BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035J24

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EEE54949.1|  hypothetical protein OsJ_02519                          109   1e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD52658.1|  HcrVf2 protein-like                                    105   5e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008807618.1|  PREDICTED: LRR receptor-like serine/threonin...    100   2e-20   
gb|EEC71039.1|  hypothetical protein OsI_02753                        98.6    7e-20   Oryza sativa Indica Group [Indian rice]
ref|XP_009405134.1|  PREDICTED: LRR receptor-like serine/threonin...  99.0    8e-20   
ref|XP_008218761.1|  PREDICTED: LRR receptor-like serine/threonin...  97.4    2e-19   Prunus mume [ume]
ref|XP_008775355.1|  PREDICTED: receptor-like protein 12              96.7    4e-19   Phoenix dactylifera
ref|XP_010918709.1|  PREDICTED: receptor-like protein 12              95.9    7e-19   Elaeis guineensis
ref|XP_010249628.1|  PREDICTED: receptor-like protein 12              95.5    9e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010662668.1|  PREDICTED: leucine-rich repeat receptor-like...  93.2    1e-18   Vitis vinifera
ref|XP_006600047.1|  PREDICTED: probably inactive leucine-rich re...  92.0    1e-18   
ref|XP_002458109.1|  hypothetical protein SORBIDRAFT_03g027070        95.1    1e-18   Sorghum bicolor [broomcorn]
ref|XP_007024895.1|  Disease resistance family protein / LRR fami...  94.7    2e-18   
ref|XP_010646018.1|  PREDICTED: probably inactive leucine-rich re...  92.8    3e-18   Vitis vinifera
ref|XP_004958856.1|  PREDICTED: probable leucine-rich repeat rece...  94.4    3e-18   
gb|KCW62328.1|  hypothetical protein EUGRSUZ_H049701                  90.1    4e-18   Eucalyptus grandis [rose gum]
ref|XP_002274461.1|  PREDICTED: LRR receptor-like serine/threonin...  93.2    6e-18   Vitis vinifera
ref|XP_007030466.1|  Disease resistance family protein / LRR fami...  93.2    8e-18   
ref|XP_009348759.1|  PREDICTED: receptor-like protein 12              92.8    9e-18   
gb|KCW64528.1|  hypothetical protein EUGRSUZ_G02130                   92.4    9e-18   Eucalyptus grandis [rose gum]
ref|XP_010068694.1|  PREDICTED: leucine-rich repeat receptor prot...  92.4    1e-17   Eucalyptus grandis [rose gum]
emb|CDP12881.1|  unnamed protein product                              92.4    1e-17   Coffea canephora [robusta coffee]
ref|XP_010646028.1|  PREDICTED: probably inactive leucine-rich re...  92.0    1e-17   Vitis vinifera
ref|XP_003621481.1|  Receptor-like protein kinase                     92.0    1e-17   Medicago truncatula
gb|KCW64519.1|  hypothetical protein EUGRSUZ_G02120                   92.0    2e-17   Eucalyptus grandis [rose gum]
gb|KCW64345.1|  hypothetical protein EUGRSUZ_G019722                  91.3    2e-17   Eucalyptus grandis [rose gum]
ref|XP_006600066.1|  PREDICTED: probable LRR receptor-like serine...  90.5    2e-17   
gb|KCW86893.1|  hypothetical protein EUGRSUZ_B03476                   91.3    3e-17   Eucalyptus grandis [rose gum]
ref|XP_011460549.1|  PREDICTED: probably inactive leucine-rich re...  90.1    3e-17   Fragaria vesca subsp. vesca
ref|XP_009354357.1|  PREDICTED: LRR receptor-like serine/threonin...  91.3    3e-17   
gb|KHN45763.1|  LRR receptor-like serine/threonine-protein kinase...  90.9    3e-17   Glycine soja [wild soybean]
gb|KDO55605.1|  hypothetical protein CISIN_1g038320mg                 89.7    3e-17   Citrus sinensis [apfelsine]
ref|XP_006599588.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    3e-17   
ref|XP_006599582.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    3e-17   
ref|XP_006600052.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    3e-17   
ref|XP_006607060.1|  PREDICTED: probable leucine-rich repeat rece...  90.9    3e-17   
ref|XP_003549056.1|  PREDICTED: LRR receptor-like serine/threonin...  90.9    4e-17   
ref|NP_001174592.1|  Os06g0140000                                     90.9    4e-17   
ref|XP_002458027.1|  hypothetical protein SORBIDRAFT_03g025650        90.9    4e-17   Sorghum bicolor [broomcorn]
ref|XP_010068268.1|  PREDICTED: probably inactive leucine-rich re...  90.9    4e-17   Eucalyptus grandis [rose gum]
ref|XP_010046668.1|  PREDICTED: leucine-rich repeat receptor-like...  90.9    4e-17   Eucalyptus grandis [rose gum]
gb|KEH25161.1|  LRR receptor-like kinase family protein               89.0    4e-17   Medicago truncatula
ref|XP_010662760.1|  PREDICTED: LRR receptor-like serine/threonin...  90.5    4e-17   Vitis vinifera
ref|XP_007226165.1|  hypothetical protein PRUPE_ppa015243mg           90.5    5e-17   
ref|XP_009618939.1|  PREDICTED: probably inactive leucine-rich re...  90.5    5e-17   Nicotiana tomentosiformis
gb|ACM89598.1|  leucine-rich repeat protein                           90.1    5e-17   Glycine max [soybeans]
ref|XP_007030464.1|  Disease resistance family protein / LRR fami...  90.1    5e-17   
gb|KHG16201.1|  DNA-damage-repair/toleration protein                  87.4    6e-17   Gossypium arboreum [tree cotton]
ref|XP_009338728.1|  PREDICTED: receptor-like protein 12              90.1    6e-17   
ref|XP_009405132.1|  PREDICTED: LRR receptor-like serine/threonin...  90.1    6e-17   
ref|XP_009618938.1|  PREDICTED: probable LRR receptor-like serine...  90.1    6e-17   Nicotiana tomentosiformis
ref|NP_001172452.1|  Os01g0601675                                     90.1    7e-17   
ref|XP_006600036.1|  PREDICTED: LRR receptor-like serine/threonin...  89.7    7e-17   
ref|XP_010910868.1|  PREDICTED: putative leucine-rich repeat rece...  87.4    8e-17   
ref|NP_001172453.1|  Os01g0601700                                     86.7    8e-17   
ref|XP_009388094.1|  PREDICTED: probably inactive leucine-rich re...  85.9    8e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010323160.1|  PREDICTED: EIX receptor 1 isoform X1             89.7    9e-17   
gb|AAR28378.1|  EIX receptor 2                                        89.7    9e-17   Solanum lycopersicum
ref|XP_006600054.1|  PREDICTED: probable LRR receptor-like serine...  89.4    9e-17   
ref|XP_010646800.1|  PREDICTED: receptor-like protein 12              88.2    9e-17   
ref|XP_002436946.1|  hypothetical protein SORBIDRAFT_10g012050        89.7    1e-16   Sorghum bicolor [broomcorn]
ref|XP_006470121.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    1e-16   
ref|XP_010040211.1|  PREDICTED: probable leucine-rich repeat rece...  89.4    1e-16   
gb|EMT19054.1|  Leucine-rich repeat receptor protein kinase EXS       89.4    1e-16   
ref|XP_010068697.1|  PREDICTED: leucine-rich repeat receptor-like...  88.6    1e-16   
gb|KHG06604.1|  DNA-damage-repair/toleration protein                  85.9    1e-16   Gossypium arboreum [tree cotton]
ref|XP_009610906.1|  PREDICTED: LRR receptor-like serine/threonin...  89.4    1e-16   Nicotiana tomentosiformis
gb|KCW45386.1|  hypothetical protein EUGRSUZ_L00930                   89.0    1e-16   Eucalyptus grandis [rose gum]
gb|KDO50225.1|  hypothetical protein CISIN_1g0032002mg                89.0    1e-16   Citrus sinensis [apfelsine]
gb|EAY74858.1|  hypothetical protein OsI_02750                        89.0    1e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_002450414.1|  hypothetical protein SORBIDRAFT_05g004935        89.0    1e-16   
ref|XP_006452209.1|  hypothetical protein CICLE_v10007386mg           89.0    1e-16   
gb|KDO56170.1|  hypothetical protein CISIN_1g040379mg                 86.7    1e-16   Citrus sinensis [apfelsine]
gb|EEC71023.1|  hypothetical protein OsI_02720                        89.0    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008360818.1|  PREDICTED: probable LRR receptor-like serine...  89.0    2e-16   
gb|KJB45923.1|  hypothetical protein B456_007G338100                  89.0    2e-16   Gossypium raimondii
ref|XP_002273469.1|  PREDICTED: receptor-like protein 12              89.0    2e-16   Vitis vinifera
gb|KEH25176.1|  LRR receptor-like kinase family protein               88.6    2e-16   Medicago truncatula
ref|XP_008218738.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  88.6    2e-16   
gb|EAY74841.1|  hypothetical protein OsI_02733                        86.3    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_009405133.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT13998.1|  LRR receptor-like serine/threonine-protein kinase...  88.6    2e-16   
ref|XP_009367839.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    2e-16   Pyrus x bretschneideri [bai li]
ref|XP_008231480.1|  PREDICTED: LRR receptor-like serine/threonin...  88.6    2e-16   Prunus mume [ume]
gb|KHG30701.1|  hypothetical protein F383_11023                       84.7    3e-16   Gossypium arboreum [tree cotton]
ref|XP_010068699.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    3e-16   
ref|XP_004969084.1|  PREDICTED: receptor-like protein kinase 5-like   88.2    3e-16   
gb|KCW64526.1|  hypothetical protein EUGRSUZ_G02127                   88.2    3e-16   Eucalyptus grandis [rose gum]
gb|KEH25160.1|  LRR receptor-like kinase family protein               88.6    3e-16   Medicago truncatula
gb|KJB45901.1|  hypothetical protein B456_007G3361002                 85.1    3e-16   Gossypium raimondii
ref|XP_007220932.1|  hypothetical protein PRUPE_ppa023754mg           88.2    3e-16   
ref|XP_010231995.1|  PREDICTED: probable LRR receptor-like serine...  88.2    3e-16   Brachypodium distachyon [annual false brome]
ref|XP_010246690.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010253421.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009607039.1|  PREDICTED: LRR receptor-like serine/threonin...  88.2    3e-16   Nicotiana tomentosiformis
gb|KCW64537.1|  hypothetical protein EUGRSUZ_G02140                   87.8    3e-16   Eucalyptus grandis [rose gum]
gb|KJB45924.1|  hypothetical protein B456_007G338300                  87.8    3e-16   Gossypium raimondii
ref|XP_009342502.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    4e-16   Pyrus x bretschneideri [bai li]
gb|KJB45925.1|  hypothetical protein B456_007G338400                  87.8    4e-16   Gossypium raimondii
gb|KJB45928.1|  hypothetical protein B456_007G338700                  87.8    4e-16   Gossypium raimondii
ref|XP_009342503.1|  PREDICTED: probable leucine-rich repeat rece...  87.8    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_006490685.1|  PREDICTED: probable LRR receptor-like serine...  87.8    4e-16   Citrus sinensis [apfelsine]
gb|KJB45216.1|  hypothetical protein B456_007G295800                  87.8    4e-16   Gossypium raimondii
ref|XP_008804946.1|  PREDICTED: probable LRR receptor-like serine...  87.4    4e-16   
ref|XP_003636151.1|  Receptor protein kinase-like protein             86.7    5e-16   
ref|XP_003633794.1|  PREDICTED: LRR receptor-like serine/threonin...  87.4    5e-16   Vitis vinifera
ref|XP_010111049.1|  LRR receptor-like serine/threonine-protein k...  87.4    5e-16   Morus notabilis
ref|XP_011005448.1|  PREDICTED: receptor-like protein 12 isoform X1   87.4    5e-16   Populus euphratica
gb|KJB26590.1|  hypothetical protein B456_004G248900                  87.4    5e-16   Gossypium raimondii
ref|XP_004980222.1|  PREDICTED: probable leucine-rich repeat rece...  87.0    6e-16   
ref|XP_002265946.1|  PREDICTED: receptor-like protein kinase 2        87.0    6e-16   Vitis vinifera
ref|XP_008218773.1|  PREDICTED: probable leucine-rich repeat rece...  87.0    7e-16   
gb|KEH16824.1|  leucine-rich receptor-like kinase family protein,...  87.0    7e-16   Medicago truncatula
gb|EAY81349.1|  hypothetical protein OsI_36521                        86.7    7e-16   Oryza sativa Indica Group [Indian rice]
ref|NP_001068112.1|  Os11g0568200                                     86.3    8e-16   
ref|XP_009340354.1|  PREDICTED: LRR receptor-like serine/threonin...  86.7    8e-16   Pyrus x bretschneideri [bai li]
ref|XP_002315907.2|  scab resistance family protein                   86.7    8e-16   
gb|KEH29514.1|  LRR receptor-like kinase family protein               86.7    9e-16   Medicago truncatula
ref|XP_006599589.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    1e-15   
gb|EMS60284.1|  LRR receptor-like serine/threonine-protein kinase...  86.7    1e-15   Triticum urartu
gb|EAY81350.1|  hypothetical protein OsI_36522                        85.9    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006475703.1|  PREDICTED: LRR receptor-like serine/threonin...  85.5    1e-15   
ref|XP_002315858.2|  scab resistance family protein                   86.3    1e-15   Populus trichocarpa [western balsam poplar]
gb|EEC68371.1|  hypothetical protein OsI_36508                        85.9    1e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006663530.1|  PREDICTED: probable leucine-rich repeat rece...  86.3    1e-15   
gb|KHN42550.1|  LRR receptor-like serine/threonine-protein kinase...  86.3    1e-15   Glycine soja [wild soybean]
ref|XP_010662805.1|  PREDICTED: LRR receptor-like serine/threonin...  86.3    1e-15   
ref|XP_007021422.1|  Disease resistance family protein / LRR fami...  86.3    1e-15   
ref|XP_008338558.1|  PREDICTED: receptor-like protein 12              86.3    1e-15   
gb|KDO37541.1|  hypothetical protein CISIN_1g045139mg                 85.9    1e-15   Citrus sinensis [apfelsine]
ref|XP_008232803.1|  PREDICTED: probably inactive leucine-rich re...  84.0    1e-15   
ref|XP_008670802.1|  PREDICTED: leucine-rich repeat receptor-like...  85.9    2e-15   Zea mays [maize]
gb|KEH16821.1|  LRR receptor-like kinase family protein               82.4    2e-15   Medicago truncatula
ref|XP_010046667.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    2e-15   Eucalyptus grandis [rose gum]
ref|XP_007224548.1|  hypothetical protein PRUPE_ppa024613mg           85.5    2e-15   
ref|XP_010046666.1|  PREDICTED: probable leucine-rich repeat rece...  85.5    2e-15   Eucalyptus grandis [rose gum]
ref|XP_010918705.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    2e-15   
gb|KCW86892.1|  hypothetical protein EUGRSUZ_B03475                   85.9    2e-15   Eucalyptus grandis [rose gum]
ref|XP_009375566.1|  PREDICTED: LRR receptor-like serine/threonin...  85.9    2e-15   Pyrus x bretschneideri [bai li]
gb|EAY74833.1|  hypothetical protein OsI_02725                        85.9    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010655653.1|  PREDICTED: receptor-like protein 12              85.9    2e-15   Vitis vinifera
gb|EEE52293.1|  hypothetical protein OsJ_34286                        85.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006475701.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    2e-15   
gb|ABA94375.1|  Leucine Rich Repeat family protein                    85.9    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EMT18287.1|  LRR receptor-like serine/threonine-protein kinase...  85.5    2e-15   
ref|XP_010660819.1|  PREDICTED: receptor-like protein 12              85.5    2e-15   
ref|XP_008218592.1|  PREDICTED: probable leucine-rich repeat rece...  85.5    2e-15   Prunus mume [ume]
emb|CAN71913.1|  hypothetical protein VITISV_032859                   85.1    2e-15   Vitis vinifera
gb|EEE54946.1|  hypothetical protein OsJ_02516                        85.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006452275.1|  hypothetical protein CICLE_v10007379mg           85.5    2e-15   
ref|XP_008226203.1|  PREDICTED: receptor-like protein 12              85.5    2e-15   Prunus mume [ume]
dbj|BAD52656.1|  HcrVf3 protein-like                                  85.1    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010650298.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    3e-15   Vitis vinifera
ref|XP_004980614.1|  PREDICTED: leucine-rich repeat receptor-like...  85.1    3e-15   
ref|XP_002318355.2|  hypothetical protein POPTR_0012s01080g           85.1    3e-15   
dbj|BAG90139.1|  unnamed protein product                              85.1    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ03068.1|  HB04p                                                 85.1    3e-15   Malus floribunda [Japanese crab apple]
ref|XP_011001954.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-15   Populus euphratica
ref|XP_007220831.1|  hypothetical protein PRUPE_ppa027090mg           85.1    3e-15   
ref|XP_003579434.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-15   Brachypodium distachyon [annual false brome]
ref|XP_006452261.1|  hypothetical protein CICLE_v10010776mg           85.1    3e-15   
ref|XP_006493981.1|  PREDICTED: LRR receptor-like serine/threonin...  85.1    3e-15   
gb|KCW86891.1|  hypothetical protein EUGRSUZ_B03474                   85.1    3e-15   Eucalyptus grandis [rose gum]
ref|XP_006452276.1|  hypothetical protein CICLE_v10007373mg           85.1    3e-15   
gb|EEE52285.1|  hypothetical protein OsJ_34275                        85.1    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ03074.1|  HcrVf4                                                85.1    3e-15   Malus floribunda [Japanese crab apple]
ref|XP_008341680.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-15   
gb|ABA94357.1|  Leucine Rich Repeat family protein                    85.1    3e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAC40827.1|  HcrVf3 protein                                       85.1    3e-15   Malus floribunda [Japanese crab apple]
ref|XP_011001953.1|  PREDICTED: probable LRR receptor-like serine...  85.1    3e-15   Populus euphratica
gb|KDO62592.1|  hypothetical protein CISIN_1g045210mg                 85.1    3e-15   Citrus sinensis [apfelsine]
gb|AEQ27748.1|  receptor-like protein                                 85.1    3e-15   Malus micromalus [Kaido crab apple]
ref|XP_010662757.1|  PREDICTED: receptor-like protein 12 isoform X1   85.1    3e-15   Vitis vinifera
ref|XP_010662758.1|  PREDICTED: receptor-like protein 12 isoform X2   84.7    3e-15   Vitis vinifera
emb|CBI22735.3|  unnamed protein product                              84.3    3e-15   Vitis vinifera
ref|XP_007220752.1|  hypothetical protein PRUPE_ppa025491mg           84.7    3e-15   
ref|XP_006452262.1|  hypothetical protein CICLE_v10010520mg           85.1    3e-15   
ref|XP_009352118.1|  PREDICTED: LRR receptor-like serine/threonin...  84.7    3e-15   
gb|AEQ27752.1|  receptor-like protein                                 84.7    4e-15   Malus micromalus [Kaido crab apple]
ref|XP_006485564.1|  PREDICTED: receptor-like protein kinase HSL1...  84.7    4e-15   
gb|AEQ27747.1|  receptor-like protein                                 84.7    4e-15   Malus baccata [shan jing zi]
gb|AAD50430.1|AF166121_1  Cf2/Cf5 disease resistance protein homolog  84.7    4e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAC40826.1|  HcrVf2 protein                                       84.7    4e-15   Malus floribunda [Japanese crab apple]
gb|AEQ27746.1|  receptor-like protein                                 84.7    4e-15   Malus baccata [shan jing zi]
ref|XP_002274689.1|  PREDICTED: receptor-like protein 12              84.7    4e-15   Vitis vinifera
ref|XP_008376669.1|  PREDICTED: probable leucine-rich repeat rece...  84.7    4e-15   Malus domestica [apple tree]
gb|EEC68383.1|  hypothetical protein OsI_36529                        84.0    4e-15   Oryza sativa Indica Group [Indian rice]
gb|EYU31382.1|  hypothetical protein MIMGU_mgv1a018210mg              84.3    5e-15   Erythranthe guttata [common monkey flower]
gb|EMS35655.1|  LRR receptor-like serine/threonine-protein kinase...  84.3    5e-15   Triticum urartu
gb|AAS48164.1|  LRR protein WM1.10                                    84.3    5e-15   Aegilops tauschii
ref|XP_010087503.1|  Probably inactive leucine-rich repeat recept...  82.0    5e-15   Morus notabilis
gb|KEH16825.1|  LRR receptor-like kinase family protein               84.3    5e-15   Medicago truncatula
gb|EMT19055.1|  LRR receptor-like serine/threonine-protein kinase...  84.3    5e-15   
gb|KDO36276.1|  hypothetical protein CISIN_1g047285mg                 83.6    5e-15   Citrus sinensis [apfelsine]
ref|XP_008349566.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  84.3    5e-15   
ref|XP_010908803.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    5e-15   
gb|EMT24091.1|  LRR receptor-like serine/threonine-protein kinase...  84.3    5e-15   
gb|EMT21339.1|  DNA-damage-repair/toleration protein                  81.3    6e-15   
ref|XP_009405127.1|  PREDICTED: probable leucine-rich repeat rece...  84.3    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB26099.1|  hypothetical protein B456_004G225800                  84.0    6e-15   Gossypium raimondii
gb|EMT27475.1|  Lysyl-tRNA synthetase                                 84.3    6e-15   
gb|EEC68364.1|  hypothetical protein OsI_36499                        84.0    6e-15   Oryza sativa Indica Group [Indian rice]
gb|EMS60635.1|  LRR receptor-like serine/threonine-protein kinase...  84.0    6e-15   Triticum urartu
gb|ABA94303.1|  Leucine Rich Repeat family protein                    84.0    7e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009378842.1|  PREDICTED: probable LRR receptor-like serine...  84.0    7e-15   Pyrus x bretschneideri [bai li]
gb|EYU31380.1|  hypothetical protein MIMGU_mgv1a023932mg              84.0    7e-15   Erythranthe guttata [common monkey flower]
gb|EMT24090.1|  Somatic embryogenesis receptor kinase 1               80.1    8e-15   
ref|XP_004513677.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    8e-15   
ref|XP_009398960.1|  PREDICTED: LRR receptor-like serine/threonin...  84.0    8e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006490686.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    8e-15   
ref|XP_009346363.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    8e-15   
ref|XP_008362832.1|  PREDICTED: probable LRR receptor-like serine...  83.6    8e-15   
ref|XP_011080440.1|  PREDICTED: probable LRR receptor-like serine...  83.6    8e-15   Sesamum indicum [beniseed]
ref|XP_009375612.1|  PREDICTED: probable LRR receptor-like serine...  83.6    8e-15   
emb|CAN63882.1|  hypothetical protein VITISV_002032                   83.6    9e-15   Vitis vinifera
ref|XP_009389804.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    9e-15   
gb|EMT32765.1|  LRR receptor-like serine/threonine-protein kinase...  83.6    9e-15   
ref|XP_007030467.1|  Disease resistance family protein / LRR fami...  83.6    9e-15   
ref|XP_010249615.1|  PREDICTED: probable leucine-rich repeat rece...  83.6    9e-15   Nelumbo nucifera [Indian lotus]
ref|XP_011462016.1|  PREDICTED: LRR receptor-like serine/threonin...  83.6    1e-14   Fragaria vesca subsp. vesca
gb|EMS47944.1|  LRR receptor-like serine/threonine-protein kinase...  83.6    1e-14   Triticum urartu
ref|XP_009378848.1|  PREDICTED: uncharacterized protein LOC103967297  84.0    1e-14   
emb|CBI22733.3|  unnamed protein product                              82.8    1e-14   Vitis vinifera
ref|XP_009362742.1|  PREDICTED: probable LRR receptor-like serine...  83.6    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_010662661.1|  PREDICTED: LRR receptor-like serine/threonin...  82.8    1e-14   Vitis vinifera
ref|XP_007035263.1|  Disease resistance family protein / LRR fami...  83.2    1e-14   
gb|AGO64661.1|  receptor-like protein                                 83.2    1e-14   Pyrus communis
ref|XP_011091762.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  83.2    1e-14   
ref|XP_010920367.1|  PREDICTED: receptor-like protein 12              83.2    1e-14   
ref|XP_008375192.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    1e-14   Malus domestica [apple tree]
ref|XP_010908117.1|  PREDICTED: probable leucine-rich repeat rece...  83.2    1e-14   Elaeis guineensis
ref|NP_001068100.1|  Os11g0558900                                     83.2    1e-14   
