoacylase-1 [Nelumbo nucifera]
Length=451

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YLRI TA PNP Y  A  F  S+  S+ L+T  +EF  GKPL+++ W G D +L
Sbjct  38   ITRFQRYLRIKTAHPNPDYASAVSFFTSEVHSIGLKTLTLEFSPGKPLLLVTWPGSDPSL  97

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH D  P+EP KW HPPF A    + G IYARGSQD KC+ +QYLEAIR+L+  
Sbjct  98   PSILLNSHLDSVPAEPSKWLHPPFSA-TRTSDGKIYARGSQDDKCIAIQYLEAIRNLRMK  156

Query  643  -GFQPIRTVYLSF  678
              FQP+RTV++S+
Sbjct  157  RKFQPLRTVHISY  169



>ref|XP_010544624.1| PREDICTED: aminoacylase-1 [Tarenaya hassleriana]
Length=438

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQ+YLR  TA PNP Y     F++ QA+S+ L  + +EFV GKP+++L W G D  L
Sbjct  30   ITRFQRYLRFKTAHPNPNYTAPVSFLVDQAQSIGLTARTIEFVPGKPVLLLTWLGSDPKL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+E  KW HPPF A      G I+ARG+QD KC+ +QYLEAIR+LK+ 
Sbjct  90   PSILFNSHLDSVPAEGEKWIHPPFSAH-RTDDGRIFARGAQDDKCIAVQYLEAIRNLKSK  148

Query  643  GFQPIRTVYLSF  678
            G+ P+RTV++S+
Sbjct  149  GYSPVRTVHISY  160



>gb|ESA17742.1| hypothetical protein GLOINDRAFT_334950 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX61858.1| Cps1p [Rhizophagus irregularis DAOM 197198w]
Length=404

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++RF++YLRI T QPNP Y     ++++QAK + L +QV E+VKGKP+++L W G+D  L
Sbjct  9    VTRFREYLRIKTVQPNPDYESCKKWLLNQAKDIGLTSQVFEYVKGKPIILLTWTGRDPEL  68

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSHTDV P    KWS  PF+A      G+I ARG+QDMKCVG  YLEAIR LK  
Sbjct  69   PAILLNSHTDVVPVFEDKWSCDPFEA-YKRENGDIIARGAQDMKCVGTSYLEAIRCLKDQ  127

Query  643  GFQPIRTVYLSF  678
              QP RT++LS+
Sbjct  128  DKQPCRTIHLSY  139



>gb|KJB16266.1| hypothetical protein B456_002G221000 [Gossypium raimondii]
 gb|KJB16267.1| hypothetical protein B456_002G221000 [Gossypium raimondii]
Length=430

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RF +YL+ +TA PNP Y +   F+ISQA ++ L  + +EF   KPL++L W G +  L
Sbjct  25   IARFLRYLQFNTAHPNPSYADPISFLISQANAIGLHARTLEFTPSKPLLLLTWPGSNPFL  84

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++L NSH D  P+EP KW +PPF A + P  G IYARG+QD KC+ +QYLEAIR+LKA+
Sbjct  85   PSVLFNSHLDSVPAEPSKWIYPPFSATLAP-DGKIYARGAQDDKCIAMQYLEAIRNLKAN  143

Query  643  GFQPIRTVYLSF  678
            GF P RTV++S+
Sbjct  144  GFTPSRTVHISY  155



>gb|AFK34969.1| unknown [Medicago truncatula]
Length=449

 Score =   155 bits (392),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I T  P P Y +++ F+IS +KSLSLE+Q +E V GKP++ILKWAG    
Sbjct  35   IISRFQQYLQIKTNHPTPNYTQSSQFLISLSKSLSLESQTIELVPGKPIIILKWAGTSPE  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+L SHTDV P+E  KW H PF A +D   G IYARGSQDMKCV +QYLEA+R LK+
Sbjct  95   LPSIMLYSHTDVVPAEHDKWVHHPFKAHVD-DEGRIYARGSQDMKCVSMQYLEAVRILKS  153

Query  640  SGFQPIRTVYLSF  678
              FQP RTVYL F
Sbjct  154  WDFQPKRTVYLVF  166



>ref|XP_002020143.1| GL13664 [Drosophila persimilis]
 gb|EDW38955.1| GL13664 [Drosophila persimilis]
Length=401

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLRI T QP+  Y    +F+  QA SL+L   VV   +  KP+VI+KW G    
Sbjct  12   IKIFREYLRIPTVQPDVDYTACVEFLKRQASSLNLPVDVVYPALPSKPVVIIKWEGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A ID A G IYARG+QDMKCVG QYL AIRSLKA
Sbjct  72   LPSIILNSHTDVVPVFPDKWTHEPFSADID-AEGRIYARGTQDMKCVGTQYLGAIRSLKA  130

Query  640  SGFQPIRTVYLSF  678
            SGFQP RT+Y+SF
Sbjct  131  SGFQPKRTLYVSF  143



>gb|AES60010.2| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=449

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I T  P P Y +++ F+IS +KSLSLE+Q +E V GKP++ILKWAG    
Sbjct  35   IISRFQQYLQIKTNHPTPNYTQSSQFLISLSKSLSLESQTIELVPGKPIIILKWAGTSPE  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+L SHTDV P+E  KW H PF A +D   G IYARGSQDMKCV +QYLEA+R LK+
Sbjct  95   LPSIMLYSHTDVVPAEHDKWVHHPFKAHVD-DEGRIYARGSQDMKCVSMQYLEAVRILKS  153

Query  640  SGFQPIRTVYLSF  678
              FQP RTVYL F
Sbjct  154  WDFQPKRTVYLVF  166



>ref|XP_001357831.2| GA19818 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26967.2| GA19818 [Drosophila pseudoobscura pseudoobscura]
Length=401

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLRI T QP+  Y    +F+  QA SL+L   VV   +  KP+VI+KW G    
Sbjct  12   IKIFREYLRIPTVQPDVDYTACVEFLKRQASSLNLPVDVVYPALPSKPVVIIKWEGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A ID A G IYARG+QDMKCVG QYL AIRSLKA
Sbjct  72   LPSIILNSHTDVVPVFPDKWTHEPFSADID-AEGRIYARGTQDMKCVGTQYLGAIRSLKA  130

Query  640  SGFQPIRTVYLSF  678
            SGFQP RT+Y+SF
Sbjct  131  SGFQPKRTLYVSF  143



>gb|KEH40951.1| N-acyl-L-amino-acid amidohydrolase [Medicago truncatula]
Length=452

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I T  P P Y +++ F+IS +KSLSLE+Q +E V GKP++ILKWAG    
Sbjct  35   IISRFQQYLQIKTNHPTPNYTQSSQFLISLSKSLSLESQTIELVPGKPIIILKWAGTSPE  94

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+L SHTDV P+E  KW H PF A +D   G IYARGSQDMKCV +QYLEA+R LK+
Sbjct  95   LPSIMLYSHTDVVPAEHDKWVHHPFKAHVD-DEGRIYARGSQDMKCVSMQYLEAVRILKS  153

Query  640  SGFQPIRTVYLSF  678
              FQP RTVYL F
Sbjct  154  WDFQPKRTVYLVF  166



>ref|XP_006386375.1| hypothetical protein POPTR_0002s08590g [Populus trichocarpa]
 gb|ERP64172.1| hypothetical protein POPTR_0002s08590g [Populus trichocarpa]
Length=442

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++RFQ+YLR +TA PNP Y     F+ S A SL L+TQ +EF+  KP +++ W G + +L
Sbjct  36   VARFQKYLRFNTAHPNPNYTAPVSFLTSLATSLGLKTQTLEFIPNKPTLLITWQGSNPSL  95

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++L NSH D  P+EP KW+HPPF A + P  G I+ARG+QD KC+ +QYLEAIR+LKA 
Sbjct  96   HSLLFNSHLDSVPAEPSKWTHPPFSATLTPE-GKIFARGAQDDKCIAIQYLEAIRNLKAR  154

Query  643  GFQPIRTVYLSF  678
             F P RT+++SF
Sbjct  155  NFVPTRTLHISF  166



>ref|XP_003589759.1| Aminoacylase-1 [Medicago truncatula]
Length=451

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            IISRFQQYL+I T  P P Y +++ F+IS +KSLSLE+Q +E V GKP++ILKWAG    
Sbjct  34   IISRFQQYLQIKTNHPTPNYTQSSQFLISLSKSLSLESQTIELVPGKPIIILKWAGTSPE  93

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+L SHTDV P+E  KW H PF A +D   G IYARGSQDMKCV +QYLEA+R LK+
Sbjct  94   LPSIMLYSHTDVVPAEHDKWVHHPFKAHVD-DEGRIYARGSQDMKCVSMQYLEAVRILKS  152

Query  640  SGFQPIRTVYLSF  678
              FQP RTVYL F
Sbjct  153  WDFQPKRTVYLVF  165



>ref|XP_003564110.1| PREDICTED: aminoacylase-1-like [Brachypodium distachyon]
Length=437

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 91/134 (68%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I RFQ YLRI TA P+P Y  A+ F +  A SL L    + F   K KPL++L W G D 
Sbjct  32   IRRFQDYLRICTAHPSPDYAGASAFFLPYAASLGLGATTLHFTPCKSKPLLLLTWPGTDP  91