gb|AEQ27754.1|  receptor-like protein                                 83.2    1e-14   Malus sieversii
ref|XP_010646026.1|  PREDICTED: leucine-rich repeat receptor-like...  82.4    1e-14   
gb|KDO36772.1|  hypothetical protein CISIN_1g041155mg                 82.0    1e-14   Citrus sinensis [apfelsine]
ref|XP_010646954.1|  PREDICTED: receptor-like protein 12              82.0    1e-14   
ref|XP_009781238.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    1e-14   Nicotiana sylvestris
ref|XP_008361472.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    1e-14   
ref|XP_003634127.2|  PREDICTED: LRR receptor-like serine/threonin...  82.8    1e-14   Vitis vinifera
ref|XP_009347195.1|  PREDICTED: leucine-rich repeat receptor-like...  82.8    1e-14   
emb|CAN75074.1|  hypothetical protein VITISV_026259                   82.0    1e-14   Vitis vinifera
ref|XP_002268170.2|  PREDICTED: probable LRR receptor-like serine...  82.8    2e-14   Vitis vinifera
gb|AEQ27749.1|  receptor-like protein                                 82.8    2e-14   Malus micromalus [Kaido crab apple]
ref|XP_009368771.1|  PREDICTED: receptor-like protein kinase 5        82.0    2e-14   Pyrus x bretschneideri [bai li]
gb|AEQ27756.1|  receptor-like protein                                 82.8    2e-14   Malus domestica [apple tree]
ref|XP_007038269.1|  Disease resistance family protein / LRR fami...  82.8    2e-14   
gb|EMT13342.1|  LRR receptor-like serine/threonine-protein kinase...  82.8    2e-14   
ref|XP_007144181.1|  hypothetical protein PHAVU_007G135200g           82.8    2e-14   Phaseolus vulgaris [French bean]
ref|XP_008344651.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  82.8    2e-14   
ref|XP_006490687.1|  PREDICTED: probable LRR receptor-like serine...  82.4    2e-14   Citrus sinensis [apfelsine]
ref|XP_002273824.2|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-14   Vitis vinifera
ref|XP_007021417.1|  Disease resistance family protein / LRR fami...  82.4    2e-14   
ref|XP_006422087.1|  hypothetical protein CICLE_v10007014mg           82.4    2e-14   
gb|ABA94322.1|  Leucine Rich Repeat family protein                    82.4    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389805.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-14   
gb|ACJ03067.1|  AL07-2p                                               82.4    2e-14   Malus floribunda [Japanese crab apple]
ref|XP_009355277.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-14   
gb|KGN50335.1|  hypothetical protein Csa_5G168740                     82.4    2e-14   Cucumis sativus [cucumbers]
ref|XP_009405129.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010650370.1|  PREDICTED: polygalacturonase inhibitor-like      79.7    2e-14   
gb|ABI15898.1|  predicted leucine rich repeat protein                 82.4    2e-14   Triticum dicoccoides [wild emmer wheat]
ref|XP_009352122.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-14   Pyrus x bretschneideri [bai li]
ref|XP_003631327.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-14   Vitis vinifera
ref|XP_004143731.1|  PREDICTED: receptor-like protein 12-like         82.4    2e-14   
ref|XP_008461894.1|  PREDICTED: probable leucine-rich repeat rece...  82.4    2e-14   Cucumis melo [Oriental melon]
ref|XP_008357614.1|  PREDICTED: receptor-like protein kinase 2        82.4    2e-14   
ref|XP_011470503.1|  PREDICTED: receptor-like protein 12              79.3    2e-14   Fragaria vesca subsp. vesca
ref|XP_008375200.1|  PREDICTED: LRR receptor-like serine/threonin...  82.4    2e-14   
gb|KJB45948.1|  hypothetical protein B456_007G339900                  82.4    2e-14   Gossypium raimondii
ref|XP_008779843.1|  PREDICTED: probable LRR receptor-like serine...  80.1    2e-14   Phoenix dactylifera
ref|XP_009344462.1|  PREDICTED: probably inactive leucine-rich re...  81.3    2e-14   
gb|ACJ03066.1|  M18S-3Ap                                              82.0    3e-14   Malus floribunda [Japanese crab apple]
gb|EAY92836.1|  hypothetical protein OsI_14636                        81.6    3e-14   Oryza sativa Indica Group [Indian rice]
gb|EYU35923.1|  hypothetical protein MIMGU_mgv1a024353mg              82.0    3e-14   Erythranthe guttata [common monkey flower]
dbj|BAJ93154.1|  predicted protein                                    82.0    3e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008343845.1|  PREDICTED: probable LRR receptor-like serine...  82.0    3e-14   
ref|XP_010911118.1|  PREDICTED: probable LRR receptor-like serine...  82.0    3e-14   
ref|XP_006475187.1|  PREDICTED: LRR receptor-like serine/threonin...  82.0    3e-14   Citrus sinensis [apfelsine]
gb|KCW65806.1|  hypothetical protein EUGRSUZ_G03161                   82.0    3e-14   Eucalyptus grandis [rose gum]
emb|CBI40047.3|  unnamed protein product                              81.6    3e-14   
ref|XP_009370731.1|  PREDICTED: polygalacturonase inhibitor 2-like    80.9    3e-14   
ref|XP_010656643.1|  PREDICTED: uncharacterized protein LOC104880714  82.0    3e-14   
ref|XP_008776421.1|  PREDICTED: receptor-like protein 12              81.3    4e-14   
ref|XP_003631328.1|  PREDICTED: probable leucine-rich repeat rece...  81.6    4e-14   
gb|AAS48162.1|  LRR protein WM1.2                                     81.6    4e-14   
ref|XP_008218771.1|  PREDICTED: receptor-like protein 12              81.6    4e-14   
dbj|BAJ89112.1|  predicted protein                                    81.6    4e-14   
ref|XP_010046671.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    4e-14   
gb|KCW86895.1|  hypothetical protein EUGRSUZ_B03478                   81.6    4e-14   
gb|KDO52973.1|  hypothetical protein CISIN_1g036642mg                 81.6    4e-14   
gb|KDO40442.1|  hypothetical protein CISIN_1g048006mg                 81.6    4e-14   
ref|XP_006475198.1|  PREDICTED: brassinosteroid LRR receptor kina...  81.6    4e-14   
gb|KJB45913.1|  hypothetical protein B456_007G3374001                 80.9    4e-14   
gb|EMS54105.1|  LRR receptor-like serine/threonine-protein kinase...  81.6    4e-14   
gb|EMS55248.1|  LRR receptor-like serine/threonine-protein kinase...  81.6    4e-14   
ref|XP_009362749.1|  PREDICTED: probable LRR receptor-like serine...  81.6    4e-14   
ref|XP_006450003.1|  hypothetical protein CICLE_v10027645mg           81.6    4e-14   
ref|XP_002273399.2|  PREDICTED: probable leucine-rich repeat rece...  81.6    4e-14   
ref|XP_008245284.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    4e-14   
ref|XP_004301719.2|  PREDICTED: LRR receptor-like serine/threonin...  81.3    5e-14   
ref|XP_003633782.1|  PREDICTED: receptor-like protein 12              81.3    5e-14   
dbj|BAJ98786.1|  predicted protein                                    81.3    5e-14   
gb|EMT08468.1|  LRR receptor-like serine/threonine-protein kinase...  81.6    5e-14   
gb|EMS67398.1|  Receptor-like protein 12                              81.3    5e-14   
ref|XP_003633783.1|  PREDICTED: probable leucine-rich repeat rece...  81.3    6e-14   
gb|AEQ27753.1|  receptor-like protein                                 81.3    6e-14   
ref|XP_007203164.1|  hypothetical protein PRUPE_ppa025012mg           81.3    6e-14   
ref|XP_010111587.1|  LRR receptor-like serine/threonine-protein k...  81.3    6e-14   
emb|CBI22711.3|  unnamed protein product                              81.3    6e-14   
ref|XP_008362544.1|  PREDICTED: receptor-like protein 12              81.3    6e-14   
ref|XP_010655798.1|  PREDICTED: probable leucine-rich repeat rece...  81.3    6e-14   
gb|EMT14344.1|  LRR receptor-like serine/threonine-protein kinase...  80.9    6e-14   
ref|XP_007035259.1|  Disease resistance family protein / LRR fami...  80.9    6e-14   
ref|XP_002444056.1|  hypothetical protein SORBIDRAFT_07g006470        80.9    7e-14   
ref|XP_010671925.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    7e-14   
ref|XP_004974894.1|  PREDICTED: probable LRR receptor-like serine...  80.9    7e-14   
ref|XP_004296198.1|  PREDICTED: probable leucine-rich repeat rece...  80.9    7e-14   
ref|XP_002268246.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    7e-14   
ref|XP_008467299.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  80.9    7e-14   
gb|KJB45896.1|  hypothetical protein B456_007G335800                  80.9    7e-14   
gb|KCW90683.1|  hypothetical protein EUGRSUZ_A02772                   80.9    7e-14   
gb|KCW65803.1|  hypothetical protein EUGRSUZ_G031561                  79.7    7e-14   
ref|XP_010253789.1|  PREDICTED: LRR receptor-like serine/threonin...  80.9    7e-14   
ref|XP_009389802.1|  PREDICTED: leucine-rich repeat receptor-like...  80.9    7e-14   
gb|KEH29508.1|  LRR receptor-like kinase family protein               80.9    7e-14   
gb|EMT29341.1|  Leucine-rich repeat receptor protein kinase EXS       80.9    8e-14   
ref|XP_009385819.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    8e-14   
gb|AEQ27758.1|  receptor-like protein                                 80.9    8e-14   
ref|XP_010671566.1|  PREDICTED: receptor-like protein 12              80.9    8e-14   
gb|EAY85345.1|  hypothetical protein OsI_06723                        80.9    8e-14   
ref|XP_010231989.1|  PREDICTED: probable leucine-rich repeat rece...  80.5    8e-14   
ref|XP_008339523.1|  PREDICTED: leucine-rich repeat receptor-like...  79.7    8e-14   
gb|AEQ27743.1|  receptor-like protein                                 80.5    8e-14   
ref|XP_008377760.1|  PREDICTED: leucine-rich repeat receptor prot...  80.5    8e-14   
gb|AEQ27757.1|  receptor-like protein                                 80.5    8e-14   
gb|KEH25178.1|  LRR receptor-like kinase family protein               80.5    8e-14   
ref|NP_001172451.1|  Os01g0601625                                     80.9    8e-14   
gb|AEQ27745.1|  receptor-like protein                                 80.5    8e-14   
ref|XP_004298186.1|  PREDICTED: probable leucine-rich repeat rece...  80.1    9e-14   
gb|EAY74831.1|  hypothetical protein OsI_02722                        80.5    9e-14   
ref|XP_002450813.1|  hypothetical protein SORBIDRAFT_05g018970        80.1    1e-13   
ref|XP_008232799.1|  PREDICTED: probable leucine-rich repeat rece...  80.1    1e-13   
gb|KJB45958.1|  hypothetical protein B456_007G340200                  80.5    1e-13   
ref|XP_008361473.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    1e-13   
gb|KDO62586.1|  hypothetical protein CISIN_1g035852mg                 80.1    1e-13   
ref|XP_008382520.1|  PREDICTED: LRR receptor-like serine/threonin...  80.1    1e-13   
ref|XP_010671922.1|  PREDICTED: receptor-like protein 12              80.5    1e-13   
gb|EMS49415.1|  LRR receptor-like serine/threonine-protein kinase...  80.1    1e-13   
ref|XP_004507279.1|  PREDICTED: probable leucine-rich repeat rece...  80.1    1e-13   
emb|CBI22739.3|  unnamed protein product                              78.6    1e-13   
ref|XP_009365389.1|  PREDICTED: leucine-rich repeat receptor-like...  77.0    1e-13   
ref|XP_002445768.1|  hypothetical protein SORBIDRAFT_07g025500        80.1    1e-13   
ref|XP_007214021.1|  hypothetical protein PRUPE_ppa016515mg           80.1    1e-13   
gb|KJB45942.1|  hypothetical protein B456_007G339300                  80.1    1e-13   
ref|XP_002276171.1|  PREDICTED: receptor-like protein 12              80.1    1e-13   
ref|XP_003593779.1|  Receptor-like protein kinase                     80.1    1e-13   
gb|EMT07965.1|  LRR receptor-like serine/threonine-protein kinase...  80.1    1e-13   
ref|XP_010908126.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    1e-13   
ref|XP_002453202.1|  hypothetical protein SORBIDRAFT_04g001610        79.7    1e-13   
ref|XP_010671855.1|  PREDICTED: receptor-like protein 12              80.1    1e-13   
ref|XP_010068966.1|  PREDICTED: receptor-like protein 12              80.1    1e-13   
ref|XP_008437709.1|  PREDICTED: LRR receptor-like serine/threonin...  76.3    1e-13   
ref|XP_004980609.1|  PREDICTED: probable leucine-rich repeat rece...  79.7    1e-13   
ref|XP_011467021.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    1e-13   
gb|KJB45956.1|  hypothetical protein B456_007G340000                  79.7    2e-13   
ref|XP_009363262.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    2e-13   
ref|XP_011005452.1|  PREDICTED: receptor-like protein 12 isoform X2   79.7    2e-13   
ref|XP_010266617.1|  PREDICTED: probable LRR receptor-like serine...  79.7    2e-13   
ref|XP_010652089.1|  PREDICTED: probable LRR receptor-like serine...  79.7    2e-13   
ref|XP_010918701.1|  PREDICTED: receptor-like protein 12              79.7    2e-13   
gb|KDP35942.1|  hypothetical protein JCGZ_09914                       79.7    2e-13   
ref|XP_006424167.1|  hypothetical protein CICLE_v10030038mg           79.7    2e-13   
gb|KDO56838.1|  hypothetical protein CISIN_1g0483512mg                76.6    2e-13   
ref|XP_008232926.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    2e-13   
ref|XP_006475195.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    2e-13   
gb|EMS65463.1|  LRR receptor-like serine/threonine-protein kinase...  79.7    2e-13   
gb|KDO52976.1|  hypothetical protein CISIN_1g042359mg                 79.3    2e-13   
ref|XP_010095091.1|  putative LRR receptor-like serine/threonine-...  79.3    2e-13   
ref|XP_008353907.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  79.3    2e-13   
ref|XP_006424163.1|  hypothetical protein CICLE_v10029837mg           79.3    2e-13   
gb|KDO39729.1|  hypothetical protein CISIN_1g044082mg                 76.3    2e-13   
gb|EMT23135.1|  hypothetical protein F775_52148                       79.3    2e-13   
ref|XP_009363364.1|  PREDICTED: LRR receptor-like serine/threonin...  79.3    2e-13   
ref|XP_009362738.1|  PREDICTED: receptor-like protein 12 isoform X1   79.3    2e-13   
ref|XP_002513041.1|  serine-threonine protein kinase, plant-type,...  79.3    2e-13   
gb|EMT03532.1|  LRR receptor-like serine/threonine-protein kinase...  79.3    2e-13   
emb|CDP20351.1|  unnamed protein product                              78.6    2e-13   
ref|XP_008218772.1|  PREDICTED: probably inactive leucine-rich re...  79.0    3e-13   
ref|XP_009362739.1|  PREDICTED: leucine-rich repeat receptor-like...  79.0    3e-13   
gb|EMT15994.1|  LRR receptor-like serine/threonine-protein kinase...  79.0    3e-13   
ref|XP_006490688.1|  PREDICTED: leucine-rich repeat receptor prot...  78.2    3e-13   
ref|XP_008240708.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  79.0    3e-13   
emb|CDP18520.1|  unnamed protein product                              78.6    3e-13   
ref|XP_010910624.1|  PREDICTED: probable LRR receptor-like serine...  78.6    3e-13   
ref|XP_008777497.1|  PREDICTED: receptor-like protein 12              78.6    3e-13   
gb|KEH16828.1|  LRR receptor-like kinase family protein               78.6    3e-13   
ref|XP_008372146.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    3e-13   
emb|CDP21461.1|  unnamed protein product                              78.6    3e-13   
ref|XP_009374463.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    3e-13   
ref|XP_009362690.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    3e-13   
tpg|DAA59209.1|  TPA: hypothetical protein ZEAMMB73_309165            78.6    4e-13   
ref|NP_001062386.1|  Os08g0541300                                     78.6    4e-13   
ref|XP_008794216.1|  PREDICTED: probable leucine-rich repeat rece...  78.6    4e-13   
dbj|BAJ96276.1|  predicted protein                                    78.6    4e-13   
gb|EAZ07831.1|  hypothetical protein OsI_30090                        78.6    4e-13   
ref|XP_008676404.1|  PREDICTED: LRR receptor-like serine/threonin...  78.6    4e-13   
gb|EAZ22557.1|  hypothetical protein OsJ_06223                        78.6    4e-13   
ref|XP_009394664.1|  PREDICTED: probable LRR receptor-like serine...  78.2    4e-13   
gb|KCW64534.1|  hypothetical protein EUGRSUZ_G02136                   78.2    4e-13   
gb|KGN58575.1|  hypothetical protein Csa_3G687760                     78.2    4e-13   
ref|XP_010315437.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  78.6    4e-13   
gb|AAS48163.1|  LLR protein WM1.1                                     78.6    4e-13   
gb|EMS60645.1|  Leucine-rich repeat receptor protein kinase EXS       78.2    5e-13   
ref|XP_006446689.1|  hypothetical protein CICLE_v10017769mg           78.2    5e-13   
gb|EMT18236.1|  LRR receptor-like serine/threonine-protein kinase...  78.2    5e-13   
gb|KCW45179.1|  hypothetical protein EUGRSUZ_L01193                   78.2    5e-13   
ref|XP_009375609.1|  PREDICTED: probable LRR receptor-like serine...  78.2    5e-13   
dbj|BAD21834.1|  putative HcrVf2 protein                              78.2    5e-13   
ref|XP_006368502.1|  hypothetical protein POPTR_0001s03540g           78.2    5e-13   
ref|XP_008372136.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    5e-13   
ref|XP_004149737.1|  PREDICTED: probable LRR receptor-like serine...  78.2    5e-13   
gb|KDO39365.1|  hypothetical protein CISIN_1g047152mg                 78.2    5e-13   
ref|XP_008467327.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    5e-13   
ref|XP_010040481.1|  PREDICTED: probable LRR receptor-like serine...  78.2    5e-13   
gb|KCW45177.1|  hypothetical protein EUGRSUZ_L011922                  77.8    5e-13   
ref|XP_008467326.1|  PREDICTED: probable leucine-rich repeat rece...  78.2    6e-13   
ref|NP_001172894.1|  Os02g0274200                                     78.2    6e-13   
ref|XP_008779794.1|  PREDICTED: probable LRR receptor-like serine...  77.8    6e-13   
gb|KDO58288.1|  hypothetical protein CISIN_1g002600mg                 77.8    6e-13   
gb|KCW64523.1|  hypothetical protein EUGRSUZ_G02124                   77.8    6e-13   
ref|XP_008244919.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    6e-13   
ref|XP_006481843.1|  PREDICTED: receptor-like protein 12-like         78.2    6e-13   
ref|XP_009394656.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    6e-13   
ref|XP_007212841.1|  hypothetical protein PRUPE_ppa020791mg           77.8    6e-13   
ref|XP_009389817.1|  PREDICTED: receptor-like protein 12              77.8    6e-13   
gb|KDP43139.1|  hypothetical protein JCGZ_26672                       77.8    6e-13   
gb|AEQ27755.1|  receptor-like protein                                 77.8    7e-13   
ref|XP_002525057.1|  serine-threonine protein kinase, plant-type,...  77.0    7e-13   
emb|CDM85725.1|  unnamed protein product                              77.8    7e-13   
gb|KHG23131.1|  hypothetical protein F383_28780                       74.3    7e-13   
emb|CDP08516.1|  unnamed protein product                              77.8    7e-13   
gb|KJB45930.1|  hypothetical protein B456_007G338900                  77.8    7e-13   
ref|XP_010910441.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    7e-13   
gb|EMT27505.1|  LRR receptor-like serine/threonine-protein kinase...  77.8    7e-13   
gb|EMS45946.1|  LRR receptor-like serine/threonine-protein kinase...  77.8    7e-13   
gb|KEH29511.1|  LRR receptor-like kinase family protein               77.8    8e-13   
ref|XP_007035258.1|  Disease resistance family protein / LRR fami...  77.8    8e-13   
emb|CBI22623.3|  unnamed protein product                              77.4    8e-13   
ref|XP_004971980.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    8e-13   
ref|XP_010040482.1|  PREDICTED: LOW QUALITY PROTEIN: LRR receptor...  77.4    9e-13   
ref|XP_010033401.1|  PREDICTED: receptor-like protein 12              77.4    9e-13   
gb|EMT13563.1|  LRR receptor-like serine/threonine-protein kinase...  77.4    9e-13   
ref|XP_009387594.1|  PREDICTED: leucine-rich repeat receptor-like...  75.5    9e-13   
gb|KJB45910.1|  hypothetical protein B456_007G3372001                 77.0    9e-13   
ref|XP_009375610.1|  PREDICTED: LRR receptor-like serine/threonin...  77.4    9e-13   
ref|XP_010910632.1|  PREDICTED: probably inactive leucine-rich re...  76.6    1e-12   
emb|CDP18524.1|  unnamed protein product                              76.6    1e-12   
ref|XP_006452201.1|  hypothetical protein CICLE_v10010699mg           74.3    1e-12   
ref|XP_002264905.3|  PREDICTED: LRR receptor-like serine/threonin...  77.0    1e-12   
ref|XP_007152108.1|  hypothetical protein PHAVU_004G103000g           77.0    1e-12   
ref|XP_008222139.1|  PREDICTED: LRR receptor-like serine/threonin...  76.6    1e-12   
ref|XP_002521092.1|  serine-threonine protein kinase, plant-type,...  77.0    1e-12   
ref|XP_009352119.1|  PREDICTED: LRR receptor-like serine/threonin...  76.6    1e-12   
gb|KJB45902.1|  hypothetical protein B456_007G336200                  76.6    1e-12   
gb|AEQ27744.1|  receptor-like protein                                 77.0    1e-12   
ref|XP_010671582.1|  PREDICTED: receptor-like protein 12              77.0    1e-12   
ref|XP_011462017.1|  PREDICTED: probable LRR receptor-like serine...  77.0    1e-12   
gb|AES64024.2|  Serine/Threonine kinase, plant-type protein           77.0    1e-12   
ref|XP_009388219.1|  PREDICTED: LRR receptor-like serine/threonin...  75.5    1e-12   
ref|XP_003636149.1|  Leucine-rich repeat receptor-like protein ki...  76.3    1e-12   
ref|XP_004978847.1|  PREDICTED: LRR receptor-like serine/threonin...  77.0    1e-12   
ref|XP_008346112.1|  PREDICTED: probable leucine-rich repeat rece...  77.0    1e-12   
ref|XP_008240711.1|  PREDICTED: LRR receptor-like serine/threonin...  77.0    1e-12   
emb|CAN68235.1|  hypothetical protein VITISV_037104                   77.4    1e-12   
gb|KDO41879.1|  hypothetical protein CISIN_1g002055mg                 77.0    1e-12   
emb|CAN61943.1|  hypothetical protein VITISV_017886                   77.0    1e-12   
emb|CAN75075.1|  hypothetical protein VITISV_026260                   77.0    1e-12   
ref|XP_008437710.1|  PREDICTED: receptor-like protein 12              77.0    1e-12   
ref|XP_007214523.1|  hypothetical protein PRUPE_ppa015660mg           76.6    1e-12   
gb|KJB72425.1|  hypothetical protein B456_011G177700                  77.0    1e-12   
ref|XP_007214101.1|  hypothetical protein PRUPE_ppa016834mg           77.0    1e-12   
ref|XP_006422089.1|  hypothetical protein CICLE_v10005980mg           73.2    1e-12   
gb|AAS48159.1|  LRR protein WM1.7                                     77.0    1e-12   
ref|XP_007220272.1|  hypothetical protein PRUPE_ppa000998mg           76.6    1e-12   
ref|XP_010662800.1|  PREDICTED: leucine-rich repeat receptor prot...  76.6    2e-12   
gb|EMS56534.1|  Leucine-rich repeat receptor-like protein kinase ...  76.3    2e-12   
gb|KCW65804.1|  hypothetical protein EUGRSUZ_G03159                   76.6    2e-12   
ref|XP_006424157.1|  hypothetical protein CICLE_v10029857mg           76.6    2e-12   
ref|XP_010662625.1|  PREDICTED: LRR receptor-like serine/threonin...  75.1    2e-12   
emb|CDP16273.1|  unnamed protein product                              76.6    2e-12   
ref|XP_011005467.1|  PREDICTED: putative leucine-rich repeat rece...  76.3    2e-12   
emb|CDO98599.1|  unnamed protein product                              76.6    2e-12   
ref|XP_008244921.1|  PREDICTED: probable LRR receptor-like serine...  76.6    2e-12   
gb|EMT01934.1|  LRR receptor-like serine/threonine-protein kinase...  76.6    2e-12   
gb|EEC68374.1|  hypothetical protein OsI_36512                        76.3    2e-12   
gb|KEH16822.1|  LRR receptor-like kinase family protein               76.6    2e-12   
ref|XP_009355439.1|  PREDICTED: receptor-like protein 12              76.3    2e-12   
ref|XP_007224766.1|  hypothetical protein PRUPE_ppa024081mg           76.3    2e-12   
gb|ACJ03073.1|  HB09p                                                 76.6    2e-12   
ref|XP_009394674.1|  PREDICTED: receptor-like protein 12              76.6    2e-12   



>gb|EEE54949.1| hypothetical protein OsJ_02519 [Oryza sativa Japonica Group]
Length=913

 Score =   109 bits (273),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 77/181 (43%), Positives = 97/181 (54%), Gaps = 10/181 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-------GLE  160
            ER ALLSFK  +++DPL  L SW    DCC+W GVGC N  TGHVV L L          
Sbjct  41   ERAALLSFKEGVMADPLRLLDSWQGAGDCCRWNGVGCSN-RTGHVVKLDLRNTLYWDDQR  99

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNN  340
             +  D P    G +   +             +        IPSF+GSL +LVYL+LS  +
Sbjct  100  QVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESLVYLNLSCID  159

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
             FG VP  LGN+S L YLD+G+ +  GQ       L W+  LSSL+YL+M GV+L  VSD
Sbjct  160  FFGEVPTQLGNLSRLSYLDVGSMYYSGQIFS--SDLSWLGRLSSLKYLDMSGVNLSMVSD  217

Query  521  W  523
            W
Sbjct  218  W  218



>dbj|BAD52658.1| HcrVf2 protein-like [Oryza sativa Japonica Group]
Length=1064

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 97/181 (54%), Gaps = 10/181 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLG-------LE  160
            ER ALLSFK  +++DPL  L SW    DCC+W GVGC N  TGHVV L L          
Sbjct  41   ERAALLSFKEGVMADPLRLLDSWQGAGDCCRWNGVGCSN-RTGHVVKLDLRNTLYWDDQR  99

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNN  340
             +  D P    G +   +             +        IPSF+GSL +LVYL+LS  +
Sbjct  100  QVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESLVYLNLSCID  159

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
             FG VP  LGN+S L YLD+G+ +  GQ       L W+  LSSL+YL+M GV+L  VSD
Sbjct  160  FFGEVPTQLGNLSRLSYLDVGSMYYSGQIFS--SDLSWLGRLSSLKYLDMSGVNLSMVSD  217

Query  521  W  523
            W
Sbjct  218  W  218



>ref|XP_008807618.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Phoenix dactylifera]
Length=1048

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 85/174 (49%), Positives = 104/174 (60%), Gaps = 13/174 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKALL FK  +        S  G +  CC+W+GV CDN  TG V+ + L  +     GP
Sbjct  39   ERKALLQFKSGLSDPENRLSSWQGRN--CCRWRGVSCDN-QTGFVIGIDLQNQHPKDFGP  95

Query  182  PCYP--GL--LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNL  343
                  G   L G + PSLL L  L  LDLS+N FE  RIP FIGSLNNL YLDLS    
Sbjct  96   VSNSRNGFWNLSGRVDPSLLQLKSLRHLDLSYNTFEGIRIPEFIGSLNNLRYLDLSNAGF  155

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL  505
             G +PP LGN+S L+YLD+ +NF     L +VD+ +WI+ LSSL +L MDGVDL
Sbjct  156  VGTIPPRLGNLSRLQYLDLSSNF----QLLMVDSFQWITGLSSLVHLAMDGVDL  205



>gb|EEC71039.1| hypothetical protein OsI_02753 [Oryza sativa Indica Group]
Length=671

 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 95/181 (52%), Gaps = 10/181 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-------GLE  160
            E  ALLSFK  +++DPL  L SW    DC +W GVGC N  TGHVV L L          
Sbjct  41   EWAALLSFKEGVMADPLRLLDSWQGAGDCYRWNGVGCSN-RTGHVVKLDLRNTLYWDDQR  99

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNN  340
             +  D P    G +   +             +        IPSF+GSL +LVYL+LS  +
Sbjct  100  QVRLDNPHAMRGQVSTSLLALRRLKYLYLSGNNLGGPGIAIPSFLGSLESLVYLNLSCID  159

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
             FG VP  LGN+S L YLD+G+ +  GQ       L W+  LSSL+YL+M GV+L  VSD
Sbjct  160  FFGEVPTQLGNLSRLSYLDVGSMYYSGQIFS--SDLSWLGRLSSLKYLDMSGVNLSMVSD  217

Query  521  W  523
            W
Sbjct  218  W  218



>ref|XP_009405134.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=953

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 112/174 (64%), Gaps = 12/174 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+FK + I DP   LSSW    DCC+W GV CD+ +TGHVV L+L   G  T   
Sbjct  9    ERDALLAFK-AGIDDPSHRLSSWRRRVDCCRWSGVVCDD-STGHVVQLNLQNAGNMTF--  64

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L+GEI PSL+ L  L+ LDL+ NDFE  RIP+F+GS   L YLDLS++N  G +
Sbjct  65   ESVEAALRGEISPSLISLTHLDRLDLNHNDFEGSRIPAFLGSFPKLRYLDLSWSNFSGAI  124

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            PP LGN+SSL+YLD     +   DL   D L+W+S LSSL YL+M GV+L + S
Sbjct  125  PPQLGNLSSLRYLD-----LRSYDL-TTDGLDWLSRLSSLRYLDMSGVNLSTAS  172



>ref|XP_008218761.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Prunus mume]
Length=894

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 110/176 (63%), Gaps = 16/176 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FKH +        SS G+ D CC W GV CDN+T GHV+ LHL        G 
Sbjct  36   ERRALLKFKHDLEDPSNQLSSSAGEGD-CCNWAGVVCDNLT-GHVLELHLA-------GY  86

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
              +     G+I PSLL+L  L +LDLS N FE  +IPSF+GSL +L YL+LSY++  G +
Sbjct  87   MPFTPSFSGKINPSLLNLTHLTYLDLSNNHFEGMQIPSFLGSLKSLRYLNLSYSSFVGLI  146

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN++SL+ LD+G+        + V++L+WIS LS L++L+M G +L   SDW
Sbjct  147  PHQLGNLTSLQVLDLGD-----YSEREVESLQWISGLSQLQHLDMSGANLSKASDW  197



>ref|XP_008775355.1| PREDICTED: receptor-like protein 12 [Phoenix dactylifera]
Length=987

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 102/177 (58%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-GLEGLCTDG  178
            ER ALL FK        +   +    DDCC+W+GV C N TTGHV+ L L   + L  DG
Sbjct  30   ERNALLGFK--ANIRDPTKKLASWVGDDCCQWRGVHCSN-TTGHVIQLDLHNPQPLNYDG  86

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
             P Y G L GEI PSLL L  L++LDLS N      IP FI SL  L Y++ S     G 
Sbjct  87   SPDYSGSLGGEINPSLLGLEHLSYLDLSLNYFVGASIPKFISSLKELTYINFSRAGFTGI  146

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP LGN+SSL++LD+             D ++WIS LSSL YLNM GV+L SV++W
Sbjct  147  IPPELGNLSSLRHLDL----YSLTPALYADDVQWISSLSSLRYLNMGGVNLISVTNW  199



>ref|XP_010918709.1| PREDICTED: receptor-like protein 12 [Elaeis guineensis]
Length=989

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 105/177 (59%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-GLEGLCTDG  178
            ER ALL FK        ++  +    DDCC+W+GV C N TTGHVV L L   + L  DG
Sbjct  30   ERDALLGFK--AGIKDPTNKLASWVGDDCCQWRGVHCSN-TTGHVVQLDLHNPQPLNYDG  86

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
             P Y G L GEI PSLL L  L++LDLS N      IP FIGSL  L Y++ S  +  G 
Sbjct  87   SPDYSGSLSGEINPSLLGLEHLSYLDLSLNYFVGATIPKFIGSLKELTYINFSRASFAGI  146

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP LGN+S+L +LD+   +     L   D ++WIS LSSL YLNM GV+L SV+ W
Sbjct  147  IPPELGNLSNLHHLDL---YSLAPTLYAKD-VQWISSLSSLRYLNMGGVNLISVTSW  199


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 6/80 (8%)
 Frame = +2

Query  275  ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEW  454
            E +P ++G+L NL  LDLS NNL+G++P  +G +SSL+ L +  N ++G         E 
Sbjct  349  EPLPDWLGNLKNLKTLDLSSNNLYGSIPASIGRMSSLQNLYLAQNGLNGT------VSES  402

Query  455  ISYLSSLEYLNMDGVDLHSV  514
            I  LS LEYL++    L +V
Sbjct  403  IGQLSKLEYLDLSFNPLKTV  422



>ref|XP_010249628.1| PREDICTED: receptor-like protein 12 [Nelumbo nucifera]
Length=906

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 101/177 (57%), Gaps = 17/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ERKALL+ K           S    + +DCC+WKGVGCDN  TGHVV L L    L    
Sbjct  35   ERKALLNLKKGFKDPSNWLSSWDSNNREDCCRWKGVGCDN-RTGHVVQLKLRGSILIRS-  92

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGN  352
                   L GEI   LL L  L +LDLS N+FE  +IP F+GSL  L YL+LS +   G 
Sbjct  93   -------LSGEINHHLLELKHLRYLDLSGNEFEGNQIPDFLGSLQKLRYLNLSNSGFGGV  145

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP  GN+SSL+YLD+   F +  +   VD L W+S LSSL YL+M+ VDL    DW
Sbjct  146  IPPQFGNLSSLRYLDL--RFCNALN---VDNLHWVSRLSSLRYLDMNSVDLRLAHDW  197



>ref|XP_010662668.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Vitis vinifera]
Length=412