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP+ILLNSH D  P+EP  W HPPF A  DPA G +YARG+QD KC+ +QYLEAIR L+
Sbjct  92   SLPSILLNSHIDSVPAEPEHWIHPPFAAHHDPANGRVYARGAQDDKCLPIQYLEAIRGLQ  151

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RTV++S 
Sbjct  152  AAGFAPPRTVHISL  165



>ref|XP_011405330.1| PREDICTED: aminoacylase-1A-like [Amphimedon queenslandica]
Length=414

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SRF++YLRI T QPNP Y  A  F+  QA  + L  Q ++    + +VI+ W G D+ L
Sbjct  23   VSRFREYLRIKTVQPNPDYAPAIKFLKGQAYEIGLSYQCIQVAPERNVVIMSWEGTDTAL  82

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+++LNSH DV P  P KWS  PF+A +    G+I ARG+QDMKCVG+QYLEAIR LKAS
Sbjct  83   PSLMLNSHMDVVPVFPEKWSCDPFEA-VKRENGDIMARGAQDMKCVGIQYLEAIRLLKAS  141

Query  643  GFQPIRTVYLSF  678
            GFQP+RT++L++
Sbjct  142  GFQPLRTIHLTY  153



>gb|ELT90864.1| hypothetical protein CAPTEDRAFT_184037 [Capitella teleta]
Length=401

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +1

Query  286  SRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTLP  465
            + F++YLR++T QPNP Y  AADF+   A  L L  QV E V GKP+ I+ W G D +LP
Sbjct  14   ANFREYLRVNTMQPNPDYAGAADFLTRMANELGLPYQVHECVPGKPIFIITWEGTDPSLP  73

Query  466  TILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASG  645
            ++LLNSH DV P  P  W + PF A+ D + G+IYARGSQDMKCVG+QY+EAIR +KASG
Sbjct  74   SLLLNSHIDVVPVFPEFWKYEPFSAEKD-SNGDIYARGSQDMKCVGIQYIEAIRRIKASG  132

Query  646  FQPIRTVYLSF  678
                RT+++SF
Sbjct  133  HSFPRTIHMSF  143



>ref|XP_008464599.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1-like [Cucumis 
melo]
Length=353

 Score =   152 bits (384),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQ+YLRI TA P+P Y  A  F+ SQA+ + L TQV+EF  GKPL+++ W G + +L
Sbjct  30   ISRFQRYLRIKTAHPDPDYATAVAFLRSQAQEIDLHTQVLEFGPGKPLLLVIWYGSNPSL  89

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH D  P+EP KW HPPF A +  + G I+ARGSQD K + +Q LEAIR+L+  
Sbjct  90   PSVLLNSHMDSVPAEPSKWLHPPFSA-VRTSDGKIFARGSQDDKSIAIQCLEAIRNLRNQ  148

Query  643  GFQPIRTVYLSF  678
             F P+RT+++S+
Sbjct  149  DFIPVRTIHISY  160



>ref|NP_001057113.1| Os06g0210200 [Oryza sativa Japonica Group]
 dbj|BAD35700.1| putative aminoacylase [Oryza sativa Japonica Group]
 dbj|BAF19027.1| Os06g0210200 [Oryza sativa Japonica Group]
Length=446

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I RFQ YLRI TA P+P Y  AA F++  A SL L    + F   K KPL++L W G D 
Sbjct  41   IGRFQDYLRIRTAHPSPDYAGAAAFLLPYAASLGLRAATLHFTPCKSKPLLLLTWPGTDP  100

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP +W HPPF A  D ATG +YARG+QD KC+ +QYLEAIR L+
Sbjct  101  SLPSLLLNSHLDSVPAEPEQWLHPPFAAHRDAATGRVYARGAQDDKCLPIQYLEAIRGLR  160

Query  637  ASGFQPIRTVYLSF  678
             +GF P RT+++S 
Sbjct  161  DAGFAPTRTLHISL  174



>ref|XP_009344110.1| PREDICTED: aminoacylase-1-like [Pyrus x bretschneideri]
Length=441

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 95/134 (71%), Gaps = 3/134 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV--KGKPLVILKWAGKDS  456
            + RFQ YLRI+TA PNP Y     F+ + A++L+L+ Q + F   K KPL++L W G   
Sbjct  29   VGRFQNYLRINTAHPNPNYAAPVAFLTAIAQTLNLQIQTLHFTPSKSKPLLLLTWPGSHP  88

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP KW+HPPF A   P  G I+ARG+QD KC+ +QYLEAIR+LK
Sbjct  89   SLPSLLLNSHLDSVPAEPDKWTHPPFSAHRTP-EGLIFARGAQDDKCIAIQYLEAIRNLK  147

Query  637  ASGFQPIRTVYLSF  678
            A+ F PIRTV++S 
Sbjct  148  AANFTPIRTVHVSL  161



>ref|XP_010943121.1| PREDICTED: aminoacylase-1 [Elaeis guineensis]
 ref|XP_010943122.1| PREDICTED: aminoacylase-1 [Elaeis guineensis]
Length=439

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I RFQ+YL+I TA PNP Y  A  F+ S+A+S+ L+T  +EF +GK L++L W G D +L
Sbjct  34   IQRFQKYLQIRTAHPNPDYASAVAFLSSEAQSIGLQTLTLEFARGKSLLLLSWPGSDPSL  93

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             +ILLNSH D  P+EP KW HPPF A  D A G I+ARG+QD KC+ +QYLEA+R+LKA+
Sbjct  94   SSILLNSHIDSVPAEPSKWLHPPFAAVRD-AAGRIFARGAQDDKCLAVQYLEALRNLKAA  152

Query  643  GFQPIRTVYLSF  678
             F P R++++S 
Sbjct  153  SFVPRRSIHVSL  164



>emb|CDY65424.1| BnaC06g40730D [Brassica napus]
Length=438

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+RFQQYL   TA PNP Y     F++ QA+S+ L T+ +E+V GKP++++ W G D  L
Sbjct  29   ITRFQQYLGFKTAHPNPNYTAPISFLVDQAQSIGLTTRTMEYVSGKPVLLVTWLGSDPKL  88

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA-  639
            P+ILLNSH D  P+E  KW HPPF A      G IYARG+QD KC+G+QYLE+IR+LK+ 
Sbjct  89   PSILLNSHLDSVPAEADKWIHPPFSAH-RTVDGLIYARGAQDDKCIGVQYLESIRNLKSR  147

Query  640  SGFQPIRTVYLSF  678
             GF P+RTV++S+
Sbjct  148  RGFSPLRTVHISY  160



>ref|XP_010694046.1| PREDICTED: aminoacylase-1-like [Beta vulgaris subsp. vulgaris]
Length=446

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            II+RFQ YLR  T+ PNP Y     F+ +QA+S+ L+ +++EF+ GKP++I+ W G    
Sbjct  38   IITRFQTYLRFKTSHPNPNYTAPVSFLTAQARSIGLQARILEFISGKPVLIITWPGSRPD  97

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+IL NSH D  P+EP KW HPPF A +  A G I+ RG+QD KC+G+QYLEAIR+L+ 
Sbjct  98   LPSILFNSHLDSVPAEPSKWVHPPFSA-VRAADGKIFGRGAQDDKCIGMQYLEAIRNLRE  156

Query  640  --SGFQPIRTVYLSF  678
                 QPIRTV+LS+
Sbjct  157  LRGVEQPIRTVHLSY  171



>gb|KDP32782.1| hypothetical protein JCGZ_12074 [Jatropha curcas]
Length=442

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRFQQYLR +TA PNP Y     F+ S A+S+ L+T  +EF   KP++++ W+G   +L
Sbjct  36   ISRFQQYLRFNTAHPNPNYTAPVSFLASLAQSIGLKTLTIEFTPNKPVLLVTWSGSSPSL  95

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+IL NSH D  P+EP KW HPPF A +  A G I+ARG+QD KC+ +QYLEA+ +LKA 
Sbjct  96   PSILFNSHLDSVPAEPTKWVHPPFSA-VRTADGKIFARGAQDDKCIAIQYLEAVGNLKAK  154

Query  643  GFQPIRTVYLSF  678
             F P RT+++S+
Sbjct  155  NFIPTRTIHISY  166



>ref|XP_001953964.1| GF16977 [Drosophila ananassae]
 gb|EDV42525.1| GF16977 [Drosophila ananassae]
Length=400

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I  F++YLRI T QPN  Y E  +F+  QA SL L   VV  V+ KP+VI+KW G +  L
Sbjct  12   IKIFREYLRIATVQPNVDYTECVEFLKRQAHSLDLPVDVVYPVEKKPVVIIKWVGSEPEL  71

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+I+LNSHTDV P  P KW+H PF A ID   G I+ARG+QDMK VG QYL AIR LKA+
Sbjct  72   PSIILNSHTDVVPVFPEKWTHEPFSADID-EEGRIFARGTQDMKSVGTQYLGAIRLLKAA  130

Query  643  GFQPIRTVYLSF  678
            GFQP RT+ ++F
Sbjct  131  GFQPKRTINVTF  142



>ref|XP_001994316.1| GH23814 [Drosophila grimshawi]
 gb|EDV95052.1| GH23814 [Drosophila grimshawi]
Length=400

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKG-KPLVILKWAGKDST  459
            I  F++YLRI +  PN  Y    DF+  QA SL L  +VV    G  P+V++KW GK   
Sbjct  12   IQIFREYLRIPSVHPNIDYTACVDFLKRQASSLDLPVEVVYPQNGLNPVVVMKWLGKQPG  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSH DV P  P KW+H PF A +D   G IYARGSQDMKCVG QYL AIR LKA
Sbjct  72   LPSILLNSHMDVVPVFPSKWTHKPFSADLD-NEGRIYARGSQDMKCVGTQYLGAIRFLKA  130

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYL+F
Sbjct  131  SGFQPKRTVYLTF  143



>emb|CBI37723.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 90/133 (68%), Gaps = 34/133 (26%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            I+SRFQ+YL+I+TAQPNP Y EAADFI+SQA+S+SL +Q +EF                 
Sbjct  26   IVSRFQRYLQINTAQPNPNYYEAADFIVSQAQSISLHSQTLEF-----------------  68

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
                             HKW+HPPFDA +D   G+IYARGSQDMKCVGLQYLEAIR LK+
Sbjct  69   ----------------HHKWTHPPFDAHVD-GNGDIYARGSQDMKCVGLQYLEAIRRLKS  111

Query  640  SGFQPIRTVYLSF  678
            SGFQP+RTVYLSF
Sbjct  112  SGFQPLRTVYLSF  124



>ref|XP_001999544.1| GI23017 [Drosophila mojavensis]
 gb|EDW15005.1| GI23017 [Drosophila mojavensis]
Length=401

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV-KGKPLVILKWAGKDST  459
            I+ F++YLRI T  PN  Y    +F+  QA SL L   VV  V +  P+V++KW GK   
Sbjct  12   INIFREYLRIPTVHPNVDYTACVEFLKRQAASLGLPVDVVYPVNEANPVVVMKWLGKQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A +D   G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFPDKWTHGPFSADLDDE-GRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYL++
Sbjct  131  SGFQPKRTVYLTY  143



>ref|XP_006845931.1| hypothetical protein AMTR_s00157p00064680 [Amborella trichopoda]
 gb|ERN07606.1| hypothetical protein AMTR_s00157p00064680 [Amborella trichopoda]
Length=493

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ISRF+ YL I+TA P P Y  AA F+ SQA SLSL T+ + F   KPL++  W G D +L
Sbjct  87   ISRFRHYLSINTAHPEPDYPSAASFLTSQALSLSLLTKTLYFAPNKPLLLFTWPGSDPSL  146

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++L NSH D  P+E  KW+HPPF A  D A GNIYARG+QD KCVG+QYLEA+R LKA 
Sbjct  147  PSVLFNSHIDSVPAEAEKWAHPPFSATRD-AHGNIYARGTQDDKCVGMQYLEAVRRLKAK  205

Query  643  GFQPIRTVYLSF  678
             + P RT+++SF
Sbjct  206  SYTPTRTIHISF  217



>ref|XP_008547538.1| PREDICTED: aminoacylase-1-like [Microplitis demolitor]
 ref|XP_008547539.1| PREDICTED: aminoacylase-1-like [Microplitis demolitor]
Length=401

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y +   F+ +QA+SL L  +V E  KGKP+V++ W G D + 
Sbjct  14   VENFREYLRIPSVQPNINYDDCVTFLRNQAQSLELPVKVYEHYKGKPIVVITWVGTDPSA  73

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH DV P    KW +PPF A++D   GNIYARGSQDMKCVG+QY+EA+R +K +
Sbjct  74   PSVLLNSHMDVVPVFADKWIYPPFSAEMD-DKGNIYARGSQDMKCVGIQYIEAVRRMKMN  132

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  133  GLRFKRTIHMSF  144



>ref|XP_001357832.1| GA19815 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26966.1| GA19815 [Drosophila pseudoobscura pseudoobscura]
Length=401

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA  LSL   VV  V  K P+VI+KW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACVEFLKRQAAGLSLPVDVVYPVNEKNPVVIMKWEGTQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A +D A G I+ARGSQDMKCVG QYL AIR+LKA
Sbjct  72   LPSIILNSHTDVVPVFPEKWTHEPFSADLD-AEGRIFARGSQDMKCVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG++P RT+YL++
Sbjct  131  SGYKPKRTIYLTY  143



>ref|XP_002054731.1| GJ24611 [Drosophila virilis]
 gb|EDW68251.1| GJ24611 [Drosophila virilis]
Length=401

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV-KGKPLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L   V+  V +  P+V++KW GK+  
Sbjct  12   IKIFREYLRIPTVHPNVDYTACVEFLKRQADSLGLPVDVLYPVNESNPVVVMKWLGKEPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D   G IYARGSQDMKCVG QYL AIR+LKA
Sbjct  72   LPSIILNSHTDVVPVFADKWTHGPFSADLDDE-GRIYARGSQDMKCVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SGFQP RTVYL++
Sbjct  131  SGFQPKRTVYLTY  143



>ref|XP_002020145.1| GL13662 [Drosophila persimilis]
 gb|EDW38957.1| GL13662 [Drosophila persimilis]
Length=401

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA  LSL   VV  V  K P+V++KW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACVEFLKRQAAGLSLPVDVVYPVNEKNPVVVMKWEGTQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A +D A G I+ARGSQDMKCVG QYL AIR+LKA
Sbjct  72   LPSIILNSHTDVVPVFPEKWTHEPFSADLD-AEGRIFARGSQDMKCVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG++P RT+YL++
Sbjct  131  SGYKPKRTIYLTY  143



>dbj|BAN21243.1| aminoacylase, putative [Riptortus pedestris]
Length=395

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPNP Y     F+  QA +L L  +V   +  KP+V++ W G D  L
Sbjct  7    VKNFREYLRIPSVQPNPNYEACLQFLKKQATTLGLPLKVCYPMPNKPVVVITWEGTDPKL  66

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P  P KW+H PF A+ D A GNIYARG+QDMKCVG+QY+EAIR LK  
Sbjct  67   PSILLNSHMDVVPVFPEKWTHDPFGAEKD-ANGNIYARGAQDMKCVGIQYIEAIRKLKED  125

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  126  GVRLKRTIHMSF  137



>ref|XP_011139461.1| PREDICTED: aminoacylase-1-like [Harpegnathos saltator]
 gb|EFN84447.1| Aminoacylase-1 [Harpegnathos saltator]
Length=402

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 92/132 (70%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y +   F+  QAKSL L  ++ +    +P+V+L WAG + T 
Sbjct  14   VDNFREYLRIPSVQPNINYDDCVSFLQKQAKSLDLPIKIYQVYPKRPIVVLTWAGTEPTK  73

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P     WS+PPFDA +D   GNIYARGSQDMKCVG+QYLEAIR LK +
Sbjct  74   PSILLNSHMDVVPVFEEYWSYPPFDAHMD-EKGNIYARGSQDMKCVGIQYLEAIRRLKLN  132

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  133  GQRLSRTIHISF  144



>ref|XP_002054733.1| GJ24614 [Drosophila virilis]
 gb|EDW68253.1| GJ24614 [Drosophila virilis]
Length=401

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV-KGKPLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L   V   V +  P+VI+KW GK   
Sbjct  12   IKIFREYLRIPTVHPNIDYTACVEFLKRQAASLDLPVDVEYPVNEANPVVIMKWLGKQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP I+LNSHTDV P  P KW+H PF A +D   G IYARGSQDMKCVG QYL AIR+LKA
Sbjct  72   LPGIILNSHTDVVPVFPEKWTHDPFTADLDDE-GRIYARGSQDMKCVGAQYLAAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            +G+QP RTVYL+F
Sbjct  131  TGYQPKRTVYLTF  143



>gb|EMT02607.1| Aminoacylase-1A [Aegilops tauschii]
Length=471

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 89/134 (66%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I RFQ YLRI TA P P Y  AA F++  A SL L T  + F   K KPL++L W G D 
Sbjct  33   IRRFQDYLRICTAHPAPDYAGAAAFLLPYAASLGLRTATLHFSPCKSKPLLLLTWPGTDP  92

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP+ILLNSH D  P+EP  W HPP+ A  DPATG +YARG Q  KC+ +QY + IR L+
Sbjct  93   SLPSILLNSHLDSVPAEPEHWIHPPYAAHRDPATGRVYARGGQGDKCLPVQYPKPIRGLQ  152

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RTV++S 
Sbjct  153  AAGFAPARTVHVSL  166



>ref|XP_002074011.1| GK14410 [Drosophila willistoni]
 gb|EDW84997.1| GK14410 [Drosophila willistoni]
Length=401

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L   VV  V  K P+VI+KW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACVEFLKRQAASLELPVDVVYPVNEKNPVVIMKWLGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A ID   G IYARGSQDMKCVG QYL AIR+LKA
Sbjct  72   LPSIILNSHTDVVPVFADKWTHDPFSADIDDE-GKIYARGSQDMKCVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL++
Sbjct  131  SGYQPKRTIYLTY  143



>gb|KFH63616.1| hypothetical protein MVEG_10310 [Mortierella verticillata NRRL 
6337]
Length=413