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 102/176 (58%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALLSFK  I        S   ++  CC W+GV C N TTGHV+ L+L  +       
Sbjct  39   EREALLSFKRGIHDPSNRLSSWASEE--CCNWEGVCCHN-TTGHVLKLNLRWD------L  89

Query  182  PCYPGLLQGEIxpsllhlpflnfldls--fndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
              Y G L GEI  SLL L  L +LDLS        IP F+GSL+NL YL+LS  +  G +
Sbjct  90   YQYHGSLGGEISSSLLDLKHLQYLDLSCNDFGSLNIPKFLGSLSNLRYLNLSTASFGGVI  149

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S L YLDIGN++ D ++    + LEWIS  S L++L+M  V+L   S+W
Sbjct  150  PHQLGNLSKLHYLDIGNSYYDHRNSLNAEDLEWISSFSFLKFLDMTNVNLSKTSNW  205



>ref|XP_006600047.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790-like [Glycine max]
Length=272

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DAP  87

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  88   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  199



>ref|XP_002458109.1| hypothetical protein SORBIDRAFT_03g027070 [Sorghum bicolor]
 gb|EES03229.1| hypothetical protein SORBIDRAFT_03g027070 [Sorghum bicolor]
Length=982

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 116/179 (65%), Gaps = 18/179 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+F+ + +SDP + LSSWG+ D+CCKWKGV C N TTGHVV L L        GP
Sbjct  42   ERSALLAFR-AGLSDPANRLSSWGEGDNCCKWKGVQCSN-TTGHVVKLDL-------QGP  92

Query  182  P---CYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLF  346
                C   +L G I  SL+ L  L +LDLS N F   +IP F+GSL+ L YLDLS ++L 
Sbjct  93   DYYNCVKQVLGGNISSSLVALQHLQYLDLSCNRFSMVKIPEFLGSLHELRYLDLSMSSLV  152

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G +PP LGN+S+L+Y+++ + F D     +     W+S LSSLE+L+M  V+L ++++W
Sbjct  153  GRIPPQLGNLSNLRYMNLDSIFGDTHSTDIT----WLSRLSSLEHLDMSWVNLSTITNW  207



>ref|XP_007024895.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY27517.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=992

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 7/176 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E+KALL FK S+        S  G+D  CC+W GV C +  TG V  L L    L T+  
Sbjct  37   EKKALLVFKESLTDPFGRLSSWVGED--CCQWHGVSCKS-ETGQVTKLDLR-NSLQTNKA  92

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L+G+I  SLL+L  L +LDLS N+FE   IP  IGSL  L YL+LSY  L G++
Sbjct  93   AQKKSALRGKINSSLLNLKNLRYLDLSMNNFEGSPIPQVIGSLRTLSYLNLSYAQLGGSI  152

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PPHLGN+S+L+YLD+ +++ D     +   L W+  L SLEYL+M GVDL +V+DW
Sbjct  153  PPHLGNLSNLQYLDL-HSYSDSSSKLIATDLLWLRGLPSLEYLDMGGVDLSAVTDW  207



>ref|XP_010646018.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
Length=467

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 91/148 (61%), Gaps = 16/148 (11%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC WKG+GCDNIT  HVV ++L  E       P     L G+I  SLL L  L +LDLS+
Sbjct  67   CCSWKGIGCDNITR-HVVKINLSCE-------PMEGASLGGDISTSLLDLNHLQYLDLSW  118

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N FE  +IP F+GSL  L YL+LS   L G+VP  LG  SSL+YLDIG   +D ++    
Sbjct  119  NSFEGLQIPEFLGSLTGLRYLNLSNAGLTGDVPRQLGKQSSLQYLDIGGISLDTKN----  174

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              L+WIS LS LE L+M  VDL+  S+W
Sbjct  175  --LDWISSLSVLEVLDMSWVDLNKASNW  200



>ref|XP_004958856.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Setaria italica]
Length=965

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 105/182 (58%), Gaps = 13/182 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            ER ALLSFK  I  D  + L+SW   D CCKW GV C +  TG V+ L L  E   TD  
Sbjct  50   ERAALLSFKKGITIDITNRLASWHGRD-CCKWTGVRCSSNETGRVLELRLRNEK--TDLH  106

Query  176  -GPPCYP-GLLQGEIxpsllhlpflnfldls----fndfERIPSFIGSLNNLVYLDLSYN  337
              P C     L GEI  SLLHL  L  +DLS        + IPSF+GS+ NL YL+LS+ 
Sbjct  107  RVPACEDDNALSGEISSSLLHLEQLEHMDLSGNCLVEYGKNIPSFLGSMKNLRYLNLSFI  166

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
              FG VPP LGN+S L+YLD+G  F D   +K    + W+  L SL++L+M  V+L  +S
Sbjct  167  PSFGEVPPQLGNLSRLQYLDLG--FNDPYSMKYSSDITWLKNLHSLQHLSMRHVNLSQIS  224

Query  518  DW  523
            DW
Sbjct  225  DW  226


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +2

Query  281  IPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWIS  460
            +P+  G+  NL+ LDLS NNL G++PP LG +SSL  L +GNN ++G    + + +  ++
Sbjct  387  LPNLTGNFTNLIILDLSANNLIGSIPPELGYLSSLTALHLGNNHLNG---TIPNKIGALT  443

Query  461  YLSSLEYLN  487
             L+SL+  N
Sbjct  444  NLTSLDLSN  452



>gb|KCW62328.1| hypothetical protein EUGRSUZ_H049701, partial [Eucalyptus grandis]
Length=267

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 96/181 (53%), Gaps = 13/181 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+  +I       S    D  CC+WKGV C    TGHV  L L     C   P
Sbjct  38   EREALLKFRQGLIDHSKRLSSWTNKD--CCEWKGVKCSK-KTGHVFKLDLR-NPFCETFP  93

Query  182  PCY-----PGLLQGEIxpsllhlpflnf--ldlsfndfERIPSFIGSLNNLVYLDLSYNN  340
              Y        L G+I  SL  L  L +  L L+    ++ P F G+L  L YL+LS+  
Sbjct  94   DGYDSCSDESRLAGKIHASLAELKHLKYLDLSLNEFSKQKTPQFFGTLPRLEYLNLSFAG  153

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
              GN+P HLGN+S+L+YLD+ N F DG D    D L+W+S LSSL+Y ++    L + +D
Sbjct  154  FDGNIPRHLGNLSNLQYLDLTNGF-DG-DYLTTDNLQWVSKLSSLKYFHLSHAYLRNATD  211

Query  521  W  523
            W
Sbjct  212  W  212



>ref|XP_002274461.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=953

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 104/176 (59%), Gaps = 18/176 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKAL  FK  ++       S  G+   CC WKG+GCDNIT  HVV ++L    +  DG 
Sbjct  41   ERKALHRFKQGLVDQGNYLSSWTGEA--CCSWKGIGCDNITR-HVVKINLSRNPM--DGA  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L GEI  SLL L  L +LDLS+N FE  +IP F+GSL  L YL+LS     G+V
Sbjct  96   S-----LGGEISTSLLDLKHLQYLDLSWNSFEGLQIPEFLGSLTGLRYLNLSNAGFTGDV  150

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+ SL+YLDIG N ++      ++ L+WIS LS LE L+M  VDL   S+W
Sbjct  151  PRQLGNLLSLQYLDIGGNSLN------IENLDWISPLSVLEVLDMSWVDLSKASNW  200



>ref|XP_007030466.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY10968.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=1163

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 108/188 (57%), Gaps = 20/188 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FKH +I    S  S   GD +DCC+W GV CDN  TGHV  L LGL       
Sbjct  209  ERQALLKFKHDLIDHSNSLSSWVEGDQEDCCRWVGVLCDN-RTGHVYELQLGLLSSSPHE  267

Query  179  PPCYPG-----------LLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVY  319
            P   P             L G+I PSLL L  L+FLDLS NDF   +IP FIGSL +L Y
Sbjct  268  PKPAPDHPKWIVAYDRPKLGGKINPSLLDLKHLSFLDLSNNDFGGIQIPEFIGSLKSLTY  327

Query  320  LDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGV  499
            L+LS  N  G +P  LGN+S L YLD+G+N      L    TL+W+S L SL+YL++  V
Sbjct  328  LNLSGANFGGAIPHQLGNLSKLHYLDLGHN-----SLSEAKTLQWVSGLPSLQYLDLSQV  382

Query  500  DLHSVSDW  523
            DL   +DW
Sbjct  383  DLSKATDW  390



>ref|XP_009348759.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=944

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 93/148 (63%), Gaps = 11/148 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC W GV C N+T GHV  LHL       D       +L G++ PSLL+L  L+ LDLS 
Sbjct  61   CCNWTGVACSNLT-GHVRELHLAG---YYDEVTGEEHMLGGKVNPSLLNLKHLSHLDLSI  116

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N+FE  +IPSF+GSL  L YLDLSY    G +P  LGN+SSL+YL++  NF+      +V
Sbjct  117  NNFEGLQIPSFLGSLKRLRYLDLSYARFHGTIPHQLGNLSSLRYLNLSGNFV-----LMV  171

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            + LEW+S LS L++L+M  VDL + S W
Sbjct  172  ENLEWLSRLSMLKHLDMSDVDLTNTSHW  199



>gb|KCW64528.1| hypothetical protein EUGRSUZ_G02130 [Eucalyptus grandis]
Length=909

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 96/179 (54%), Gaps = 11/179 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+  +I       S    D  CC+WKGV C   TTGHV  L L      TD P
Sbjct  38   EREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVECSK-TTGHVFKLDLRNPCFETD-P  93

Query  182  PCY---PGLLQGEIxpsllhlpflnfl--dlsfndfERIPSFIGSLNNLVYLDLSYNNLF  346
              Y      L G+I  SL  L  L +L   L+    ++IP F G+L  L YL+LS     
Sbjct  94   DGYCLNKSSLAGQIHASLAELKHLKYLDLSLNNFSKQKIPQFFGTLQRLEYLNLSSAGFD  153

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            GN+P HLGN+S+L+Y+D+ N F  G+     D L+W+S LSSL+Y  +  +DL    DW
Sbjct  154  GNIPHHLGNLSNLQYMDLANEF--GKGYLTSDNLQWVSKLSSLKYFLLTVIDLRKAKDW  210



>ref|XP_010068694.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like 
[Eucalyptus grandis]
Length=974

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 94/182 (52%), Gaps = 15/182 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+  ++       S    D  CC+WKGV C    TGHV    L L   C +  
Sbjct  38   EREALLKFRQGLVDQSKRLSSWTSKD--CCEWKGVECSK-KTGHV--FKLDLRNPCFETS  92

Query  182  P-----CYP-GLLQGEIxpsllhlpfln--fldlsfndfERIPSFIGSLNNLVYLDLSYN  337
            P     C     L G+I  SL  L  L    L  +     +IP F GSL  L YL+LS  
Sbjct  93   PDGYISCLDNSSLAGKIHASLAELKHLKYLDLSFNKFSKPKIPQFFGSLQRLEYLNLSSA  152

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
               GN+P HL N+S+L+YLD+ N F  G+     D L+W+S LSSL+Y N+ G+DL   +
Sbjct  153  GFDGNIPHHLSNLSNLQYLDLANEF--GEGYLTSDNLQWVSKLSSLKYFNLAGIDLWKAN  210

Query  518  DW  523
            DW
Sbjct  211  DW  212



>emb|CDP12881.1| unnamed protein product [Coffea canephora]
Length=881

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 100/153 (65%), Gaps = 9/153 (6%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLG-----LEGLCTDGPPCYPGLLQGEIxpsllhlpflnf  250
            CC+WKGV C+N  TG+VV L L      L G   D     P  + G+I  SLL L  LN+
Sbjct  66   CCRWKGVSCNN-QTGNVVKLDLRSYGCYLNGGQDDPSNLNPSCMSGKISSSLLDLKHLNY  124

Query  251  ldlsfndfER--IPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQ  424
            LDLS N+F+   +P F+GSL+ L YLDLSY+N  G VPPHLGN+S+L+YLD+ +N ++  
Sbjct  125  LDLSMNNFQNNPVPEFLGSLDELSYLDLSYSNFAGLVPPHLGNLSNLRYLDLSSNSLNSS  184

Query  425  DLKV-VDTLEWISYLSSLEYLNMDGVDLHSVSD  520
               + +  L WI++L+SLEYLN+  V+L  VSD
Sbjct  185  QPGIWIADLSWITHLTSLEYLNLGFVNLSMVSD  217



>ref|XP_010646028.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Vitis vinifera]
Length=691

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 91/148 (61%), Gaps = 16/148 (11%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC WKG+GCDNIT  HVV ++L  E       P     L G+I  SLL L  L +LDLS+
Sbjct  67   CCSWKGIGCDNITR-HVVKINLSCE-------PMEGASLGGDISTSLLDLNHLQYLDLSW  118

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N FE  +IP F+GSL  L YL+LS   L G+VP  LG  SSL+YLDIG   +D ++    
Sbjct  119  NSFEGLQIPEFLGSLTGLRYLNLSNAGLTGDVPRQLGKQSSLQYLDIGGISLDTEN----  174

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              L+WIS LS LE L+M  VDL+  S+W
Sbjct  175  --LDWISSLSVLEVLDMSWVDLNKASNW  200



>ref|XP_003621481.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES77699.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=926

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLG---LEGLCT  172
            ER ALL FKH +     S  S    DD CC+W GV C+N+T G V+ L L     E +  
Sbjct  34   ERNALLRFKHGLSDPSKSLSSWSAADD-CCRWMGVRCNNMT-GRVMELDLTPLDFEYMEL  91

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
             G    P LL+       L       L L++    +IPSF GS+  L YLDLSY+   G 
Sbjct  92   SGE-ISPSLLE-------LKYLIRLDLSLNYFVHTKIPSFFGSMERLTYLDLSYSGFMGL  143

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+LKYL++G N+        +D L+WI+ L SLE+L++ GVDL++ ++W
Sbjct  144  IPHQLGNLSNLKYLNLGYNYA-----LQIDNLDWITKLPSLEHLDLSGVDLYNETNW  195



>gb|KCW64519.1| hypothetical protein EUGRSUZ_G02120 [Eucalyptus grandis]
Length=969

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 94/182 (52%), Gaps = 15/182 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+  ++       S    D  CC+WKGV C    TGHV    L L   C +  
Sbjct  38   EREALLKFRQGLVDQSKRLSSWTSKD--CCEWKGVECSK-KTGHV--FKLDLRNPCFETS  92

Query  182  P-----CYP-GLLQGEIxpsllhlpfln--fldlsfndfERIPSFIGSLNNLVYLDLSYN  337
            P     C     L G+I  SL  L  L    L  +     +IP F GSL  L YL+LS  
Sbjct  93   PDGYISCLDNSSLAGKIHASLAELKHLKYLDLSFNKFSKPKIPQFFGSLQRLEYLNLSSA  152

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
               GN+P HL N+S+L+YLD+ N F  G+     D L+W+S LSSL+Y N+ G+DL   +
Sbjct  153  GFDGNIPHHLSNLSNLQYLDLANEF--GEGYLTSDNLQWVSKLSSLKYFNLAGIDLWKAN  210

Query  518  DW  523
            DW
Sbjct  211  DW  212



>gb|KCW64345.1| hypothetical protein EUGRSUZ_G019722, partial [Eucalyptus grandis]
Length=588

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 100/182 (55%), Gaps = 15/182 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG-  178
            ER+ALL FKH +        S  G++  CCKW+GV C N  TGHV  L L L   C +  
Sbjct  42   EREALLKFKHGLTDPSRRLSSWTGEE--CCKWEGVEC-NKKTGHV--LKLDLHNPCIEEI  96

Query  179  -----PPCYPGLLQGEIxpsllhlpfln--fldlsfndfERIPSFIGSLNNLVYLDLSYN  337
                  P    +L G I PSL  L +L    L ++    ++IP+F  SL  L YL+LS+ 
Sbjct  97   DIKVFVPSNKCMLGGNIVPSLTELKYLKYLDLSVNNFSTQKIPTFFASLQKLEYLNLSHA  156

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +  GN+P  L N+S L+YLD+  NF  G      +  +W+S LSSL+YL+M GV+L  V 
Sbjct  157  SFNGNIPRQLSNLSKLQYLDLSINFDMG--YLTSNDFDWVSKLSSLKYLHMSGVNLSKVK  214

Query  518  DW  523
            DW
Sbjct  215  DW  216



>ref|XP_006600066.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Glycine max]
Length=573

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  87

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  88   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  199



>gb|KCW86893.1| hypothetical protein EUGRSUZ_B03476, partial [Eucalyptus grandis]
Length=930

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 96/158 (61%), Gaps = 16/158 (10%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLC------TDGPP------CYPGLLQGEIxpsll  229
            CC+W GV CDN  TGHVV L L    +C       DG P        P  L G++ P LL
Sbjct  46   CCEWVGVSCDN-DTGHVVKLDLRSPDICGDIVDDDDGAPESALEDYKPMCLSGQVSPFLL  104

Query  230  hlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIG  403
             L +L +LDLS N+F+   IPSFIGSL  L YL+LS  +  G VPP LGN+S+L+YLD+ 
Sbjct  105  ALKYLTYLDLSHNNFQGNPIPSFIGSLKTLTYLNLSQASFGGLVPPQLGNLSNLRYLDLT  164

Query  404  NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
             +    Q+L+V D L W+S L SL YLN++GV+L   S
Sbjct  165  FDINSRQELRVSD-LNWLSGLFSLNYLNLEGVNLRKGS  201



>ref|XP_011460549.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Fragaria vesca subsp. vesca]
Length=485

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 107/178 (60%), Gaps = 25/178 (14%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALLSFK  +        S  G D  CC+WKG+ C+N  TGHVV + L          
Sbjct  79   ERRALLSFKEDVSDRSGRLSSWVGLD--CCRWKGISCNN-HTGHVVKMDLR--------N  127

Query  182  PCYPGL--------LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLS  331
            P Y  L        L+G+I PS L L  L +LDLS NDFE  RIP+F G L +L YL++S
Sbjct  128  PKYDPLNGFNGKTSLRGKINPSFLSLKSLYYLDLSGNDFEGRRIPNFFGKLTSLRYLNIS  187

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL  505
            Y +  G +PP LGN+S+L YLD+  N+++G   K    L W+S+LSSL+YLN+ GVDL
Sbjct  188  YASFEGEIPPALGNLSNLNYLDL-KNYVNGGYSK---NLNWLSHLSSLKYLNLGGVDL  241



>ref|XP_009354357.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=1022

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 103/179 (58%), Gaps = 16/179 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+AL+ FK  +        S  G +  CC+W+G+ C N TTG V  L + L      G 
Sbjct  31   EREALIDFKKGLEDPENRLSSWKGSN--CCEWRGIHCHN-TTGAV--LTVDLHNPHPQGS  85

Query  182  PCYPGL--LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFG  349
            P   G   L GEI PSL  L  L  LDLSFN F    IP F GSL NL YL+LS+    G
Sbjct  86   PSRYGFWNLSGEISPSLKMLESLRHLDLSFNTFNGIPIPEFFGSLKNLQYLNLSHAGFSG  145

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
             + P+LGN+SSL++LD+ +NFI       VD LEW++ + S+EYLNM+G DL  V  DW
Sbjct  146  RILPNLGNLSSLQFLDVSSNFIS------VDNLEWVTGMVSMEYLNMNGTDLSMVGPDW  198



>gb|KHN45763.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Glycine 
soja]
Length=901

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  7    ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  56

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  57   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  116

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  117  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  168



>gb|KDO55605.1| hypothetical protein CISIN_1g038320mg, partial [Citrus sinensis]
Length=467