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++RF++YLRI T QPNP Y  +  F+I+QA  + +  +VVE VKGKP VI+ + G D +L
Sbjct  11   VTRFREYLRIKTMQPNPDYEGSTAFLINQANEIGMPYKVVECVKGKPTVIMTFEGSDPSL  70

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            PT+LLNSHTDV P  P  W+   F A  +   G IYARGSQDMKCVG+ YLE +R  +A 
Sbjct  71   PTLLLNSHTDVVPVFPEMWTQDAFAA--NKVNGFIYARGSQDMKCVGMSYLEVLRRYRAE  128

Query  643  GFQPIRTVYLSF  678
            G +P+RT++L++
Sbjct  129  GKKPLRTIHLTW  140



>ref|XP_001982187.1| GG11184 [Drosophila erecta]
 gb|EDV54057.1| GG11184 [Drosophila erecta]
Length=401

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L  +V+  V  + P+V+LKW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWLGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D A G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFEEKWTHGPFSADLD-AEGRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL+F
Sbjct  131  SGYQPQRTIYLTF  143



>ref|XP_001999543.1| GI23018 [Drosophila mojavensis]
 gb|EDW15004.1| GI23018 [Drosophila mojavensis]
Length=399

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 2/132 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I  F++YLRI +  PN  Y    +F+  QA SL L  +VV  V   P+V++KW GK S L
Sbjct  12   IQIFREYLRIPSVHPNVDYTACVEFLKRQAASLELPIEVVS-VGLNPVVVIKWLGKQSEL  70

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+I+LNSH DV P  P KW+H PF+A++D   G IYARG+QDMK V  QYL A+RSLKAS
Sbjct  71   PSIVLNSHMDVVPVFPDKWTHEPFNAEMDDE-GRIYARGAQDMKSVATQYLAAVRSLKAS  129

Query  643  GFQPIRTVYLSF  678
            G+QP RTVYL+F
Sbjct  130  GYQPKRTVYLTF  141



>ref|XP_392498.1| PREDICTED: aminoacylase-1-like [Apis mellifera]
Length=401

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y     F+  QAKSL L  ++      KP+V+L W G D ++
Sbjct  14   VENFREYLRIPSVQPNVNYDGCVAFLEKQAKSLDLPFKIYYVDPKKPIVVLTWIGIDPSI  73

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            PTILLNSH DV P    KW++PPFDA ID   GNIYARGSQDMKCVG+QYLEAIR +K +
Sbjct  74   PTILLNSHMDVVPVFEDKWTYPPFDAHID-EKGNIYARGSQDMKCVGIQYLEAIRRMKLT  132

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  133  GQRFKRTIHISF  144



>ref|XP_002104512.1| GD20996 [Drosophila simulans]
 gb|EDX14015.1| GD20996 [Drosophila simulans]
Length=401

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL+L  +V+  V  + P+V+LKW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACTEFLKRQAASLNLPVEVIYPVNEQNPVVVLKWQGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D A G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFEEKWTHGPFSADLD-AEGRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL++
Sbjct  131  SGYQPKRTIYLTY  143



>ref|XP_001994315.1| GH23872 [Drosophila grimshawi]
 gb|EDV95051.1| GH23872 [Drosophila grimshawi]
Length=401

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFV-KGKPLVILKWAGKDST  459
            I  F++YLRI T  PN  Y +   F+  QA SL L   V   V K  P+VI+KW GK   
Sbjct  12   IKIFREYLRIPTVHPNIDYTDCVAFLKRQAASLDLLVDVEYPVNKDNPVVIMKWLGKQPK  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP I+LNSHTDV P  P KWSH PF A +D   G IYARG+QDMKCVG QYL AIR+LKA
Sbjct  72   LPGIVLNSHTDVVPVFPEKWSHDPFSADMDDE-GRIYARGTQDMKCVGAQYLAAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
             G+QP RT+Y++F
Sbjct  131  KGYQPKRTIYVTF  143



>ref|XP_011297555.1| PREDICTED: aminoacylase-1-like [Fopius arisanus]
Length=401

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QP+  Y +   F+  QA SL L  +V E  K KP+V++ W GKD   
Sbjct  15   VENFREYLRIPSVQPDVNYDDCVAFLRRQAVSLGLPVRVYEPYKKKPIVVITWIGKDPAA  74

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW+HPPFDA +D   GNI+ARG+QDMKCVG+QYLEAIR LK +
Sbjct  75   PAILLNSHMDVVPVFADKWTHPPFDAHMD-DKGNIFARGAQDMKCVGIQYLEAIRRLKQN  133

Query  643  GFQPIRTVYLSF  678
            G    RT+++SF
Sbjct  134  GQTFKRTIHMSF  145



>ref|XP_001953966.1| GF16975 [Drosophila ananassae]
 gb|EDV42527.1| GF16975 [Drosophila ananassae]
Length=401

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 93/133 (70%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA+SL+L   V+  V  + P+V++KW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACTEFLKRQAESLALPVDVIYPVNQQNPVVVMKWLGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A +D + G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFPEKWTHGPFSADLD-SEGRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
             G+QP RTVYL++
Sbjct  131  QGYQPKRTVYLTY  143



>ref|XP_002032300.1| GM26483 [Drosophila sechellia]
 gb|EDW43286.1| GM26483 [Drosophila sechellia]
Length=401

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L  +V+  V  + P+V+LKW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D A G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFEEKWTHGPFSADLD-AEGRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL++
Sbjct  131  SGYQPKRTIYLTY  143



>ref|XP_002098383.1| GE10351 [Drosophila yakuba]
 gb|EDW98095.1| GE10351 [Drosophila yakuba]
Length=401

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L  +V+  V  + P+V+LKW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTACTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWLGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D A G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFEEKWTHGPFSADLD-AEGRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL++
Sbjct  131  SGYQPKRTIYLTY  143



>ref|XP_002074012.1| GK14412 [Drosophila willistoni]
 gb|EDW84998.1| GK14412 [Drosophila willistoni]
Length=400

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKG-KPLVILKWAGKDST  459
            I  F+QYLRI T  PN  Y    +F+  QA SL L  +V+  V    P+VI+KW G    
Sbjct  12   IEIFRQYLRIPTVPPNLDYTPCVEFLKRQAASLELPVEVIYPVNNTDPVVIMKWLGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P    KWSH PF+A +D   G IY RG+QDMKCVG QYL AIR+LKA
Sbjct  72   LPSILLNSHTDVVPVFRDKWSHDPFNADLD-EEGRIYGRGAQDMKCVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RTVYL++
Sbjct  131  SGYQPKRTVYLTY  143



>ref|XP_001994317.1| GH23739 [Drosophila grimshawi]
 gb|EDV95053.1| GH23739 [Drosophila grimshawi]
Length=401

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLR+ T  PN  Y    +F+  QA SL L   V+    +  P+V++KW GK   
Sbjct  12   IKIFREYLRMPTMHPNVDYTACVEFLKRQAASLELPVDVLYPANESNPVVVMKWLGKQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P  P KW+H PF A +D   G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFPDKWTHEPFSADMDDE-GRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SGFQP RT+YL++
Sbjct  131  SGFQPKRTIYLTY  143



>ref|NP_651120.1| CG6726, isoform A [Drosophila melanogaster]
 ref|NP_732822.1| CG6726, isoform B [Drosophila melanogaster]
 ref|NP_001287478.1| CG6726, isoform C [Drosophila melanogaster]
 gb|AAF56094.2| CG6726, isoform A [Drosophila melanogaster]
 gb|AAN13926.1| CG6726, isoform B [Drosophila melanogaster]
 gb|ACL86486.1| CG6726-PA, partial [synthetic construct]
 gb|ACL91139.1| CG6726-PA [synthetic construct]
 gb|AHN57477.1| CG6726, isoform C [Drosophila melanogaster]
Length=401

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L  +V+  V  + P+V+LKW G    
Sbjct  12   IKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D A G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  72   LPSIILNSHTDVVPVFEEKWTHGPFSADLD-AEGRIFARGSQDMKCVGTQYLGAVRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL++
Sbjct  131  SGYQPKRTIYLTY  143



>gb|AAM50281.2| RE13549p [Drosophila melanogaster]
Length=413

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            I  F++YLRI T  PN  Y    +F+  QA SL L  +V+  V  + P+V+LKW G    
Sbjct  24   IKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPE  83

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A +D A G I+ARGSQDMKCVG QYL A+R+LKA
Sbjct  84   LPSIILNSHTDVVPVFEEKWTHGPFSADLD-AEGRIFARGSQDMKCVGTQYLGAVRALKA  142

Query  640  SGFQPIRTVYLSF  678
            SG+QP RT+YL++
Sbjct  143  SGYQPKRTIYLTY  155



>ref|XP_001752334.1| predicted protein [Physcomitrella patens]
 gb|EDQ83067.1| predicted protein [Physcomitrella patens]
Length=434

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +SR + YLRIDT+ PNP YG   +F++SQA  L L+ Q +E VK KP+V++ WAG +++L
Sbjct  32   VSRLKAYLRIDTSHPNPNYGPVTEFLVSQATELGLQVQKLEIVKEKPIVLITWAGLNTSL  91

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++LLNSHTDV P+E  KW + P  A  +   GNIY RG+QDMK VG+QYLEAIR LK+S
Sbjct  92   TSLLLNSHTDVVPAEELKWKYDPLLA-FEDGKGNIYGRGAQDMKSVGVQYLEAIRVLKSS  150

Query  643  GFQPIRTVYLSF  678
            G+QP R+V+LS+
Sbjct  151  GYQPTRSVHLSY  162



>ref|XP_006655902.1| PREDICTED: aminoacylase-1-like [Oryza brachyantha]
Length=453

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 92/134 (69%), Gaps = 2/134 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEF--VKGKPLVILKWAGKDS  456
            I RFQ YLRI T  P+P Y  AA  ++  A SL L T  + F   K KPL++L W G D 
Sbjct  39   IGRFQDYLRIRTTHPSPDYAGAAALLLPYAASLGLRTATLHFTPCKSKPLLLLTWPGTDP  98

Query  457  TLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLK  636
            +LP++LLNSH D  P+EP  W HPPF A  DPATG +YARG+QD KC+ +QYLEAIR L+
Sbjct  99   SLPSVLLNSHLDSVPAEPEHWLHPPFAAHRDPATGRVYARGAQDDKCLPIQYLEAIRGLQ  158

Query  637  ASGFQPIRTVYLSF  678
            A+GF P RT+++S 
Sbjct  159  AAGFSPTRTLHISL  172



>ref|NP_651121.1| CG17110, isoform A [Drosophila melanogaster]
 ref|NP_001262858.1| CG17110, isoform B [Drosophila melanogaster]
 ref|NP_001287479.1| CG17110, isoform C [Drosophila melanogaster]
 gb|AAL90037.1| AT09807p [Drosophila melanogaster]
 gb|AAF56095.2| CG17110, isoform A [Drosophila melanogaster]
 gb|ACL87364.1| CG17110-PA, partial [synthetic construct]
 gb|AGB96238.1| CG17110, isoform B [Drosophila melanogaster]
 gb|AHN57478.1| CG17110, isoform C [Drosophila melanogaster]
Length=402

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 89/130 (68%), Gaps = 2/130 (2%)
 Frame = +1

Query  292  FQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDSTLPT  468
            FQ+YLRI +  P+  Y    +F+  QA  L+L   VV   V  KP+VI+KW GK   L +
Sbjct  17   FQEYLRIPSVHPDVDYTACVEFLKRQANKLNLRVDVVYPVVPSKPVVIMKWLGKHPELKS  76

Query  469  ILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKASGF  648
            I+LNSH DV P  P KW+H PF A ID A G IYARG+QDMK VG QY+ A+R+LKASG+
Sbjct  77   IILNSHMDVVPVFPEKWTHEPFGAHID-AQGRIYARGAQDMKSVGCQYMAAVRALKASGY  135

Query  649  QPIRTVYLSF  678
            QP RTVYL+F
Sbjct  136  QPKRTVYLTF  145



>ref|XP_006609856.1| PREDICTED: aminoacylase-1-like [Apis dorsata]
Length=401

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F +YLRI + QPN  Y +   F+  QAKSL L  ++      KP+V+L W G D + 
Sbjct  14   VENFCEYLRIPSVQPNVNYDDCVAFLEKQAKSLDLPIKIYYVDPKKPIVVLTWIGIDPSK  73

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW++PPFDA ID   GNIYARGSQDMKCVG+QYLEAIR +K +
Sbjct  74   PAILLNSHMDVVPVFEDKWTYPPFDAHID-EKGNIYARGSQDMKCVGIQYLEAIRRMKLT  132

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  133  GQRFKRTIHISF  144



>ref|XP_009406638.1| PREDICTED: aminoacylase-1-like [Musa acuminata subsp. malaccensis]
Length=438

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I RFQ+YLRI TA P+P Y  AA F++ +A+S+ L    +EFV GKPL+++ W G D +L
Sbjct  33   IERFQRYLRIRTAHPDPDYAAAAAFLLEEARSIGLHALAIEFVPGKPLLLISWPGSDPSL  92

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH D  P+EP +W HPPF A I  A G I+ARG+QD K + +QYLEA+R+LKA+
Sbjct  93   PSLLLNSHIDSVPAEPSRWIHPPF-AAIRDAGGRIFARGAQDDKSIAVQYLEALRNLKAA  151

Query  643  GFQPIRTVYLSF  678
            GF P R+V++S 
Sbjct  152  GFVPARSVHISL  163



>ref|XP_001982186.1| GG11185 [Drosophila erecta]
 gb|EDV54056.1| GG11185 [Drosophila erecta]
Length=402

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVK-GKPLVILKWAGKDST  459
            I  FQ+YLRI T  P+  Y    +F+  QA +L+L   VV  V   KP+VI+KW GK   
Sbjct  14   IQIFQEYLRIPTVHPDVDYTACVEFLKCQASNLNLPVDVVCPVAPSKPVVIMKWMGKHPE  73

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            L +I+LNSH DV P  P KW+H PF A ID A G I+ARG+QDMK VG QY+ A+R+LKA
Sbjct  74   LKSIILNSHMDVVPVFPEKWTHEPFGAHID-AQGRIFARGAQDMKSVGCQYMAAVRALKA  132

Query  640  SGFQPIRTVYLSF  678
            SG+QP RTVYL+F
Sbjct  133  SGYQPKRTVYLTF  145



>gb|EHJ78690.1| hypothetical protein KGM_00092 [Danaus plexippus]
Length=399

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I  F +YL+I + QPN  Y    +F+  Q+  + L  +V E V  KP+VIL W G D +L
Sbjct  11   IKNFVEYLQIPSVQPNVNYDGCVNFLKRQSTEIGLSFKVYELVPTKPIVILTWLGSDPSL  70

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P     W++PPF   ID   G I+ARGSQDMKCVG+QYLEAIR LK+S
Sbjct  71   PSILLNSHMDVVPVFEESWTYPPFSGHID-EHGKIFARGSQDMKCVGIQYLEAIRKLKSS  129

Query  643  GFQPIRTVYLSF  678
            G Q  RT+++SF
Sbjct  130  GIQLKRTLHVSF  141



>gb|KDR16327.1| Aminoacylase-1 [Zootermopsis nevadensis]
Length=408

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F++YLRI + QP+  Y +   F+  QA  L L  QV   V GKP+V+L W G +  L
Sbjct  15   VANFREYLRIPSVQPDVNYDDCVAFLKKQAVQLGLPLQVYSVVFGKPIVVLTWEGLEPGL  74

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSH DV P  P KW+H PF A  D   GNI+ARG+QDMKCVG+QYLEA+R LK+ 
Sbjct  75   PSVLLNSHMDVVPVFPEKWTHDPFSADKD-KNGNIFARGAQDMKCVGIQYLEAVRRLKSE  133

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  134  GVRLRRTIHISF  145



>ref|XP_002020144.1| GL13663 [Drosophila persimilis]
 gb|EDW38956.1| GL13663 [Drosophila persimilis]
Length=401

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVE-FVKGKPLVILKWAGKDST  459
            I  F++YLRI + QP+  Y    +F+  QA SL+L   VV   +  KP VI+KW GK   
Sbjct  12   IKIFREYLRIPSVQPDVDYSACVEFLKRQANSLNLPVDVVHPALPTKPAVIIKWLGKQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSH DV P  P KW+H PF A +D   G IYARGSQDMK VG QYL AIR+LKA
Sbjct  72   LPSIILNSHMDVVPVFPEKWTHDPFSALMD-NEGRIYARGSQDMKSVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RTVYL++
Sbjct  131  SGYQPKRTVYLTY  143



>gb|AEE63015.1| unknown [Dendroctonus ponderosae]
Length=338

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YL+I +  P+  Y     F+ +QAK L L  +V   V+GKP+V++ W+G +  L
Sbjct  17   VENFRKYLQIPSVHPHVDYEPCVQFLRAQAKGLDLPLKVYTVVEGKPIVVITWSGSEPAL  76

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P    KW+HPPF A  D A GNIYARG+QDMKCVG+QYLEAIR ++ +
Sbjct  77   PSILLNSHMDVVPVFADKWAHPPFSAHTD-AQGNIYARGAQDMKCVGIQYLEAIRRMRLA  135

Query  643  GFQPIRTVYLSF  678
            G    RTV+++F
Sbjct  136  GAMVRRTVHVAF  147



>ref|XP_003694085.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1-like [Apis florea]
Length=401

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y     F+  QAKSL L  ++      KP+V+L W G D + 
Sbjct  14   VENFREYLRIPSVQPNVNYDGCVAFLEKQAKSLDLPIKIYYVDPKKPIVVLTWIGTDPSK  73

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW++PPFDA ID   GNIYARGSQDMKCVG+QYLEAIR +K +
Sbjct  74   PAILLNSHMDVVPVFEDKWTYPPFDAHID-EKGNIYARGSQDMKCVGIQYLEAIRRMKLT  132

Query  643  GFQPIRTVYLSF  678
            G +  RT++ SF
Sbjct  133  GQRFKRTIHXSF  144



>ref|XP_002098387.1| GE10355 [Drosophila yakuba]
 gb|EDW98099.1| GE10355 [Drosophila yakuba]
Length=401