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 96/152 (63%), Gaps = 12/152 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLG---LEGLCTDGPPCYPGLLQGEIxpsllhlpflnfld  256
            CCKW+GV CDN +TG VV L L    +    TD    Y   L+GEI PS+L L  LN+LD
Sbjct  65   CCKWEGVICDN-STGKVVQLKLRSPEIPDSFTDNGTTYQ--LEGEISPSVLDLKHLNYLD  121

Query  257  lsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDL  430
            LS N+F   RIP+F+GSL  L YL+LS  +  GN+PP  GN+SSL+ LD+   +    + 
Sbjct  122  LSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLE-  180

Query  431  KVVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
               D +EW+S LSSL+YLN++GVDL    S W
Sbjct  181  --SDDVEWLSRLSSLQYLNLEGVDLSKAGSSW  210



>ref|XP_006599588.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Glycine max]
Length=932

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  87

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  88   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  199



>ref|XP_006599582.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Glycine max]
Length=932

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  87

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  88   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  199



>ref|XP_006600052.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Glycine max]
Length=766

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 103/176 (59%), Gaps = 16/176 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L        G 
Sbjct  138  ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINLDTPA----GS  190

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P Y GL  GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G +
Sbjct  191  P-YRGL-SGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGLI  248

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  249  PHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  299



>ref|XP_006607060.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Glycine max]
Length=776

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  7    ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  56

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  57   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  116

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  117  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  168



>ref|XP_003549056.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2-like [Glycine max]
Length=932

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  87

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  88   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  199



>ref|NP_001174592.1| Os06g0140000 [Oryza sativa Japonica Group]
 dbj|BAD68675.1| putative HcrVf3 protein [Oryza sativa Japonica Group]
 gb|EAY99587.1| hypothetical protein OsI_21565 [Oryza sativa Indica Group]
 gb|EAZ35772.1| hypothetical protein OsJ_20063 [Oryza sativa Japonica Group]
 dbj|BAH93320.1| Os06g0140000 [Oryza sativa Japonica Group]
Length=961

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 90/151 (60%), Gaps = 12/151 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC W GV C+N  TGH++ L+L    +  +        L G+I PSL+HL  L +L+L  
Sbjct  54   CCNWYGVTCNN-RTGHIIKLNLANYNISKEDA------LTGDISPSLVHLTHLMYLNLRS  106

Query  266  ndf--ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIG---NNFIDGQDL  430
            NDF   RIP+FIGSL NL +LDLS+ N  G +PP LGN+S L YLDI    NNF      
Sbjct  107  NDFGGARIPAFIGSLKNLRHLDLSFANFGGKIPPQLGNLSKLNYLDISFPYNNFSSFTSS  166

Query  431  KVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              VD L W+S LSSL YL+M   +L   SDW
Sbjct  167  SSVDNLLWVSQLSSLVYLDMSLWNLSVASDW  197



>ref|XP_002458027.1| hypothetical protein SORBIDRAFT_03g025650 [Sorghum bicolor]
 gb|EES03147.1| hypothetical protein SORBIDRAFT_03g025650 [Sorghum bicolor]
Length=949

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 107/183 (58%), Gaps = 11/183 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            ER ALLSFK S I      L +  + DDCC+W GV C + +TGHV+ + L       D  
Sbjct  37   ERDALLSFK-SGIQSDPQKLLASWNGDDCCRWTGVNC-SYSTGHVLKIDLRNSFFLDDLL  94

Query  176  GPPC---YPGLLQGEIxpsllhlpflnfldlsfn----dfERIPSFIGSLNNLVYLDLSY  334
             PP    YP  ++G+I  SLL L  L +LDLS N    +  +IP F+GSL NLVYL+LS 
Sbjct  95   HPPIHSEYPHGMRGKISSSLLALHHLEYLDLSGNLLGGEAVQIPRFLGSLPNLVYLNLSS  154

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
             +  G VPPHLGN+S L+YLDI   + D ++    + + W++ L  L +L+M GV+L   
Sbjct  155  TDFSGRVPPHLGNLSKLQYLDIDTTWNDEENNMHSEDISWLARLPLLVFLDMSGVNLSIT  214

Query  515  SDW  523
             DW
Sbjct  215  GDW  217



>ref|XP_010068268.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At3g28040 [Eucalyptus grandis]
 gb|KCW63271.1| hypothetical protein EUGRSUZ_G00897 [Eucalyptus grandis]
Length=952

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 95/180 (53%), Gaps = 13/180 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG-  178
            ER+ALL FKH +        S  G++  CCKW+GV C N  TGHV  L L L   C +  
Sbjct  38   EREALLKFKHGLTDPWKRLSSWTGEE--CCKWEGVEC-NKKTGHV--LKLDLHNPCIEEI  92

Query  179  ---PPCYPGLLQGEIxpsllhlp--flnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                P Y   L G I PSL  L       L ++     +IP F  SL  L YL+LSY   
Sbjct  93   DMLEPSYKCRLGGNIVPSLTELKYLKHLDLSINNFSTHKIPMFFASLKKLEYLNLSYAGF  152

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G++P  L N+S L+YLD+ N+F+ G      + L+W+S L SL YL+M GV L S  DW
Sbjct  153  NGDIPRQLNNLSKLQYLDLSNDFVLG--YLTSNDLDWMSKLPSLTYLHMSGVGLSSAKDW  210



>ref|XP_010046668.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
[Eucalyptus grandis]
Length=1095

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 96/158 (61%), Gaps = 16/158 (10%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLC------TDGPP------CYPGLLQGEIxpsll  229
            CC+W GV CDN  TGHVV L L    +C       DG P        P  L G++ P LL
Sbjct  179  CCEWVGVSCDN-DTGHVVKLDLRSPDICGDIVDDDDGAPESALEDYKPMCLSGQVSPFLL  237

Query  230  hlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIG  403
             L +L +LDLS N+F+   IPSFIGSL  L YL+LS  +  G VPP LGN+S+L+YLD+ 
Sbjct  238  ALKYLTYLDLSHNNFQGNPIPSFIGSLKTLTYLNLSQASFGGLVPPQLGNLSNLRYLDLT  297

Query  404  NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
             +    Q+L+V D L W+S L SL YLN++GV+L   S
Sbjct  298  FDINSRQELRVSD-LNWLSGLFSLNYLNLEGVNLRKGS  334



>gb|KEH25161.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25162.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25163.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25164.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25165.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25166.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25167.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25168.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25169.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25170.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25171.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25172.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25173.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25174.1| LRR receptor-like kinase family protein [Medicago truncatula]
 gb|KEH25175.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=442

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 96/175 (55%), Gaps = 18/175 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK            +    ++CCKW+G+ C N+T G+V +L+L         P
Sbjct  35   ERQALLKFK--DALIHSKVNLTSWKGEECCKWEGISCHNLT-GYVTSLNLK--------P  83

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              Y   + G++  S+  L  L  L+L     E +IP  IGSL  L+ L L YNN FG +P
Sbjct  84   FDYTKAVGGKLDYSICELQHLISLNLDNIGLEGKIPKCIGSLGKLIELKLMYNNFFGVIP  143

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGN+S+L+ LD+ +N++   D      LEW+S+LS L YL++  V+L    DW
Sbjct  144  PSLGNLSNLQTLDLSHNYLTAND------LEWLSHLSDLRYLDLSEVNLTLAIDW  192



>ref|XP_010662760.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=900

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 92/174 (53%), Gaps = 18/174 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALLSFKH+++       S    +D CC W+GV C N+T   V+ L L    L   G 
Sbjct  35   EKQALLSFKHALLHPANQLSSWSIKED-CCGWRGVHCSNVT-ARVLKLELADMNL---GG  89

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
               P LL+ E    L                   PSF+GS+ +L +LDLSY    G  PP
Sbjct  90   EISPALLKLEFLDHLDLSSNDFRG-------SPFPSFLGSMGSLKFLDLSYTYFGGLAPP  142

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S L +L++G++ +       V+ L WIS+LSSL+YL MDG+DLH    W
Sbjct  143  QLGNLSKLLHLNLGHSGL------YVENLNWISHLSSLKYLYMDGIDLHRGRHW  190



>ref|XP_007226165.1| hypothetical protein PRUPE_ppa015243mg [Prunus persica]
 gb|EMJ27364.1| hypothetical protein PRUPE_ppa015243mg [Prunus persica]
Length=892

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 108/177 (61%), Gaps = 15/177 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FKH +        S  G  D CC W GV CDN+T  HV  LHL          
Sbjct  34   ERQALLMFKHDLEDPSNRLSSWVGKGD-CCNWTGVVCDNLTV-HVRELHLA---------  82

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
              +  +L G+I  SLL+L  L +LDLS NDF+  +IPSF+GSL +L YL+LS++   G +
Sbjct  83   -GHVDMLSGKINQSLLNLKHLTYLDLSNNDFQGMQIPSFLGSLKSLRYLNLSHSWFVGLI  141

Query  356  PPHLGNISSLKYLDIGN-NFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN++SL+ LD+GN  + +   L  V++L+WIS LS L++L+M G +L   SDW
Sbjct  142  PHQLGNLTSLQVLDLGNPPYSEIYSLLEVESLQWISGLSQLQHLDMSGANLSKASDW  198



>ref|XP_009618939.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 isoform X2 [Nicotiana tomentosiformis]
Length=840

 Score = 90.5 bits (223),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (59%), Gaps = 20/148 (14%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKWKGV CDN  TGHV+AL L            +   LQGE   SLL LP L  LDLS 
Sbjct  65   CCKWKGVECDN-KTGHVIALDL------------HKQFLQGEFATSLLGLPHLRHLDLSQ  111

Query  266  ndf--ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
             DF   ++P FI +  NL YL+LS     G +P HLGN+S L++LD+     DG  L+ V
Sbjct  112  IDFLGAQVPEFISTFKNLEYLNLSKTKFRGTIPEHLGNLSRLQFLDLS----DGFSLR-V  166

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            D L+WI +L S++ L++ GVD+    +W
Sbjct  167  DNLQWIRHLFSMKILDLSGVDMSDAKNW  194



>gb|ACM89598.1| leucine-rich repeat protein [Glycine max]
Length=732

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 96/177 (54%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  7    ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGQVMEINL-------DTP  56

Query  182  PCYP-GLLQGEIxpsl--lhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSL  L       L  ++     IPSF+GSL +L YLDLS +   G 
Sbjct  57   VGSPYRELSGEISPSLLGLKYLNHLDLSSNYFVLTPIPSFLGSLKSLRYLDLSLSGFMGL  116

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  117  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  168



>ref|XP_007030464.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY10966.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=826

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 95/189 (50%), Gaps = 28/189 (15%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGL-------  157
            ER+ALL FKH +I       S   GD +DCCKW GV CDN  TGHV  LHLG        
Sbjct  97   ERQALLKFKHDLIDHSNRLSSWVEGDYEDCCKWVGVLCDN-RTGHVNQLHLGFLIPDEHA  155

Query  158  -------EGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLV  316
                    G    G    P LL        L       L  ++ D  +IP FIGSL  L 
Sbjct  156  PDAVWEAYGRSKLGRKINPSLLD-------LKHLSFLDLSNNYFDGMQIPEFIGSLKRLT  208

Query  317  YLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDG  496
            YL+LS  +  G +P  LGN+S L YLD+G+NF     L    TL+W+S L SL YL++  
Sbjct  209  YLNLSGASFGGAIPHKLGNLSKLHYLDLGHNF-----LLEAKTLQWVSSLPSLRYLDLSR  263

Query  497  VDLHSVSDW  523
            V+L   +DW
Sbjct  264  VNLSKATDW  272



>gb|KHG16201.1| DNA-damage-repair/toleration protein [Gossypium arboreum]
Length=345

 Score = 87.4 bits (215),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 100/176 (57%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK+ +        S     D CCKW GV C N +TGHV  LHL         P
Sbjct  40   EREALLKFKNDLTDPSNRLSSWVEGGD-CCKWIGVVCHN-STGHVNQLHLA-------AP  90

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P  P  L G+I PSLL L  LN LDLS+N F    IP F G L +L YL+LS     G +
Sbjct  91   PLSPSALGGKINPSLLELKHLNSLDLSYNSFSSIHIPKFFGLLESLTYLNLSCAQFQGAI  150

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P +LGN+S L+YLD+G N  D +      +L+W+S L SL++L++ G DL   +DW
Sbjct  151  PHNLGNLSKLQYLDLGGN--DHEQ----KSLQWVSGLYSLQHLDLSGADLSKATDW  200



>ref|XP_009338728.1| PREDICTED: receptor-like protein 12 [Pyrus x bretschneideri]
Length=947

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 106/176 (60%), Gaps = 12/176 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  +        S  G  + CC W GV CDN+T GHV  LHL       D  
Sbjct  37   ERQALLLFKKDLDDPTHMLSSWGGASN-CCNWIGVACDNLT-GHVHELHLAGN---YDQE  91

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L G++ PSLL+L  L++L+LS N+FE  +IPSF+GSL  L YLDLSY    G +
Sbjct  92   TGEEHGLGGKVNPSLLNLKHLSYLNLSHNNFEGLQIPSFLGSLKGLRYLDLSYAGFNGTI  151

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+SSL+YLD+ +NF       +V+ L+W+S LS L++L+M  VDL + S W
Sbjct  152  PHQLGNLSSLRYLDLSHNFG-----SMVENLKWLSGLSLLKHLDMSSVDLTNASHW  202



>ref|XP_009405132.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Musa acuminata subsp. malaccensis]
Length=990

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 106/174 (61%), Gaps = 14/174 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  I+ DP SSLSSW    DCC+W GV CDN  TGHVV L+L         P
Sbjct  42   ERDALLDFKTGIVKDPSSSLSSWRGRVDCCRWSGVVCDN-RTGHVVELNLQ-----NSDP  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
              Y   + GEI PSLL L  L  L+LS+NDF   +IP F+GSL  L YLDLS++N  G +
Sbjct  96   YNYETSIGGEIRPSLLLLTHLERLNLSYNDFGGIQIPKFLGSLTKLTYLDLSWSNFSGAI  155

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            PP LGN+SSL+YLD+ +  +        D L W+S L+SL YL+M   +L   S
Sbjct  156  PPQLGNLSSLRYLDLNSGGLS------TDGLHWLSRLTSLRYLDMSFGNLSMAS  203



>ref|XP_009618938.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X1 [Nicotiana tomentosiformis]
Length=894

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (59%), Gaps = 20/148 (14%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKWKGV CDN  TGHV+AL L            +   LQGE   SLL LP L  LDLS 
Sbjct  65   CCKWKGVECDN-KTGHVIALDL------------HKQFLQGEFATSLLGLPHLRHLDLSQ  111

Query  266  ndf--ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
             DF   ++P FI +  NL YL+LS     G +P HLGN+S L++LD+     DG  L+ V
Sbjct  112  IDFLGAQVPEFISTFKNLEYLNLSKTKFRGTIPEHLGNLSRLQFLDLS----DGFSLR-V  166

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            D L+WI +L S++ L++ GVD+    +W
Sbjct  167  DNLQWIRHLFSMKILDLSGVDMSDAKNW  194



>ref|NP_001172452.1| Os01g0601675 [Oryza sativa Japonica Group]
 dbj|BAB89968.1| HcrVf1 protein-like [Oryza sativa Japonica Group]
 dbj|BAB91719.1| HcrVf1 protein-like [Oryza sativa Japonica Group]
 gb|EAZ12592.1| hypothetical protein OsJ_02500 [Oryza sativa Japonica Group]
 dbj|BAH91182.1| Os01g0601675 [Oryza sativa Japonica Group]
Length=953

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 97/177 (55%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER AL+SFK  ++       S  GDD  CC+W GV C+N  TGH+V L+L   G C   P
Sbjct  40   ERSALISFKSGLLDPGNLLSSWEGDD--CCQWNGVWCNN-ETGHIVELNLP-GGSCNILP  95

Query  182  P---CYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            P     PGL        L      +      N    +P F+GSL+NL  LDLS++   G 
Sbjct  96   PWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLDLSWSTFVGT  155

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            VPP LGN+S+L+Y  +G+N  D   L   D + W+S LSSLE+L+M  V+L +V DW
Sbjct  156  VPPQLGNLSNLRYFSLGSN--DNSSLYSTD-VSWLSRLSSLEHLDMSLVNLSAVVDW  209



>ref|XP_006600036.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like, partial [Glycine max]
Length=732

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 101/177 (57%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGKVMEINL-------DTP  87

Query  182  PCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS +   G 
Sbjct  88   AGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSS EYL++ G DLH   +W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSFEYLDLSGSDLHKKGNW  199



>ref|XP_010910868.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At2g24130 [Elaeis guineensis]
Length=383

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 100/183 (55%), Gaps = 12/183 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +        S  GDD  CC WKGV CDN  TGHVV L L         P
Sbjct  35   ERNALLGFKEGLKDPSNRLSSWVGDD--CCTWKGVACDN-QTGHVVKLDLRNPSCFEYYP  91

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P     L GE+ PSLL L +LN+LDLS N+F   RIP F+GS   L YL+LS   + G +
Sbjct  92   PNNTWCLGGELRPSLLGLKYLNYLDLSMNNFGGIRIPEFMGSFRQLKYLNLSRAYMRGLI  151

Query  356  PPHLGNISSLKYLDI-------GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
            P  LGN+SSL+YLD+       G+NF       ++D   WIS LSSL YLNM  V     
Sbjct  152  PYQLGNLSSLQYLDLSHNYYYYGDNFKVSYGFLIIDNAIWISRLSSLRYLNMMDVQFREG  211

Query  515  SDW  523
            + W
Sbjct  212  AHW  214



>ref|NP_001172453.1| Os01g0601700 [Oryza sativa Japonica Group]
 dbj|BAH91183.1| Os01g0601700 [Oryza sativa Japonica Group]
Length=296

 Score = 86.7 bits (213),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 94/181 (52%), Gaps = 22/181 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLG-------LE  160
            ERKALL+FK        +        +DCC+WKGV CDN TTGHVV L L          
Sbjct  52   ERKALLTFK--DSFWDRAGRLYSWRGEDCCRWKGVRCDN-TTGHVVRLDLRNTDEDDWSN  108

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNN  340
            GL        P ++        LH      L  +  +F  IP F+GSL+NL YL+LS  N
Sbjct  109  GLILSTSEMSPSIVD-------LHHLRYLDLSYNHFNFTSIPDFLGSLSNLRYLNLSAAN  161

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
             +G +P  LGN+S+L+YLD+GN+      L V D L W+  L  L YL++  VDL S  +
Sbjct  162  FWGTLPSQLGNLSNLQYLDLGNS----HSLSVSD-LSWLMGLPFLSYLDLSTVDLSSERN  216

Query  521  W  523
            W
Sbjct  217  W  217



>ref|XP_009388094.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Musa acuminata subsp. malaccensis]
Length=209

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 89/178 (50%), Gaps = 19/178 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK         +  S     DCC W+GV C   TTGHVV L         D  
Sbjct  2    EREALLDFK--AGIHDTHNRLSSWVGQDCCAWEGVIC-GATTGHVVML---------DLR  49

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE----RIPSFIGSLNNLVYLDLSYNNLFG  349
              +   L+GE   +   L   +   L  +       RIP FIGS   L YL+LS  N  G
Sbjct  50   NTFDRALRGERMMNSSLLALSHLEHLDLSFNNFSGIRIPEFIGSFKKLRYLNLSSTNFMG  109

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             +P  LGN+SSL  LD+    +      +VD L+W+S+L+SL+YLN+ G++L  V DW
Sbjct  110  GIPARLGNLSSLYVLDLS---VALHFTSLVDNLDWLSHLTSLKYLNLSGLNLTDVPDW  164



>ref|XP_010323160.1| PREDICTED: EIX receptor 1 isoform X1 [Solanum lycopersicum]
Length=1027

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 103/172 (60%), Gaps = 11/172 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +  D     +   +++ CC WKG+ CD   TGHV+ L L  E  C  G 
Sbjct  39   ERDALLEFKRGLNDDFGRLSTWGDEEE-CCNWKGIECDK-RTGHVIVLDLHSEVTCP-GH  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
             C+  +L G++ PSLL L +LNFLDLS N FE   IP FIGSL  L YL+LS ++  G +
Sbjct  96   ACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEI  155

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
            P    N++SL+ LD+GNN +      +V  L W+S+LSSLE+L + G D  +
Sbjct  156  PAQFQNLTSLRILDLGNNNL------IVKDLVWLSHLSSLEFLRLGGNDFQA  201



>gb|AAR28378.1| EIX receptor 2 [Solanum lycopersicum]
Length=1021

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 103/172 (60%), Gaps = 11/172 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +  D     +   +++ CC WKG+ CD   TGHV+ L L  E  C  G 
Sbjct  39   ERGALLEFKRGLNDDFGRLSTWGDEEE-CCNWKGIECDK-RTGHVIVLDLHSEVTCP-GH  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
             C+  +L G++ PSLL L +LNFLDLS N FE   IP FIGSL  L YL+LS ++  G +
Sbjct  96   ACFAPILTGKVSPSLLELEYLNFLDLSVNGFENSEIPRFIGSLKRLEYLNLSSSDFSGEI  155

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
            P    N++SL+ LD+GNN +      +V  L W+S+LSSLE+L + G D  +
Sbjct  156  PAQFQNLTSLRILDLGNNNL------IVKDLVWLSHLSSLEFLRLGGNDFQA  201



>ref|XP_006600054.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Glycine max]
Length=811

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 95/177 (54%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L       D P
Sbjct  38   ERNALLSFKHGLADPSNRLSSWSDKSD-CCTWPGVHCNN--TGQVMEINL-------DTP  87

Query  182  PCYP-GLLQGEIxpsl--lhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               P   L GEI PSL  L       L  ++     IPSF+GSL +L YLDLS +   G 
Sbjct  88   VGSPYRELSGEISPSLLGLKYLNHLDLSSNYFVLTPIPSFLGSLESLRYLDLSLSGFMGL  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+S+L++L++G N+        +D L WIS LSSLEYL++ G DLH    W
Sbjct  148  IPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGKW  199



>ref|XP_010646800.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=461

 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 106/178 (60%), Gaps = 12/178 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +        S  G+D  CCKW+GV C+N  +GHV+ L+L    L  DG 
Sbjct  44   ERVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNN-RSGHVIKLNL--RSLDDDGT  98

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                G L GEI  SLL L +LN LDLS N+FE  RIP FIGSL  L YL+LS  +  G +
Sbjct  99   H---GKLGGEISHSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLEKLRYLNLSGASFSGPI  155

Query  356  PPHLGNISSLKYLDIGN--NFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S L YLD+    +F    D    + L+WIS LSSL +LN++GV+L   S +
Sbjct  156  PPQLGNLSRLIYLDLKEYFDFNTYPDESSQNDLQWISGLSSLRHLNLEGVNLSRASAY  213



>ref|XP_002436946.1| hypothetical protein SORBIDRAFT_10g012050 [Sorghum bicolor]
 gb|EER88313.1| hypothetical protein SORBIDRAFT_10g012050 [Sorghum bicolor]
Length=968

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 90/151 (60%), Gaps = 18/151 (12%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPG-LLQGEIxpsllhlpflnfldls  262
            CC W GV C N  TGHVV L LG   L       Y G  L G+I PSLL L  L +LDLS
Sbjct  86   CCHWAGVRCSN-RTGHVVELRLGNSNL-------YDGYALVGQISPSLLSLEHLEYLDLS  137

Query  263  fndfE----RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDL  430
             N  E    +IP F+GSL NL YL+LS     G VPPHLGN+S L+YLDI +    G D 
Sbjct  138  MNSLEGATGQIPKFLGSLKNLEYLNLSGIPFSGRVPPHLGNLSKLQYLDISS----GADT  193

Query  431  KVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              VD + W++ L  L+YLN+  V+L +V+DW
Sbjct  194  FSVD-MSWLTRLQFLDYLNLKTVNLSTVADW  223



>ref|XP_006470121.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=978

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 96/152 (63%), Gaps = 12/152 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLG---LEGLCTDGPPCYPGLLQGEIxpsllhlpflnfld  256
            CCKW+GV CDN +TG VV L L    +    TD    Y   L+GEI PS+L L  LN+LD
Sbjct  65   CCKWEGVICDN-STGKVVQLKLRSPEIPDSFTDNGTTYQ--LEGEISPSVLDLKHLNYLD  121

Query  257  lsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDL  430
            LS N+F   RIP+F+GSL  L YL+LS  +  GN+PP  GN+SSL+ LD+   +    + 
Sbjct  122  LSLNNFRGSRIPNFLGSLEKLRYLNLSGASFAGNIPPSFGNLSSLQILDLNTFYYSSLE-  180

Query  431  KVVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
               D +EW+S LSSL+YLN++GVDL    S W
Sbjct  181  --SDDVEWLSRLSSLQYLNLEGVDLSKAGSSW  210



>ref|XP_010040211.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=958

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 97/182 (53%), Gaps = 18/182 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FKH +        S  G++  CCKW+GV C N  TGHV  L L L   C +  
Sbjct  42   EREALLKFKHGLTDPSRRLSSWIGEE--CCKWEGVEC-NKKTGHV--LKLDLRNPCIEEI  96

Query  182  ------PCYPGLLQGEIxpsllhlpfln--fldlsfndfERIPSFIGSLNNLVYLDLSYN  337
                  P    +L G I PSL  L +L    L ++    +RIP F  SL  L YL+LS+ 
Sbjct  97   DIDIFIPSDKCMLGGNIVPSLTKLKYLKYLDLSVNNFSTQRIPMFFASLQKLEYLNLSHA  156

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +  G++P  L N+S L+YLD+  N          + L W+S LSSL+YL+M GVDL  V 
Sbjct  157  SFNGDIPRQLSNLSKLQYLDLSTN-----SYTTSNNLAWVSKLSSLKYLHMSGVDLSKVK  211

Query  518  DW  523
            DW
Sbjct  212  DW  213



>gb|EMT19054.1| Leucine-rich repeat receptor protein kinase EXS [Aegilops tauschii]
Length=842

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 95/183 (52%), Gaps = 13/183 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            ER  LLSFK  I S+  + L+SW   D CC+W+GV C N  TGHV+ LHL    +  D  
Sbjct  41   ERATLLSFKKGITSNDANILTSWQGQD-CCRWRGVSCSN-RTGHVIKLHLRNPNVALDTY  98

Query  176  -------GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSY  334
                   G     G +   +            ++       +IP  +GS+ NL YL+LS 
Sbjct  99   GEYDVCGGASALFGEISPSLLSLKHLEHMDLSMNCLLGTNSQIPHLLGSMGNLRYLNLSG  158

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                G VPPHLGN+S L+YLD+G +  D  D+   D + W++ L+ L++L M GV+L  +
Sbjct  159  IPFTGRVPPHLGNLSKLQYLDLGQDG-DYSDMYSTD-ITWLTKLAFLKFLGMSGVNLSGI  216

Query  515  SDW  523
             DW
Sbjct  217  VDW  219



>ref|XP_010068697.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
[Eucalyptus grandis]
Length=534

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 95/183 (52%), Gaps = 19/183 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-------GLE  160
            ER+ALL F+  +I       S    D  CC+WKGV C    TGHV  L L         +
Sbjct  38   EREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVQCSK-KTGHVFKLDLRNPCFETSPD  94

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfl--dlsfndfERIPSFIGSLNNLVYLDLSY  334
            G C D        L G+I  SL  L  L +L   L+    ++IP F G+L  L YL+LS 
Sbjct  95   GYCLDKSS-----LAGKIHASLAELKHLKYLDLSLNNFSMQKIPQFFGTLQRLEYLNLSS  149

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                GN+P HLGN+S+L YLD+ + F  G+     D L+W+S LSSL+Y ++  +DL   
Sbjct  150  AGFDGNIPHHLGNLSNLWYLDLASEF--GEGYLTSDNLQWVSKLSSLKYFHLALIDLRKA  207

Query  515  SDW  523
             DW
Sbjct  208  KDW  210



>gb|KHG06604.1| DNA-damage-repair/toleration protein [Gossypium arboreum]
Length=267

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 104/184 (57%), Gaps = 18/184 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            ERKALL FK+ +I       S     D CC+W GV C N +TGHV  LHL    L     
Sbjct  41   ERKALLKFKNDLIDPSDRLSSWVEGGD-CCEWIGVFCQN-STGHVHQLHLAAPPLSAPDI  98

Query  176  -GPPC-----YPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLS  331
              PP          L+G+I PSLL L  L+ LDLS N+F   +IP F G L +L YL+LS
Sbjct  99   YAPPAEWEPYRRSKLRGKINPSLLELKHLSSLDLSNNNFSSIQIPKFFGLLESLTYLNLS  158

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
                 G +P +LGN+S L+YLD+G N     DLK  ++ +W+S LSSL YL++   DL+ 
Sbjct  159  LARFQGTIPHNLGNLSKLQYLDLGYN-----DLK-SESPQWVSALSSLHYLDLSSADLYE  212

Query  512  VSDW  523
             +DW
Sbjct  213  ANDW  216



>ref|XP_009610906.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nicotiana tomentosiformis]
Length=1032

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 106/178 (60%), Gaps = 12/178 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER ALL FK  ++ D     +     D  +CCKWKG+ CD   +GHV  L L  E  C  
Sbjct  41   ERDALLEFKRGLVDDFDRLSTWGDEEDKKECCKWKGIECDK-RSGHVTVLDLHSEVSCP-  98

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfER--IPSFIGSLNNLVYLDLSYNNLFG  349
            G  C+  +L G++ PSLL L  LN+LDLS N F+R  IP FI SL  L YL+LS ++  G
Sbjct  99   GHACFAPILTGKLSPSLLELQHLNYLDLSVNGFDRSEIPRFISSLKRLEYLNLSSSDFSG  158

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             VP  L N++SL+ LD+GNN     +  +V  L W+S+LSSLE+L + G D  + S+W
Sbjct  159  VVPTQLKNLTSLRILDLGNN-----NQLIVKDLGWLSHLSSLEFLRLGGNDFQA-SNW  210



>gb|KCW45386.1| hypothetical protein EUGRSUZ_L00930, partial [Eucalyptus grandis]
Length=884

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 97/182 (53%), Gaps = 18/182 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FKH +        S  G++  CCKW+GV C N  TGHV  L L L   C +  
Sbjct  22   EREALLKFKHGLTDPSRRLSSWIGEE--CCKWEGVEC-NKKTGHV--LKLDLRNPCIEEI  76

Query  182  ------PCYPGLLQGEIxpsllhlpfln--fldlsfndfERIPSFIGSLNNLVYLDLSYN  337
                  P    +L G I PSL  L +L    L ++    +RIP F  SL  L YL+LS+ 
Sbjct  77   DIDIFIPSDKCMLGGNIVPSLTKLKYLKYLDLSVNNFSTQRIPMFFASLQKLEYLNLSHA  136

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +  G++P  L N+S L+YLD+  N          + L W+S LSSL+YL+M GVDL  V 
Sbjct  137  SFNGDIPRQLSNLSKLQYLDLSTN-----SYTTSNNLAWVSKLSSLKYLHMSGVDLSKVK  191

Query  518  DW  523
            DW
Sbjct  192  DW  193



>gb|KDO50225.1| hypothetical protein CISIN_1g0032002mg, partial [Citrus sinensis]
Length=713

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 105/176 (60%), Gaps = 15/176 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  +        S  GD D CC W GV C N+T GH+  L L L    T  P
Sbjct  35   ERRALLRFKQDLQDPSNRLASWTGDGD-CCTWAGVACGNVT-GHI--LELNLRNPSTSNP  90

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                 +L G++ P+LL L  L++LDLS NDF+  +IP FIGS+ NL YL+LS     G +
Sbjct  91   R---SMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMI  147

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S L++LD+ +N++       VD + W+S LS LE+L++  V+L   SDW
Sbjct  148  PPQLGNLSDLQFLDLSSNYL------YVDNVWWLSGLSFLEHLDLRSVNLSKASDW  197



>gb|EAY74858.1| hypothetical protein OsI_02750 [Oryza sativa Indica Group]
Length=972

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 103/180 (57%), Gaps = 9/180 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK + I+       S    ++CC+W GV C N  TGHV+ L+L    L  D P
Sbjct  52   ERDALLSFK-AGITSDPKKRLSSWLGENCCQWSGVRCSN-RTGHVIILNLSNTILQYDDP  109

Query  182  PCY--PGL---LQGEIxpsllhlpflnfldls-fndfERIPSFIGSLNNLVYLDLSYNNL  343
              Y  P +   L G I  SL+ L  L  LDLS     E +P F+GSL +L +L+L+Y   
Sbjct  110  HYYKFPNVDFQLYGIISSSLVSLRQLKRLDLSGNILGESMPEFLGSLQSLTHLNLAYMGF  169

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G VP  LGN+S+L++LDI   F +   +   D + W++ L SL+YL+M  V+L SV DW
Sbjct  170  YGRVPHQLGNLSNLQFLDITPRFYEYPPMHAAD-ISWLARLPSLKYLDMSYVNLSSVVDW  228



>ref|XP_002450414.1| hypothetical protein SORBIDRAFT_05g004935 [Sorghum bicolor]
 gb|EES09402.1| hypothetical protein SORBIDRAFT_05g004935 [Sorghum bicolor]
Length=951

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 82/148 (55%), Gaps = 9/148 (6%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldls-  262
            CC+WKGV C N  T HVV L L  E  C+D        L GE+  SL+ L  L  LDLS 
Sbjct  68   CCQWKGVQCSN-RTSHVVKLDLHGETCCSDYA------LGGEMSSSLVGLQHLEHLDLSC  120

Query  263  -fndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
                   IP FIGSL +L YL+LSY    G +PP LGN+S L YLDI +           
Sbjct  121  NNFSSTSIPKFIGSLRSLEYLNLSYAAFGGRIPPQLGNLSKLVYLDINSACWGYHHSLYS  180

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            D+L W+S LSSL+YL M  ++L +  DW
Sbjct  181  DSLSWVSRLSSLKYLGMTWMNLSAAVDW  208



>ref|XP_006452209.1| hypothetical protein CICLE_v10007386mg [Citrus clementina]
 gb|ESR65449.1| hypothetical protein CICLE_v10007386mg [Citrus clementina]
Length=926

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 105/176 (60%), Gaps = 15/176 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  +        S  GD D CC W GV C N+T GH+  L L L    T  P
Sbjct  35   ERRALLRFKQDLQDPSNRLASWTGDGD-CCTWAGVACGNVT-GHI--LELNLRNPSTSNP  90

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                 +L G++ P+LL L  L++LDLS NDF+  +IP FIGS+ NL YL+LS     G +
Sbjct  91   R---SMLVGKVNPALLDLKHLSYLDLSSNDFQGVQIPRFIGSMRNLRYLNLSDTQFVGMI  147

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S L++LD+ +N++       VD + W+S LS LE+L++  V+L   SDW
Sbjct  148  PPQLGNLSDLQFLDLSSNYL------YVDNVWWLSGLSFLEHLDLRSVNLSKASDW  197



>gb|KDO56170.1| hypothetical protein CISIN_1g040379mg, partial [Citrus sinensis]
Length=373

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 96/180 (53%), Gaps = 21/180 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FK S++ +     S     +  DCCKW GVGC N  TGHV+ L +  + +  D
Sbjct  37   EREALLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSN-RTGHVIKLEI--QPIDFD  93

Query  176  GPPCY----PGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
              P      P LLQ       LH      L L+      IP FIGSL  L YLDLS+   
Sbjct  94   SFPLRGTISPALLQ-------LHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEF  146

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G +P HLGN+S+L++LD+  N      L     L+W+S+LSSL YL++   +L   +DW
Sbjct  147  EGPIPSHLGNLSALQHLDLSLN-----HLFSAGNLDWLSHLSSLTYLDLGSNNLSRSTDW  201



>gb|EEC71023.1| hypothetical protein OsI_02720 [Oryza sativa Indica Group]
Length=1200

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 96/177 (54%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER AL+SFK         +L S  + DDCC W GV C+N  TGH+V L+L   G C   P
Sbjct  40   ERSALISFK--SGLLDPGNLLSSWEGDDCCPWNGVWCNN-ETGHIVELNLP-GGSCNILP  95

Query  182  P---CYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            P     PGL        L      +      N    +P F+GSL+NL  LDLS++   G 
Sbjct  96   PWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLDLSWSTFVGT  155

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            VPP LGN+S+L+Y  +G+N  D   L   D + W+S LSSLE+L+M  V+L +V DW
Sbjct  156  VPPQLGNLSNLRYFSLGSN--DNSSLYSTD-VSWLSRLSSLEHLDMSLVNLSAVVDW  209


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 9/82 (11%)
 Frame = +2

Query  284  PSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISY  463
            PS++G+L NL  LDLS+N+  G VPP +G++S+L  LD+  N   G     V + + + +
Sbjct  614  PSWVGALGNLQILDLSHNSFSGPVPPGIGSLSNLTTLDLSYNRFQG-----VISKDHVEH  668

Query  464  LSSLEYLNMD----GVDLHSVS  517
            LS L+YL++      +D+H+ S
Sbjct  669  LSRLKYLDLSDNFLKIDIHTNS  690



>ref|XP_008360818.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=968

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 95/187 (51%), Gaps = 19/187 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGL---  166
            ER+ALL+FKH ++       S        DCCKW GV C N  T HV  LHLG   L   
Sbjct  50   EREALLAFKHGLVDHYNVLSSWGREEHKQDCCKWVGVHCSN-RTNHVTQLHLGWYSLNES  108

Query  167  ---CTDGPPCYPG-LLQGEIxpsllhlpflnf---ldlsfndfERIPSFIGSLNNLVYLD  325
                  G P Y    LQG+     L          L     +  R+P FIGSL+NL +LD
Sbjct  109  YSHQQKGDPQYISYFLQGKKMSPKLIELQRLKYLDLSSINFNGTRLPYFIGSLSNLRHLD  168

Query  326  LSYNNLFGNVPPHLGNISSLKYLDI-GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVD  502
            LS+ +  G  P  +GN++ L+YLD+ GN+F   ++LK      W+  LSSL YL++   +
Sbjct  169  LSFASFGGRFPSQVGNLTHLQYLDLNGNDFNSVENLK-----SWLPLLSSLTYLDLSSTN  223

Query  503  LHSVSDW  523
            L +V DW
Sbjct  224  LSNVHDW  230



>gb|KJB45923.1| hypothetical protein B456_007G338100 [Gossypium raimondii]
Length=954

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 103/176 (59%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK+ +I       S     D CC+W GV C N +TGHV  LHL         P
Sbjct  41   EREALLKFKNHLIDPSNRLSSWVEGGD-CCEWTGVVCHN-STGHVNQLHLA-------SP  91

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P  P  L G+I PSLL L  L+ LDLS NDF    IP F+G L +L +L+LS     G +
Sbjct  92   PFSPSALGGKINPSLLELKHLSSLDLSNNDFSSIHIPIFLGMLGSLTHLNLSRAGFQGAI  151

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P +LGN+S L+YLD     + G DLK   +L+W+S LSSL+YL++   DLH  +DW
Sbjct  152  PHNLGNLSKLQYLD-----LRGNDLK-SKSLQWVSGLSSLQYLDLSYADLHKATDW  201



>ref|XP_002273469.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=994

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 106/178 (60%), Gaps = 12/178 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +        S  G+D  CCKW+GV C+N  +GHV+ L+L    L  DG 
Sbjct  44   ERVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNN-RSGHVIKLNL--RSLDDDG-  97