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLRI +  PN  Y    +FI  QA SL+L   VV   VK KP+VI+KW G    
Sbjct  12   IQIFREYLRIPSVHPNIDYTACVEFIRRQADSLNLPVDVVYPAVKSKPVVIIKWEGSQPK  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSH DV P  P KW+H PF A ID   G I+ARG+QDMK VG QYL AIR LKA
Sbjct  72   LPSIILNSHMDVVPVFPEKWTHEPFSADID-EEGRIFARGAQDMKSVGTQYLGAIRLLKA  130

Query  640  SGFQPIRTVYLSF  678
             GFQP RT+Y++F
Sbjct  131  DGFQPKRTLYVTF  143



>ref|XP_002137025.1| GA26984 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY67583.1| GA26984 [Drosophila pseudoobscura pseudoobscura]
Length=401

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 91/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVE-FVKGKPLVILKWAGKDST  459
            I  F++YLRI + QP+  Y    +F+  QA SL+L   VV   +  KP VI+KW GK   
Sbjct  12   IKIFREYLRIRSVQPDVDYSACVEFLRRQANSLNLPVYVVHPAIPTKPAVIIKWLGKQPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSH DV P  P +W+H PF A +D   G IYARGSQDMK VG QYL AIR+LKA
Sbjct  72   LPSIILNSHMDVVPVFPEEWTHDPFSAHMD-NEGRIYARGSQDMKSVGTQYLGAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG+QP RTVYL++
Sbjct  131  SGYQPKRTVYLTY  143



>ref|XP_011260966.1| PREDICTED: aminoacylase-1-like [Camponotus floridanus]
 gb|EFN65223.1| Aminoacylase-1 [Camponotus floridanus]
Length=401

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y E   F+  QA+SL L  +V      KP+V+L W G +   
Sbjct  13   VENFREYLRIPSVQPNINYDECVAFLKRQAQSLDLPVKVYHIHPDKPIVVLTWVGTEPAK  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW++PPF A +D   GNIYARGSQDMKCVG+QYLEAIR LK +
Sbjct  73   PAILLNSHMDVVPVFEDKWTYPPFSAHMD-EQGNIYARGSQDMKCVGIQYLEAIRRLKLN  131

Query  643  GFQPIRTVYLSF  678
            G    RT+++SF
Sbjct  132  GQHYQRTIHISF  143



>ref|XP_001999541.1| GI23020 [Drosophila mojavensis]
 gb|EDW15002.1| GI23020 [Drosophila mojavensis]
Length=401

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLRI T  PN  Y +   F+  QA SL L   VV    +  P+V++KW G +  
Sbjct  12   IKIFREYLRIPTVHPNIDYSDCVAFLKRQAASLDLPVDVVYPANEANPVVVMKWEGTEPE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+I+LNSHTDV P    KW+H PF A ID   G IYARGSQDMKCVG QYL AIR+LKA
Sbjct  72   LPSIILNSHTDVVPVFLEKWTHDPFSADIDDE-GRIYARGSQDMKCVGTQYLAAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
            SG++P RT YL++
Sbjct  131  SGYKPKRTFYLTY  143



>ref|XP_011257812.1| PREDICTED: aminoacylase-1-like [Camponotus floridanus]
Length=401

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y E   F+  QA+SL L  +V      KP+V+L W G +   
Sbjct  13   VENFREYLRIPSVQPNINYDECVAFLKRQAQSLDLPVKVYHIHPDKPIVVLTWVGTEPAK  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW++PPF A +D   GNIYARGSQDMKCVG+QYLEAIR LK +
Sbjct  73   PAILLNSHMDVVPVFEDKWTYPPFSAHMD-EQGNIYARGSQDMKCVGIQYLEAIRRLKLN  131

Query  643  GFQPIRTVYLSF  678
            G    RT+++SF
Sbjct  132  GQHYQRTIHISF  143



>ref|XP_001953963.1| GF16978 [Drosophila ananassae]
 gb|EDV42524.1| GF16978 [Drosophila ananassae]
Length=397

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+ F++YLRI T  P+  Y    +F+  QAKSL+L  +VV   + KP+VI+ W G    L
Sbjct  9    INIFREYLRIPTVHPDVDYTSCVEFLKRQAKSLNLPVEVVYPAEKKPVVIITWLGSQPEL  68

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             +I+LNSHTDV P  P KW+H PF A ID + G I+ARG+QDMK VG QYL AIR L AS
Sbjct  69   SSIILNSHTDVVPVFPEKWTHEPFSADID-SEGRIFARGTQDMKSVGTQYLGAIRRLLAS  127

Query  643  GFQPIRTVYLSF  678
            GF+P RTVY++F
Sbjct  128  GFKPKRTVYVTF  139



>emb|CDP15803.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSL-SLETQVVEFV--KGKPLVILKWAGKD  453
            I+RFQQYL+I +A P P Y  A +F+ S + S+ SL++Q++ F   K KPL++L W G D
Sbjct  43   ITRFQQYLQISSAHPTPDYTSAINFLTSFSNSIPSLQSQILYFTPEKDKPLLLLTWPGSD  102

Query  454  STLPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSL  633
             TLP+ILLNSH D  P++P KW HPPF A    + G I+ARG+QD KC+G+QYLEAI+ L
Sbjct  103  PTLPSILLNSHLDSVPADPSKWVHPPFSA-YHSSDGKIFARGAQDDKCIGIQYLEAIKRL  161

Query  634  -KASGFQPIRTVYLSF  678
             +   F P+RTV++SF
Sbjct  162  IEEKNFSPLRTVHISF  177



>ref|XP_001746582.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88478.1| predicted protein [Monosiga brevicollis MX1]
Length=421

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++RF+ YLRI+T QP P Y  AA F+  QAK L  E +  E V GKP VI+   G D TL
Sbjct  31   VTRFRDYLRINTMQPTPDYEAAAVFLEGQAKDLGFEVRRWEGVPGKPAVIMTCPGTDPTL  90

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+++LNSH DV P     W HPPF A  +   G IYARGSQDMKCVG+QYLEA+R L+A+
Sbjct  91   PSVVLNSHIDVVPVFEEHWKHPPFAAVKE--DGWIYARGSQDMKCVGMQYLEALRELRAA  148

Query  643  GFQPIRTVYLSF  678
            G    RT++L+F
Sbjct  149  GASFARTIHLTF  160



>ref|XP_002103973.1| GD20717 [Drosophila simulans]
 gb|EDX13476.1| GD20717 [Drosophila simulans]
Length=405

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLRI +  PNP Y    +F+  QA++L L  +V     K  P+V+L W G +  
Sbjct  12   IDYFREYLRIPSVHPNPDYEPCVEFLKRQAENLDLPVEVYYPLDKQNPVVVLSWEGTEKE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
             P+ILLNSH DV P  P KW+HPPF A++D   G I+ARGSQDMKCVG+QYL AIR+LKA
Sbjct  72   WPSILLNSHMDVVPVFPEKWTHPPFGAEVD-EEGRIFARGSQDMKCVGMQYLAAIRALKA  130

Query  640  SGFQPIRTVYLSF  678
             G +  RT+++SF
Sbjct  131  KGLRFKRTIHISF  143



>ref|XP_002423294.1| Aminoacylase-1, putative [Pediculus humanus corporis]
 gb|EEB10556.1| Aminoacylase-1, putative [Pediculus humanus corporis]
Length=404

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y E   F+  Q K L+L+ ++ E VK KP+VIL   G +S L
Sbjct  15   VENFRKYLRIPSVQPNVNYEECVKFLTQQGKELNLDVKIFEIVKNKPIVILTKRGTNSRL  74

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P  P  W + PFDA +D   GNIY RG+QDMKCV +QYLEA+R L   
Sbjct  75   PSILLNSHMDVVPVFPEFWKYGPFDANVD-ENGNIYGRGAQDMKCVAIQYLEALRRLIRK  133

Query  643  GFQPIRTVYLSF  678
              Q  R ++LSF
Sbjct  134  NVQFKRDIHLSF  145



>gb|EFN67390.1| Aminoacylase-1 [Camponotus floridanus]
Length=427

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN  Y E   F+  QA+SL L  +V      KP+V+L W G +   
Sbjct  13   VENFREYLRIPSVQPNINYDECVAFLKRQAQSLDLPVKVYHIHPDKPIVVLTWVGTEPAK  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW++PPF A +D   GNIYARGSQDMKCVG+QYLEAIR LK +
Sbjct  73   PAILLNSHMDVVPVFEDKWTYPPFSAHMD-EQGNIYARGSQDMKCVGIQYLEAIRRLKLN  131

Query  643  GFQPIRTVYLSF  678
            G    RT+++SF
Sbjct  132  GQHYQRTIHISF  143



>ref|XP_011139459.1| PREDICTED: aminoacylase-1A-like [Harpegnathos saltator]
Length=402

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN +Y +  +FI++ A+S  L  +V     GKP+VI+ W G DS+ 
Sbjct  17   VEYFREYLRIPSVQPNAKYEKCVEFILTLAESFHLPAKVYHLHPGKPVVIIAWEGTDSSK  76

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             TILLN+H DV  + P KW +PPF A +D   GNIYARGSQDMK VG+QYLEAI   K +
Sbjct  77   STILLNNHMDVVTTYPDKWLYPPFSAHMDE-DGNIYARGSQDMKSVGMQYLEAIHRFKLN  135

Query  643  GFQPIRTVYLSF  678
            G +  RTVY+SF
Sbjct  136  GKRFSRTVYISF  147



>ref|XP_004926560.1| PREDICTED: aminoacylase-1-like [Bombyx mori]
Length=399

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I+ F +YL+I + QPN  Y +   F+  QA  + L  +V E V  KP+V+L W GK+  L
Sbjct  11   IANFVEYLKIPSVQPNIDYSDCVKFLTRQANEIGLAVKVYEVVPTKPIVVLTWTGKEPNL  70

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P   + W++PPF   ID   G I+ARGSQDMKCVG+QYLEAIR LKA+
Sbjct  71   PAILLNSHMDVVPVFENSWTYPPFSGHID-NDGKIFARGSQDMKCVGIQYLEAIRKLKAA  129

Query  643  GFQPIRTVYLSF  678
                 RT+++SF
Sbjct  130  QVTLKRTLHISF  141



>ref|XP_002074014.1| GK14414 [Drosophila willistoni]
 gb|EDW85000.1| GK14414 [Drosophila willistoni]
Length=347

 Score =   140 bits (354),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVK-GKPLVILKWAGKDST  459
            I  F++YLRI +  PN  Y E   F+  QA S++L   VV   K  KP+VI+KW G    
Sbjct  15   IQIFREYLRIPSVLPNVNYTECVAFLKRQAASINLAVDVVYPAKQTKPVVIMKWLGSQPE  74

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSH DV P    KW+  PF A +D + G I+ARGSQDMKCVG QYL AIR+LKA
Sbjct  75   LPSILLNSHMDVVPVFREKWTQDPFGAHLD-SEGRIFARGSQDMKCVGTQYLAAIRALKA  133

Query  640  SGFQPIRTVYLSF  678
            +G++P RTVYLS+
Sbjct  134  NGYRPKRTVYLSY  146



>ref|XP_011175804.1| PREDICTED: aminoacylase-1 [Solenopsis invicta]
 gb|EFZ21239.1| hypothetical protein SINV_00964 [Solenopsis invicta]
Length=401

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QP+  Y E   F+  QA+SL L  +V      KP+V+L W G   T 
Sbjct  11   VENFREYLRIPSVQPDINYDECVAFLKKQAQSLDLPLKVYHVYPKKPIVVLTWEGTQPTK  70

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P    KW++PPF A +D   GNIYARG+QDMKCVG+QYLEAIR LK +
Sbjct  71   PSILLNSHMDVVPVFEDKWTYPPFSAHMD-EQGNIYARGAQDMKCVGIQYLEAIRRLKLN  129

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  130  GQRCQRTIHMSF  141



>gb|EFN84446.1| Aminoacylase-1A [Harpegnathos saltator]
Length=428

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 90/132 (68%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI + QPN +Y +  +FI++ A+S  L  +V     GKP+VI+ W G DS+ 
Sbjct  43   VEYFREYLRIPSVQPNAKYEKCVEFILTLAESFHLPAKVYHLHPGKPVVIIAWEGTDSSK  102

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             TILLN+H DV  + P KW +PPF A +D   GNIYARGSQDMK VG+QYLEAI   K +
Sbjct  103  STILLNNHMDVVTTYPDKWLYPPFSAHMDE-DGNIYARGSQDMKSVGMQYLEAIHRFKLN  161

Query  643  GFQPIRTVYLSF  678
            G +  RTVY+SF
Sbjct  162  GKRFSRTVYISF  173



>ref|XP_006169396.1| PREDICTED: aminoacylase-1A-like [Tupaia chinensis]
Length=408

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  +A+ L L  Q VE   G  + +L W G + TL
Sbjct  13   VTLFRQYLRIRTVQPQPDYGAAVAFLEERARQLGLSCQKVEVAPGYVVTVLTWPGTNPTL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P++LLNSHTDV P     WSH PF+A  DP  G IYARG+QDMKCV +QYLEA+R LKA 
Sbjct  73   PSLLLNSHTDVVPVFEEHWSHGPFEAFKDP-EGFIYARGAQDMKCVSIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G +  RT++++F
Sbjct  132  GRRFPRTIHMTF  143



>ref|XP_002097104.1| GE24683 [Drosophila yakuba]
 gb|EDW96816.1| GE24683 [Drosophila yakuba]
Length=405

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVV-EFVKGKPLVILKWAGKDST  459
            I  F++YLRI T  PNP Y    +F+  QA+ L L  +V     K  P+V+L W G +  
Sbjct  12   IEYFREYLRIPTVHPNPDYEPCVEFLKRQAEDLDLPVKVYYPLDKKNPVVVLSWEGTERE  71

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
             P+ILLNSH DV P  P  W+HPPF A ID   G I+ARGSQDMKCVG+QYL AIRSLKA
Sbjct  72   WPSILLNSHMDVVPVFPENWTHPPFGADID-EEGRIFARGSQDMKCVGVQYLAAIRSLKA  130

Query  640  SGFQPIRTVYLSF  678
             G +  RT+++SF
Sbjct  131  KGLRFKRTIHISF  143



>emb|CDS31047.1| aminoacylase 1 [Hymenolepis microstoma]
Length=427

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F+ YLR  T  P+P Y EA +++ +Q   + LE  +VE +   P++++KW G D +L
Sbjct  12   VENFRTYLRFQTVHPDPDYTEAVNWLRNQGTEIGLECFLVELIPKNPILVMKWQGNDPSL  71

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
              I+LNSH DV   E  KW+H PF A++ P  GNIYARG+QDMK VG+Q+LEA+R LK  
Sbjct  72   RAIMLNSHMDVVAVEREKWTHDPFAAEMTP-DGNIYARGTQDMKSVGVQHLEAVRRLKLG  130

Query  643  GFQPIRTVYLSF  678
            GF P RT+YL++
Sbjct  131  GFIPKRTIYLTY  142



>ref|XP_002713420.1| PREDICTED: aminoacylase-1 [Oryctolagus cuniculus]
Length=408

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  QA  L+L  Q VE   G  + +L W G + TL
Sbjct  13   VTLFRQYLRIRTVQPEPDYGAAVPFLEDQAHQLALSCQKVEVAPGYVVTVLTWPGTNPTL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             +ILLNSHTDV P     WSH PF+A  DP  G IYARG+QDMKCV +QYLEA+R LKA 
Sbjct  73   SSILLNSHTDVVPVFKEHWSHDPFEAFKDP-EGYIYARGAQDMKCVSIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G +  RT++++F
Sbjct  132  GHRFPRTIHMTF  143



>ref|XP_006106513.1| PREDICTED: aminoacylase-1B isoform X3 [Myotis lucifugus]
Length=343

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  +A+ L L  Q VE   G+ + +L W G +  L
Sbjct  13   VTLFRQYLRIRTVQPEPDYGAAVAFLEERARQLGLGCQKVEVAPGRVVTVLTWPGTNPKL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++LLNSHTDV P     WSH PF+A  D A G IYARG+QDMKCVG+QYLEA+R LKA 
Sbjct  73   SSLLLNSHTDVVPVSKEYWSHDPFEAFKD-AEGYIYARGAQDMKCVGIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G    RT++++F
Sbjct  132  GHHFPRTIHMTF  143



>ref|XP_002594432.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae]
 gb|EEN50443.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae]
Length=411

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +++F+ YLRI T  P+P Y  A  F+   A  L L  +V+E   GKP+V++ W G+D TL
Sbjct  19   VTKFRDYLRIRTVHPDPDYAGAVVFLQQYADELGLPCKVIEVHPGKPVVLMTWEGQDPTL  78

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            PT+LLNSHTDV P  P  W   PF A      GNIYARG+QDMKC G+ YLEAIR LKA 
Sbjct  79   PTVLLNSHTDVVPVFPEHWCCEPFSAD-KMENGNIYARGTQDMKCCGIWYLEAIRRLKAE  137

Query  643  GFQPIRTVYLSF  678
            G +  RT +LSF
Sbjct  138  GKRFKRTFHLSF  149



>ref|XP_008153375.1| PREDICTED: aminoacylase-1 isoform X3 [Eptesicus fuscus]
Length=343

 Score =   140 bits (352),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  +A+ L L  Q VE   G+ + +L W G +  L
Sbjct  13   VTLFRQYLRIRTVQPEPDYGAAVAFLEERARQLGLGCQKVEVAPGRVVTVLTWPGTNPEL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++LLNSHTDV P     WSH PF+A  D A G IYARG+QDMKCVG+QYLEA+R LKA 
Sbjct  73   SSLLLNSHTDVVPVSQEYWSHDPFEAFKD-AEGYIYARGAQDMKCVGIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G +  RT++++F
Sbjct  132  GHRFPRTIHMTF  143



>ref|XP_007950231.1| PREDICTED: aminoacylase-1 isoform X3 [Orycteropus afer afer]
Length=343

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  +A  L L+ Q VE   G+ + +L W G + TL
Sbjct  13   VTLFRQYLRIHTVQPEPDYGAAVAFLEERAHQLGLDCQKVEVAPGRVVTVLTWPGTNPTL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++LLNSHTDV P     WSH PF+A  D A G IYARG+QDMKCV +QYLEA+R LKA 
Sbjct  73   SSLLLNSHTDVVPVFKEHWSHDPFEAFKD-AEGYIYARGAQDMKCVSIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G +  RT++++F
Sbjct  132  GHRFPRTIHMTF  143