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                G L GEI  SLL L +LN LDLS N+FE  RIP FIGSL  L YL+LS  +  G +
Sbjct  98   --TDGKLGGEISLSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLERLRYLNLSCASFSGPI  155

Query  356  PPHLGNISSLKYLDIGN--NFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S L YLD+    +F    D    + L+WIS LSSL +LN++GV+L   S +
Sbjct  156  PPQLGNLSRLIYLDLKEYFDFNRYPDESSQNNLQWISGLSSLRHLNLEGVNLSRASAY  213



>gb|KEH25176.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=871

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 18/175 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK ++I   ++  S  G++  CCKW+G+ C N+T G+V +L+L         P
Sbjct  35   ERQALLKFKDALIHSKVNLTSWKGEE--CCKWEGISCHNLT-GYVTSLNLK--------P  83

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              Y   + G++  S+  L  L  L+L     E +IP  IGSL  L+ L L YNN FG +P
Sbjct  84   FDYTKAVGGKLDYSICELQHLISLNLDNIGLEGKIPKCIGSLGKLIELKLMYNNFFGVIP  143

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGN+S+L+ LD+ +N++   D      LEW+S+LS L YL++  V+L    DW
Sbjct  144  PSLGNLSNLQTLDLSHNYLTAND------LEWLSHLSDLRYLDLSEVNLTLAIDW  192



>ref|XP_008218738.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein 12 [Prunus 
mume]
Length=916

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 92/174 (53%), Gaps = 18/174 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FKH +        S  G+ D CC W GV CDN+T GH+  LHL          
Sbjct  36   ERQALLKFKHDLEDPSNQLSSWAGEGD-CCNWTGVVCDNLT-GHIRELHLA---------  84

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
              Y G +   +             +       +IPSF+GSL +L YL+LSY++  G +P 
Sbjct  85   DTYSGKISPSLLNLKHLSYLDLSNNDFQGM--QIPSFLGSLKSLRYLNLSYSSFVGLIPH  142

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN++SL+ LD+G+        + V++L+WIS LS L++L+M   +L   SDW
Sbjct  143  QLGNLTSLQVLDLGD-----YSEREVESLQWISGLSKLQHLDMSCANLSKASDW  191



>gb|EAY74841.1| hypothetical protein OsI_02733 [Oryza sativa Indica Group]
Length=379

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 90/148 (61%), Gaps = 10/148 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+WKGVGC N  TG VV L   L+G C +       +L G I  SLL L  L +LDLS 
Sbjct  71   CCRWKGVGCSN-RTGRVVKL--DLQGDCGNSI-ISKQVLGGSISDSLLDLHHLQYLDLSC  126

Query  266  ndf--ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N F  +++P F+ SL++L YLDLS ++  G +PP LGN+SSL+Y  I + F D     + 
Sbjct  127  NRFNGQQVPKFLSSLHSLRYLDLSQSSFSGRIPPQLGNLSSLRYFSIDSIFGDTDSTDI-  185

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
                W+S LSSLEYL+M  V+L +V  W
Sbjct  186  ---SWLSRLSSLEYLDMSFVNLSTVVHW  210



>ref|XP_009405133.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Musa acuminata subsp. malaccensis]
Length=972

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 107/174 (61%), Gaps = 14/174 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  ++  P S LSSW    DCC+W GV CDN  TGHVV L+L  + L  +  
Sbjct  42   ERDALLDFKTGLLGGPSSRLSSWRGRVDCCRWSGVVCDN-RTGHVVELNLNPDYLNNETS  100

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  + GEI PSLL L  L  L+LS NDF   +IP F+GSL  L YLDLS++N  G +
Sbjct  101  ------IGGEIRPSLLLLTHLERLNLSHNDFGGIQIPKFLGSLTELTYLDLSWSNFSGAI  154

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            PP LGN+S+L+ L++ + +    DL  +D L W+S L+SL YL+M GV L   S
Sbjct  155  PPQLGNLSTLRSLNLNSLY----DL-TIDGLHWLSRLTSLRYLDMSGVKLSMAS  203



>gb|EMT13998.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=1118

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 101/176 (57%), Gaps = 19/176 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK            S    +DCC W+GVGC N  TGHVV L+L   G      
Sbjct  37   ERAALLSFK--GSLSDPVKQLSSWHGEDCCTWEGVGCSN-RTGHVVNLNLSGCG------  87

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
              Y   + G+I PSL  L  L +LDLS N+F   +IP F+ SL +L +LDLS+ +  G V
Sbjct  88   --YEARVGGDISPSLTALHHLKYLDLSCNNFSGVQIPKFVASLKSLQHLDLSFASFVGRV  145

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S+L +L + +N +   DL       W+S+L+SL+YL+M  V+L +  DW
Sbjct  146  PPQLGNLSNLVFLSVSDNPLYSDDLA------WLSHLTSLQYLDMSSVNLSTSVDW  195



>ref|XP_009367839.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=1084

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/187 (37%), Positives = 98/187 (52%), Gaps = 19/187 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLG------L  157
            ER+ALL+FK  ++ D     S        DCCKW GV C N  T HV  LHLG       
Sbjct  56   EREALLAFKQGLVDDYDLLSSWGREEHKQDCCKWLGVHCSN-RTNHVTQLHLGRSYLDQA  114

Query  158  EGLCTDGPPCYPGL-LQGEIxpsllhlpflnf---ldlsfndfERIPSFIGSLNNLVYLD  325
              L   G P +    LQG++    L          L     +  ++P FIGSL+NL +LD
Sbjct  115  HALQQKGRPQFIYYYLQGKMMSPKLTKLKHLKYLDLSRIKFNGSQVPDFIGSLSNLRHLD  174

Query  326  LSYNNLFGNVPPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVD  502
            L+Y +  G +P  +GN++ L+YLD+  NNF + +DL       W+ +LS+L YL++ G +
Sbjct  175  LTYASFGGRIPTQIGNLTHLQYLDLRYNNFANVEDLN-----SWMPHLSALTYLDLSGNN  229

Query  503  LHSVSDW  523
            L +V DW
Sbjct  230  LSNVPDW  236



>ref|XP_008231480.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Prunus mume]
Length=1046

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 99/173 (57%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCT-DG  178
            ER+AL+ FK  +        S  G +  CC+W G+ C+N T+  +         L T D 
Sbjct  37   EREALIDFKDGLEDPENRLSSWRGSN--CCQWWGIHCNNTTSAVIEVDLRNPHPLNTFDD  94

Query  179  PPCYPGL--LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLF  346
             P   G   L GEI  SL  L  L  LDLSFN F    IP+F G+L NL YL+LS+    
Sbjct  95   SPGRYGFWNLSGEIRRSLKMLQSLKHLDLSFNTFNGISIPAFFGTLKNLQYLNLSHAGFS  154

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL  505
            G +PP+LGN+SSL+YLD+ +NF+       VD L+W++ + S+EYLNM+G DL
Sbjct  155  GGIPPNLGNLSSLRYLDVSSNFVS------VDNLQWVTGMRSMEYLNMNGADL  201



>gb|KHG30701.1| hypothetical protein F383_11023 [Gossypium arboreum]
Length=254

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 107/176 (61%), Gaps = 12/176 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK+ +I    S  S     D CC+W GV C N +TGHV  LHL          
Sbjct  36   EREALLKFKNDLIDPSNSLSSWMEGGD-CCEWSGVVCHN-STGHVHKLHLA-----APLS  88

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P     L+G+I PSLL L  L+FLDLS N+F    IP F+G L NL+YL+LS+    G +
Sbjct  89   PYEQSALRGKINPSLLELEHLSFLDLSNNNFSSIHIPKFLGMLVNLMYLNLSFARFQGEI  148

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P +LGN++ L+YLD+ +N  +  D+K   +L+WIS LSSL+YL++   DL   ++W
Sbjct  149  PHNLGNLTKLQYLDLRSN--ERGDIKAT-SLQWISGLSSLQYLDLSESDLSKATNW  201



>ref|XP_010068699.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
Length=912

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 92/180 (51%), Gaps = 10/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+  +I       S    D  CC+WKGV C    TGHV  L L    L TD  
Sbjct  38   EREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVECSK-KTGHVFKLDLRNPCLETDIY  94

Query  182  PCYPGLLQGEIxpsllhlpflnf------ldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                G  Q  +   +              L L+    ++IP F G+L  L YL+LS+   
Sbjct  95   GDIIGSDQSSLAGKIHASLAELKHLKYLDLSLNKFSKKKIPLFFGTLQRLEYLNLSFAGF  154

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             GN+P HLGN+S+L+YLD+   F  G     +D L+W+S LSSL+YL + G DL + +DW
Sbjct  155  DGNIPHHLGNLSNLQYLDLA-CFGKGWGYLTIDNLQWVSKLSSLKYLRLSGNDLGNATDW  213



>ref|XP_004969084.1| PREDICTED: receptor-like protein kinase 5-like [Setaria italica]
Length=956

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 105/176 (60%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+F+        ++  S  + D CC+WKGV C N  + H+V L L  +G   D  
Sbjct  42   ERSALLTFR--AGLSDPANRLSSWEGDSCCQWKGVQCSN-RSSHIVKLDL--QGPDCDNS  96

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfER--IPSFIGSLNNLVYLDLSYNNLFGNV  355
                 +L G I  SL+ L  L +LDLS N F++  IP F+GS + L YLDLS ++L G +
Sbjct  97   DASMQVLGGNISSSLIVLQQLQYLDLSCNRFDKVQIPEFLGSFHELRYLDLSQSSLVGRI  156

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S+L+YL++ + F D     +     W+S LSSLE+L+M  V+L ++++W
Sbjct  157  PPQLGNLSNLRYLNLDSIFGDTHSTDIT----WLSRLSSLEHLDMSWVNLSTITNW  208



>gb|KCW64526.1| hypothetical protein EUGRSUZ_G02127 [Eucalyptus grandis]
Length=838

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 95/183 (52%), Gaps = 19/183 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-------GLE  160
            ER+ALL F+  +I       S    D  CC+WKGV C    TGHV  L L         +
Sbjct  38   EREALLKFRQGLIDHSKRLSSWTSKD--CCEWKGVQCSK-KTGHVFKLDLRNPCFETSPD  94

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfl--dlsfndfERIPSFIGSLNNLVYLDLSY  334
            G C D        L G+I  SL  L  L +L   L+    ++IP F G+L  L YL+LS 
Sbjct  95   GYCLDKSS-----LAGKIHASLAELKHLKYLDLSLNNFSMQKIPQFFGTLQRLEYLNLSS  149

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                GN+P HLGN+S+L YLD+ + F  G+     D L+W+S LSSL+Y ++  +DL   
Sbjct  150  AGFDGNIPHHLGNLSNLWYLDLASEF--GEGYLTSDNLQWVSKLSSLKYFHLALIDLRKA  207

Query  515  SDW  523
             DW
Sbjct  208  KDW  210



>gb|KEH25160.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1538

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 18/175 (10%)
 Frame = +2

Query  2     ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
             ER+ALL FK ++I   ++  S  G++  CCKW+G+ C N+T G+V +L+L         P
Sbjct  1131  ERQALLKFKDALIHSKVNLTSWKGEE--CCKWEGISCHNLT-GYVTSLNLK--------P  1179

Query  182   PCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNVP  358
               Y   + G++  S+  L  L  L+L     E +IP  IGSL  L+ L L YNN FG +P
Sbjct  1180  FDYTKAVGGKLDYSICELQHLISLNLDNIGLEGKIPKCIGSLGKLIELKLMYNNFFGVIP  1239

Query  359   PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             P LGN+S+L+ LD+ +N++   D      LEW+S+LS L YL++  V+L    DW
Sbjct  1240  PSLGNLSNLQTLDLSHNYLTAND------LEWLSHLSDLRYLDLSEVNLTLAIDW  1288


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 11/82 (13%)
 Frame = +2

Query  278  RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWI  457
            +IP  IGSL+ L+ L+L YN   G +PP LGN+S         NF+        + LEW+
Sbjct  79   KIPKCIGSLDKLIELNLGYNYFVGVIPPSLGNLS---------NFLINS--LTANDLEWL  127

Query  458  SYLSSLEYLNMDGVDLHSVSDW  523
            S+LS+L Y+++  V+L    DW
Sbjct  128  SHLSNLRYIDLSYVNLTLAIDW  149



>gb|KJB45901.1| hypothetical protein B456_007G3361002, partial [Gossypium raimondii]
Length=301

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 105/183 (57%), Gaps = 17/183 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGL-----EGL  166
            ER+ALL FK+ +I       S     D CC+W GV C N +TGHV  LHL       +G 
Sbjct  13   EREALLKFKNHLIDPSNRLSSWVEGGD-CCEWTGVVCHN-STGHVNQLHLAAPLSEPDGF  70

Query  167  CTDGP--PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSY  334
             T+      Y   L G+I PSLL L  L+ LDLS+NDF    IP F G L +L YL+L  
Sbjct  71   ATNAEMEAYYNSRLGGKINPSLLELKHLSSLDLSYNDFNSIHIPKFFGLLESLTYLNLCR  130

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                G +P +LGN+S L+YLD+G N +  +      TL+W+S LSSL+YL++   DLH+ 
Sbjct  131  AQFQGAIPHNLGNLSKLQYLDLGGNNLKSK------TLQWVSGLSSLQYLDLSYADLHTA  184

Query  515  SDW  523
            +DW
Sbjct  185  NDW  187



>ref|XP_007220932.1| hypothetical protein PRUPE_ppa023754mg [Prunus persica]
 gb|EMJ22131.1| hypothetical protein PRUPE_ppa023754mg [Prunus persica]
Length=955

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 95/180 (53%), Gaps = 15/180 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FK  ++       S  S     DCC+W GV C N  TGHV+ L L  +     
Sbjct  44   ERQALLAFKRGLVDKFDVLSSWGSEAQKQDCCRWIGVSCSN-QTGHVLQLDLSYK--VVG  100

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndf---ERIPSFIGSLNNLVYLDLSYNNLF  346
                   LL+G++    L                    IP FIGSL+NL YLDLSY N  
Sbjct  101  AHSWNYSLLEGKMISPKLIELQYLHHLDLHEINFNGSHIPDFIGSLSNLRYLDLSYTNFG  160

Query  347  GNVPPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G  P  +GN+++L++LD+  N+FI+ ++      L+W+  LSSL YL++ G +L++V DW
Sbjct  161  GKFPSQVGNLTNLQHLDLRFNDFINAEN------LDWLPLLSSLRYLDLSGTNLNNVFDW  214



>ref|XP_010231995.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Brachypodium distachyon]
Length=985

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 85/179 (47%), Gaps = 12/179 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVAL-----HLGLEGL  166
            ER ALLSFK + ++   +S         CC W GV C ++ TGHVV L     H   E  
Sbjct  44   ERAALLSFK-AGVTSDPASRLDSWSGHGCCHWSGVSC-SVRTGHVVELDLHNDHFFAELS  101

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLF  346
              D P    G +   +             +   N    IP F+GSL  L YLDLS  N  
Sbjct  102  GADAPHSMSGQISSSLPALRHLKHLDLSGNYLGNGMP-IPEFVGSLKRLTYLDLSNMNFI  160

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G VPP LGN+S L +LDI + +     + +     W++ L SLE+LNM  V+L +  DW
Sbjct  161  GTVPPQLGNLSKLVHLDISSVYFPTHSMDI----SWLARLQSLEHLNMGTVNLSAAVDW  215



>ref|XP_010246690.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Nelumbo nucifera]
Length=897

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 104/186 (56%), Gaps = 23/186 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslssw-gddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL+FK  +        S      +DCC W+GVGCDN  TGHVV L L  +    DG
Sbjct  37   EREALLNFKKGLKDSSNRLSSWDWNGSEDCCSWEGVGCDN-RTGHVVRLEL--QNPYADG  93

Query  179  ---------PPCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLD  325
                       C  G   GEI   LL L  L  LDLS NDF   RIP F+GS  +L YL+
Sbjct  94   YDEKYYETYERCKIG---GEINSHLLELKHLKHLDLSSNDFGGSRIPEFLGSFQSLEYLN  150

Query  326  LSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL  505
            L  +   G VP  LGN+S+L+YLD+GN +     L  V+ L+W+S+LSSL YL+M  V+L
Sbjct  151  LFDSGFVGKVPHQLGNLSNLQYLDMGNGY-----LLHVEDLQWLSHLSSLHYLDMSSVNL  205

Query  506  HSVSDW  523
               SD+
Sbjct  206  SKASDY  211



>ref|XP_010253421.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Nelumbo nucifera]
Length=1043

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 101/175 (58%), Gaps = 21/175 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+AL+ FK  +        S  G+D  CC W GVGCDN TTGHV+ L+L          
Sbjct  38   ERQALIKFKKGLHYHLSGVSSWVGED--CCAWFGVGCDN-TTGHVLKLNL----------  84

Query  182  PCYPGLLQGEIxpsllhlpflnfldls-fndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              +   L GE+ P LL L  LN+LDLS       IPSF+GS+ NL YL+LS +   G VP
Sbjct  85   --HSSELSGEVNPFLLDLKHLNYLDLSGNTFLGEIPSFLGSMKNLRYLNLSSSLFSGVVP  142

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             HLGN+SSLK LD+G     G    ++D L+W+S+LSSL++L++       VS W
Sbjct  143  RHLGNLSSLKQLDLG-----GNPNLIIDNLQWLSHLSSLQHLDLSTAMFQRVSGW  192



>ref|XP_009607039.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana tomentosiformis]
Length=1051

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 10/151 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGL--LQGEIxpsllhlpflnfldl  259
            CCKW+G+GC N TTG V+ + L              G   L GEI PSLL +  L +LDL
Sbjct  62   CCKWRGIGCSN-TTGSVIKIDLHNPFPVNSADVTRYGFWNLSGEIRPSLLKIQSLQYLDL  120

Query  260  sfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLK  433
            S N F    IP F+GSL NL YL+LS    FG +PP LGN+S L+YLD+ + F       
Sbjct  121  SLNTFGGIPIPRFVGSLKNLEYLNLSKAGFFGTIPPTLGNLSHLQYLDVSSEF----SAV  176

Query  434  VVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
             V++ +W++YL SL++L M+ VDL  V S W
Sbjct  177  TVESFQWVTYLVSLKHLGMNQVDLSMVGSSW  207



>gb|KCW64537.1| hypothetical protein EUGRSUZ_G02140, partial [Eucalyptus grandis]
Length=855

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 95/182 (52%), Gaps = 15/182 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  +I       S    D  CC+WKGV C    TGH+    L L   C +  
Sbjct  38   EREALLKFKQGLIDHSKRLSSWTSKD--CCEWKGVKCSK-KTGHI--FKLDLRNPCFETS  92

Query  182  P-----CY-PGLLQGEIxpsllhlpfln--fldlsfndfERIPSFIGSLNNLVYLDLSYN  337
            P     C     L G+I  SL  L  L    L L+    ++IP F G+L  L YL+LS  
Sbjct  93   PNGYISCLDKSSLAGKIHASLAELKHLKYLDLSLNKFSKQKIPQFFGTLQRLEYLNLSSA  152

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
               GN+P HLGN+S+L+YLD+ + F +G      + L+W+S LSSL+Y ++  +DL    
Sbjct  153  GFDGNIPHHLGNLSNLQYLDLASRFGEGS--LTTNNLQWVSKLSSLKYFHLSSIDLGKSK  210

Query  518  DW  523
            DW
Sbjct  211  DW  212



>gb|KJB45924.1| hypothetical protein B456_007G338300 [Gossypium raimondii]
Length=937

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 91/174 (52%), Gaps = 16/174 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK+ +I    S  S     D CCKW GV C N +TGHV  LHL       D  
Sbjct  35   EREALLKFKNHLIDPSNSLSSWVEGGD-CCKWIGVVCHN-STGHVHQLHLAALS-SYDQS  91