>ref|XP_001380469.3| PREDICTED: aminoacylase-1A-like isoform X1 [Monodelphis domestica]
 ref|XP_007500579.1| PREDICTED: aminoacylase-1A-like isoform X2 [Monodelphis domestica]
Length=413

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 87/132 (66%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P Y E   F+   A  L L+ Q VE   G+ + IL W G D  L
Sbjct  18   VTLFRQYLRIRTVQPEPNYDEVVLFLEKIASDLGLDCQKVEVAPGRVVTILTWQGTDPRL  77

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             +++LNSHTDV P     WSH PF+A  DP  GNIYARG+QDMKCVG+QYLEAIR LK  
Sbjct  78   QSLVLNSHTDVVPVFEEHWSHDPFEAFKDP-QGNIYARGAQDMKCVGIQYLEAIRRLKGE  136

Query  643  GFQPIRTVYLSF  678
            G +  RT++L+F
Sbjct  137  GKRLPRTIHLTF  148



>ref|XP_009861814.1| PREDICTED: aminoacylase-1-like [Ciona intestinalis]
Length=346

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGK-PLVILKWAGKDST  459
            +++F++YLRI T  P P Y +A  F++   K L LE ++V+ ++ K  +V++KW GK+  
Sbjct  6    VTKFREYLRIKTVHPEPDYEKAIAFLVEYGKDLGLEVKLVQPLEPKFAVVLMKWPGKNPK  65

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSHTDV P     W H  F A I    GNIY RG+QDMKCVG+QYLEAIR LK 
Sbjct  66   LPSILLNSHTDVVPVYEEHWKHDAF-AAIKDDNGNIYGRGTQDMKCVGVQYLEAIRELKK  124

Query  640  SGFQPIRTVYLSF  678
             G Q  R VY+SF
Sbjct  125  QGVQLERDVYISF  137



>ref|XP_003642034.1| PREDICTED: aminoacylase-1 isoformX2 [Gallus gallus]
Length=348

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F++YLRIDT  P P Y  A  F+      L LE Q VE  +G+ +++L W G +  L
Sbjct  18   VTLFREYLRIDTVHPKPDYDAAVQFLERVGTDLGLECQKVEVCQGRVVLVLTWPGTNPRL  77

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             +ILLNSHTDV P     W++PPF+A  D + GNIYARG+QDMKCV +QYLEAIR LKA 
Sbjct  78   RSILLNSHTDVVPVFEEHWTYPPFEAVKD-SQGNIYARGAQDMKCVSIQYLEAIRRLKAE  136

Query  643  GFQPIRTVYLSF  678
            G    RT++LSF
Sbjct  137  GKSFARTIHLSF  148



>ref|XP_011332735.1| PREDICTED: aminoacylase-1-like [Cerapachys biroi]
 gb|EZA58129.1| Aminoacylase-1 [Cerapachys biroi]
Length=403

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YLRI +  P+  Y E   F+  QA+SL L  +V      KP+V+L WAG   T 
Sbjct  14   VENFREYLRIPSVHPDINYDECVAFLTRQAQSLDLPIKVYHVHPKKPIVVLTWAGIQPTK  73

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P ILLNSH DV P    KW++PPF A +D   GNIYARGSQDMKCVG+QYLEAIR +K +
Sbjct  74   PAILLNSHMDVVPVFEDKWTYPPFSAHMD-EQGNIYARGSQDMKCVGIQYLEAIRRMKLN  132

Query  643  GFQPIRTVYLSF  678
            G +  RT+++SF
Sbjct  133  GQRCQRTIHISF  144



>ref|XP_006978456.1| PREDICTED: aminoacylase-1A-like isoform X1 [Peromyscus maniculatus 
bairdii]
 ref|XP_006978457.1| PREDICTED: aminoacylase-1A-like isoform X2 [Peromyscus maniculatus 
bairdii]
Length=408

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QPNP YG A  F+  +A  L L  Q VE   G  + +L W G + TL
Sbjct  13   VTLFRQYLRIRTVQPNPDYGAAIAFLEERAHQLGLSCQKVEVAPGFVITVLTWLGTNPTL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSHTDV P     W H PF+A  D + G IYARG+QDMKCV +QYLEA+R LK+ 
Sbjct  73   PSILLNSHTDVVPVFKEHWHHDPFEAFKD-SEGYIYARGAQDMKCVSIQYLEAVRRLKSE  131

Query  643  GFQPIRTVYLSF  678
            G +  RT++L+F
Sbjct  132  GHRFPRTIHLTF  143



>ref|XP_001863762.1| aminoacylase [Culex quinquefasciatus]
 gb|EDS39113.1| aminoacylase [Culex quinquefasciatus]
Length=404

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            I  F++YL+I +  P+  Y E  +F+  QA SL L  +V E    KP+VI+ W G D + 
Sbjct  16   IRLFREYLKIPSVHPDVNYDECVEFLRRQASSLDLPVEVYEVNPSKPIVIISWEGTDPSA  75

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             +I+LNSH DV P  P +W+HPPF A +D A G IYARGSQDMKCVG+Q+L AIR++K  
Sbjct  76   TSIILNSHMDVVPVYPERWTHPPFSAHMD-AEGRIYARGSQDMKCVGMQFLGAIRAMKRD  134

Query  643  GFQPIRTVYLSF  678
            G Q  RT++++F
Sbjct  135  GVQLRRTLHVTF  146



>ref|XP_006106511.1| PREDICTED: aminoacylase-1B isoform X1 [Myotis lucifugus]
Length=408

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  +A+ L L  Q VE   G+ + +L W G +  L
Sbjct  13   VTLFRQYLRIRTVQPEPDYGAAVAFLEERARQLGLGCQKVEVAPGRVVTVLTWPGTNPKL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++LLNSHTDV P     WSH PF+A  D A G IYARG+QDMKCVG+QYLEA+R LKA 
Sbjct  73   SSLLLNSHTDVVPVSKEYWSHDPFEAFKD-AEGYIYARGAQDMKCVGIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G    RT++++F
Sbjct  132  GHHFPRTIHMTF  143



>gb|ERL86650.1| hypothetical protein D910_04056 [Dendroctonus ponderosae]
Length=592

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 91/132 (69%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            +  F++YL+I +  P+  Y     F+ +QAK L L  +V   V+GKP+V++ W+G +  L
Sbjct  17   VENFRKYLQIPSVHPHVDYEPCVQFLRAQAKGLDLPLKVYTVVEGKPIVVITWSGSEPAL  76

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
            P+ILLNSH DV P    KW+HPPF A  D A GNIYARG+QDMKCVG+QYLEAIR ++ +
Sbjct  77   PSILLNSHMDVVPVFADKWAHPPFSAHTD-AQGNIYARGAQDMKCVGIQYLEAIRRMRLA  135

Query  643  GFQPIRTVYLSF  678
            G    RTV+++F
Sbjct  136  GATVRRTVHVAF  147



>ref|XP_008153360.1| PREDICTED: aminoacylase-1 isoform X1 [Eptesicus fuscus]
Length=408

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 89/132 (67%), Gaps = 1/132 (1%)
 Frame = +1

Query  283  ISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDSTL  462
            ++ F+QYLRI T QP P YG A  F+  +A+ L L  Q VE   G+ + +L W G +  L
Sbjct  13   VTLFRQYLRIRTVQPEPDYGAAVAFLEERARQLGLGCQKVEVAPGRVVTVLTWPGTNPEL  72

Query  463  PTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKAS  642
             ++LLNSHTDV P     WSH PF+A  D A G IYARG+QDMKCVG+QYLEA+R LKA 
Sbjct  73   SSLLLNSHTDVVPVSQEYWSHDPFEAFKD-AEGYIYARGAQDMKCVGIQYLEAVRRLKAE  131

Query  643  GFQPIRTVYLSF  678
            G +  RT++++F
Sbjct  132  GHRFPRTIHMTF  143



>emb|CBY18015.1| unnamed protein product [Oikopleura dioica]
Length=399

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 1/131 (1%)
 Frame = +1

Query  280  IISRFQQYLRIDTAQPNPRYGEAADFIISQAKSLSLETQVVEFVKGKPLVILKWAGKDST  459
            +++RF++Y+R++T QPNP Y  A +FI      L LE    E + GKP ++L W G +  
Sbjct  8    LVTRFREYIRVNTMQPNPDYKAAEEFIHKYGDELGLEFSSHECITGKPCIVLTWEGSEPE  67

Query  460  LPTILLNSHTDVAPSEPHKWSHPPFDAQIDPATGNIYARGSQDMKCVGLQYLEAIRSLKA  639
            LP+ILLNSH DV P  P +W H PF A      G IY RG+QDMKCVG+ Y+EAIR LK 
Sbjct  68   LPSILLNSHIDVVPVFPSQWDHEPFSAH-KTEDGWIYGRGTQDMKCVGIWYMEAIRVLKM  126

Query  640  SGFQPIRTVYL  672
              F+P RT+++
Sbjct  127  QNFKPKRTIHV  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240