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
               P LL+       L       L  +      IP F+G L +L YL+LS     G +P 
Sbjct  92   AINPSLLE-------LKHLSFLDLSNNNFGSIPIPKFLGMLESLTYLNLSNAQFQGAIPH  144

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +LGN+S L YLD+G N++  +      +L+W+S LSSLEYL++   DLH  +DW
Sbjct  145  NLGNLSKLHYLDLGGNYLKPK------SLQWVSGLSSLEYLDLSSADLHKANDW  192



>ref|XP_009342502.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X1 [Pyrus x bretschneideri]
Length=994

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 94/187 (50%), Gaps = 19/187 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FKH ++       S        DCCKW GV C N  T HV  LHLG   L   
Sbjct  52   EREALLAFKHGLVDHYHLLSSWGREEHKQDCCKWVGVHCSN-RTNHVTQLHLGWYSLNES  110

Query  176  GPPCYPG-------LLQGEIxpsllhlpflnf---ldlsfndfERIPSFIGSLNNLVYLD  325
                  G        LQG++    L          L     +  R+P FIGSL+NL++LD
Sbjct  111  YSHQQKGDTQDINYFLQGKMMSPKLLELQHLKYLDLSSINFNGTRLPYFIGSLSNLIHLD  170

Query  326  LSYNNLFGNVPPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVD  502
            LSY +  G  P  +GN++ L+YLD+  N+F   ++L       W+  LSSL Y+++ G +
Sbjct  171  LSYASFGGRFPSQVGNLTHLQYLDLRWNDFNRAENLN-----SWLPRLSSLTYVDLSGTN  225

Query  503  LHSVSDW  523
            L +V DW
Sbjct  226  LSNVHDW  232



>gb|KJB45925.1| hypothetical protein B456_007G338400 [Gossypium raimondii]
Length=802

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 87/148 (59%), Gaps = 16/148 (11%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKW GV C N +TGHV  LHL         PP  P  L G+I PSLL L  LN LDLS+
Sbjct  62   CCKWIGVVCHN-STGHVNQLHLA-------APPLSPSALGGKINPSLLELKHLNSLDLSY  113

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N F    IP F   L +L YL+LSY    G +P +LGN+S L+YLD+  N  + +     
Sbjct  114  NSFSSIHIPKFFSLLESLTYLNLSYAQFQGTIPHNLGNLSKLQYLDLRGNHHEQK-----  168

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              L+W+S LSSL++L++ G DL   +DW
Sbjct  169  -ILQWVSGLSSLQHLDLSGADLSKATDW  195



>gb|KJB45928.1| hypothetical protein B456_007G338700 [Gossypium raimondii]
Length=1028

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 17/183 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGL-----EGL  166
            ER+ALL FK+ +        S     D CC+W GV C N +TGHV  LHL       +  
Sbjct  41   EREALLKFKNHLFDPSNRLSSWVEGGD-CCEWTGVVCHN-STGHVNQLHLAAPLSVPDAF  98

Query  167  CTDGP--PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSY  334
             T+      +  LL G+I PSLL L  L+ LDLS+N F    IP F G L +L YL+LS 
Sbjct  99   ATNAEWEAYHNSLLGGKINPSLLELKHLSSLDLSYNIFSSIHIPKFFGLLESLTYLNLSR  158

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
            +   G +P +LGN+S L+YLD+G     G DLK   TL+W+S LSSL+YL++   DLH+ 
Sbjct  159  SQFQGAIPHNLGNLSKLQYLDLG-----GNDLK-SKTLQWVSGLSSLQYLDLSYADLHTA  212

Query  515  SDW  523
            +DW
Sbjct  213  NDW  215



>ref|XP_009342503.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 isoform X2 [Pyrus x bretschneideri]
Length=970

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 94/187 (50%), Gaps = 19/187 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FKH ++       S        DCCKW GV C N  T HV  LHLG   L   
Sbjct  52   EREALLAFKHGLVDHYHLLSSWGREEHKQDCCKWVGVHCSN-RTNHVTQLHLGWYSLNES  110

Query  176  GPPCYPG-------LLQGEIxpsllhlpflnf---ldlsfndfERIPSFIGSLNNLVYLD  325
                  G        LQG++    L          L     +  R+P FIGSL+NL++LD
Sbjct  111  YSHQQKGDTQDINYFLQGKMMSPKLLELQHLKYLDLSSINFNGTRLPYFIGSLSNLIHLD  170

Query  326  LSYNNLFGNVPPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVD  502
            LSY +  G  P  +GN++ L+YLD+  N+F   ++L       W+  LSSL Y+++ G +
Sbjct  171  LSYASFGGRFPSQVGNLTHLQYLDLRWNDFNRAENLN-----SWLPRLSSLTYVDLSGTN  225

Query  503  LHSVSDW  523
            L +V DW
Sbjct  226  LSNVHDW  232



>ref|XP_006490685.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
Length=959

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 97/180 (54%), Gaps = 21/180 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FK S++ +     S     +  DCCKW GVGC N  TGHV+ L +  + +  D
Sbjct  37   EREALLTFKESLVDESGVLSSWGPEDEKRDCCKWTGVGCSN-RTGHVIKLEI--QPIDFD  93

Query  176  GPPCY----PGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
              P      P LLQ       LH      L L+      IP FIGSL  L YLDLS+   
Sbjct  94   SFPLRGTISPALLQ-------LHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLSFAEF  146

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G +P HLGN+S+L++LD+  N      L  V  L+W+S+LSSL YL++   +L   +DW
Sbjct  147  EGPIPSHLGNLSALQHLDLSLN-----HLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDW  201



>gb|KJB45216.1| hypothetical protein B456_007G295800 [Gossypium raimondii]
Length=1027

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 102/180 (57%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLG-----LEGL  166
            ER+ALL FK ++        S     + CC W G+ CDN+T GHV+ LHLG      E  
Sbjct  53   ERQALLRFKQNLTDPSDQLASWSNGGN-CCDWTGLVCDNLT-GHVIELHLGNLHNPTEDT  110

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNL  343
               G P     L G++  SLL L  L +LDLS N+F  +IP F+GSL+NL YL+LS    
Sbjct  111  GFPGEPFERSRLSGKVVSSLLDLKHLRYLDLSGNNFGGQIPGFLGSLHNLRYLNLSNAGF  170

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G+VPP LGN++ L+YLD+ +           + L+W++YL+ L+ L++ GV L   S W
Sbjct  171  EGSVPPQLGNLTHLQYLDLHDTL---STYLYAENLQWLTYLTKLKSLDLSGVTLSKASHW  227



>ref|XP_008804946.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Phoenix dactylifera]
Length=942

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 90/148 (61%), Gaps = 7/148 (5%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+W GV CDN  TGHV+A+ L  + L  D  P     L GEI  SLL L  L +LDLS 
Sbjct  63   CCEWTGVSCDN-KTGHVIAIDLRCQHLYDD--PSTDWHLGGEIGSSLLDLKHLKYLDLSS  119

Query  266  ndf--ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N+F    IP +IGS+  L YL+LS     G +P  LGN+S+L+YLD+ N+F    DL   
Sbjct  120  NNFGGRSIPQYIGSMTGLRYLNLSNAAFSGRIPHQLGNLSNLEYLDL-NSFYSLYDLN-A  177

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            D ++W+S LSSL YL+M  V L   SDW
Sbjct  178  DGIQWLSNLSSLRYLDMTRVTLAKASDW  205



>ref|XP_003636151.1| Receptor protein kinase-like protein, partial [Medicago truncatula]
Length=561

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 17/175 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+ +I  +     S  G++  CCKW+G+ CDN T  HV+ L+L         P
Sbjct  35   ERRALLKFRDAINLNREFISSWKGEE--CCKWEGISCDNFT-HHVIGLNLE--------P  83

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              Y   L+G++  S+  L  L  L+L+ N FE +IP  IGSL+ L+ L+L +N+  G +P
Sbjct  84   LNYTKELRGKLDSSICELQHLTSLNLNGNQFEGKIPKCIGSLDKLIELNLGFNHFVGVIP  143

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGN+S+L+ LD+ +N+    D+ + + LEW+S+LS+L YL++  V+L    DW
Sbjct  144  PSLGNLSNLQTLDLSSNY----DM-ISNDLEWLSHLSNLRYLDLSNVNLTLAVDW  193



>ref|XP_003633794.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Vitis vinifera]
Length=988

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 94/150 (63%), Gaps = 10/150 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKW+GV C+N  +GHV+ L+L    L  DG     G L GEI  SLL L +LN LDLS 
Sbjct  69   CCKWRGVVCNN-RSGHVIKLNL--RSLDDDG---TSGKLGGEISLSLLDLKYLNHLDLSM  122

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGN--NFIDGQDLK  433
            N+FE  RIP FIGSL  L YL+LS  +  G +PP LGN+S L YLD+    +F    D  
Sbjct  123  NNFEGTRIPKFIGSLERLRYLNLSGASFSGPIPPQLGNLSRLIYLDLREYFDFNTYPDES  182

Query  434  VVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              + L+WIS LSSL +LN++G++L   S +
Sbjct  183  SQNDLQWISGLSSLRHLNLEGINLSRASAY  212



>ref|XP_010111049.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
 gb|EXC29911.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Morus 
notabilis]
Length=952

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 88/150 (59%), Gaps = 20/150 (13%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYP---GLLQGEIxpsllhlpflnfld  256
            CCKW+GV C N  T HV+A+H+         PP       L QG I  SL+ L  L  L+
Sbjct  69   CCKWEGVHCSN-QTNHVIAIHI---------PPQQVIGYSLAQGAINRSLIELQQLESLN  118

Query  257  lsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDI-GNNFIDGQDLK  433
            LS N   +IP F+G L NL YLDLS  ++ G +P  LGN+ ++KYLD+ GN++   Q+LK
Sbjct  119  LSSNYIRQIPPFLGFLGNLRYLDLSNTDVSGAIPTELGNLFNIKYLDLSGNSYAQVQNLK  178

Query  434  VVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
                  W+S LSSLEYL++  ++L    DW
Sbjct  179  ------WLSNLSSLEYLDLSLLNLSKSHDW  202



>ref|XP_011005448.1| PREDICTED: receptor-like protein 12 isoform X1 [Populus euphratica]
 ref|XP_011005449.1| PREDICTED: receptor-like protein 12 isoform X1 [Populus euphratica]
 ref|XP_011005450.1| PREDICTED: receptor-like protein 12 isoform X1 [Populus euphratica]
Length=948

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 95/176 (54%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK  II +     S     +  DCCKW+GVGCDN+T GHV +L+L    L   
Sbjct  45   ERQALLKFKEDIIDEYGVLSSWGGEEEKRDCCKWRGVGCDNVT-GHVTSLNLHSSPLYEH  103

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                +  L+       L             N  E I  FIGSL++L YL+LSYN     +
Sbjct  104  N---FTPLIGKVSNSLLELQHLNYLDLSLNNLDESIMDFIGSLSSLRYLNLSYNLFTVTI  160

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P HL N+S L+ LD+  +F D      V+ L W+S+LSSLE+L++ G DL  V+DW
Sbjct  161  PYHLKNLSRLQSLDLSYSF-DAS----VENLGWLSHLSSLEHLDLSGSDLSKVNDW  211



>gb|KJB26590.1| hypothetical protein B456_004G248900 [Gossypium raimondii]
Length=1007

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 104/186 (56%), Gaps = 20/186 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL+FK  II       S   + +DCCKW GV CDNI TGHV  L L         P
Sbjct  35   ERQALLNFKQDIIDRSNRLSSWSKNGEDCCKWLGVYCDNI-TGHVYKLDLK----PPSSP  89

Query  182  PCYP----------GLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLD  325
            P Y            +L+G+I PSLL L  L  LDLS N+F    IPSF+GS+ +L +LD
Sbjct  90   PVYASDAEFGVYWRSILRGKINPSLLSLNHLVHLDLSHNNFGGTLIPSFLGSMESLTFLD  149

Query  326  LSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL  505
            LS  +  G +P  LGN+S L++L++G N      L     L+W+S  SSLE+L++  VDL
Sbjct  150  LSDAHFGGVIPHQLGNLSELQHLNLGGN---SNKLFEAKNLQWLSGFSSLEFLDLSQVDL  206

Query  506  HSVSDW  523
                DW
Sbjct  207  SKAIDW  212



>ref|XP_004980222.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930-like [Setaria italica]
Length=951

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 88/149 (59%), Gaps = 13/149 (9%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHL-GLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldls  262
            CC+WKGV C N  T HVV L L G  G   +        L GE+  SL+ L  L +LDLS
Sbjct  68   CCQWKGVHCSN-RTSHVVKLDLHGDVGHSENA-------LGGEMSSSLVELQHLKYLDLS  119

Query  263  --fndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKV  436
              + +   IP FIGSL NL YL+LS+    G +PP LGN+S+L YLD+GNN+        
Sbjct  120  CNYFNGSSIPKFIGSLKNLEYLNLSFAQFLGRIPPQLGNLSNLVYLDLGNNYY--CSYLY  177

Query  437  VDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             D+L W+S+LS L+YL+M   +L +  DW
Sbjct  178  SDSLIWVSHLSQLKYLDMSWANLSAAVDW  206



>ref|XP_002265946.1| PREDICTED: receptor-like protein kinase 2 [Vitis vinifera]
Length=969

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 105/177 (59%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKALL FK+ +     +  S  G D  CCKWKGV C+N  TGHVV + L   G      
Sbjct  45   ERKALLEFKNGLKEPSRTLSSWVGAD--CCKWKGVDCNN-QTGHVVKVDLKYGG------  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L GEI  SLL L  LN+LDLSFNDF+   IP+F+GS   L YL+LS+    G +
Sbjct  96   ------LGGEISDSLLDLKHLNYLDLSFNDFQGIPIPNFLGSFERLRYLNLSHAAFGGMI  149

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL-HSVSDW  523
            PPHLGN+S L YLD+  ++     L  V  L W+S LSSL+YL++  V+L  + ++W
Sbjct  150  PPHLGNLSQLCYLDLSGDYYSRAPLMRVHNLNWLSGLSSLKYLDLGNVNLSKATTNW  206



>ref|XP_008218773.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Prunus mume]
Length=891

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 92/174 (53%), Gaps = 18/174 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL+FK  +       +S  G+ D CC W GV C N+T GHV  L LG   L     
Sbjct  37   ERRALLTFKQDLNDSSNQLMSWDGEGD-CCNWTGVVCHNLT-GHVRKLRLGNYYLAGKLN  94

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
            P    L                 L  +  +  +IP+F GSL +L +LDLS  +  G +PP
Sbjct  95   PSLLNL----------KNLHYLDLSNNDFEGRQIPNFFGSLASLRHLDLSQADFQGIIPP  144

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S+L+YLD+ +N+ +      V  L+WIS LS L++L+M G++L    DW
Sbjct  145  QLGNLSNLRYLDLHDNYFE------VKNLQWISDLSLLQHLDMSGINLREAGDW  192



>gb|KEH16824.1| leucine-rich receptor-like kinase family protein, putative [Medicago 
truncatula]
Length=992

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 17/175 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+ +I  +     S  G++  CCKW+G+ CDN T  HV+ L+L         P
Sbjct  72   ERRALLKFRDAINLNREFISSWKGEE--CCKWEGISCDNFT-HHVIGLNLE--------P  120

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              Y   L+G++  S+  L  L  L+L+ N FE +IP  IGSL+ L+ L+L +N+  G +P
Sbjct  121  LNYTKELRGKLDSSICELQHLTSLNLNGNQFEGKIPKCIGSLDKLIELNLGFNHFVGVIP  180

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGN+S+L+ LD+ +N+    D+ + + LEW+S+LS+L YL++  V+L    DW
Sbjct  181  PSLGNLSNLQTLDLSSNY----DM-ISNDLEWLSHLSNLRYLDLSNVNLTLAVDW  230



>gb|EAY81349.1| hypothetical protein OsI_36521 [Oryza sativa Indica Group]
Length=692

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 90/175 (51%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL+FK  I  DP   L+S      DCC+W+GV C N+T GHV+ LHL       D 
Sbjct  38   EREALLAFKRGITGDPAGRLTSWKRGSHDCCQWRGVRCSNLT-GHVLELHLRNNFPRYDE  96

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
                 G +   +             +       R P F+ SL NL+Y++ S   L G VP
Sbjct  97   ATALVGHISTSLISLEHLEHLDLSNNNLVGPAGRFPRFVSSLRNLIYINFSGMPLTGMVP  156

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGNI+ L+YLD+ +    G  +   D ++W++ L +L YL +  V+L  VSDW
Sbjct  157  PQLGNITKLQYLDLSH----GIGMYSTD-IQWLTNLPALRYLGLSNVNLSRVSDW  206



>ref|NP_001068112.1| Os11g0568200 [Oryza sativa Japonica Group]
 gb|ABA94274.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
 dbj|BAF28475.1| Os11g0568200 [Oryza sativa Japonica Group]
 gb|EAZ18772.1| hypothetical protein OsJ_34300 [Oryza sativa Japonica Group]
Length=645

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 90/175 (51%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL+FK  I  DP   L+S      DCC+W+GV C N+T GHV+ LHL       D 
Sbjct  38   EREALLAFKRGITGDPAGRLTSWKRGSHDCCQWRGVRCSNLT-GHVLELHLRNNFPRYDE  96

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
                 G +   +             +       R P F+ SL NL+Y++ S   L G VP
Sbjct  97   ATALVGHISTSLISLEHLEHLDLSNNNLVGPAGRFPRFVSSLRNLIYINFSGMPLTGMVP  156

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGNI+ L+YLD+ +    G  +   D ++W++ L +L YL +  V+L  VSDW
Sbjct  157  PQLGNITKLQYLDLSH----GIGMYSTD-IQWLTNLPALRYLGLSNVNLSRVSDW  206



>ref|XP_009340354.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 isoform X1 [Pyrus x bretschneideri]
Length=934

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 68/179 (38%), Positives = 95/179 (53%), Gaps = 20/179 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-----swgddddCCKWKGVGCDNITTGHVVALHLGLEGL  166
            ER+ALL+FK  +I D  + +      +     DCC+WKGV CDN  TGHVV L LG + L
Sbjct  33   EREALLAFKKGLIMDEDNQVIFSSWGTEAAKQDCCRWKGVSCDN-QTGHVVQLDLGDDFL  91

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLF  346
               G    P L++       L       L   F +   +P FIGSL NL +LDLS+    
Sbjct  92   --QGTMISPKLIE-------LKHLRYLDLKGIFFNGSTVPDFIGSLTNLTHLDLSWCYFG  142

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G  P  +GN+++L+YLD+  N     D   V+ L W++ LSSL YL++   +L +  DW
Sbjct  143  GKFPIQVGNLTNLQYLDLSAN-----DFYNVENLNWLTRLSSLTYLDLSFANLRNAFDW  196



>ref|XP_002315907.2| scab resistance family protein [Populus trichocarpa]
 gb|EEF02078.2| scab resistance family protein [Populus trichocarpa]
Length=994

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 107/176 (61%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +  D    LS  G+D  CC WKGV C N  TGHVV L L    +     
Sbjct  35   ERDALLKFKQGLTDDSGQLLSWIGED--CCTWKGVSCSN-RTGHVVQLDLRNRQVSFANK  91

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L+GEI  SLL+L  L++LDLS N+F+   IP+F+GSL NL YL+LS+ +  G V
Sbjct  92   TT----LRGEINHSLLNLTRLDYLDLSLNNFQGAEIPAFLGSLKNLKYLNLSHASFNGQV  147

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              HLGN+S+L+YLD+  N+     LK VDTL+W S L SL++L++ G+ L    DW
Sbjct  148  SHHLGNLSNLQYLDLSWNY----GLK-VDTLQWASTLPSLKHLDLSGLKLTKAIDW  198



>gb|KEH29514.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1037

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 14/146 (10%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+W+G+ CDN  TG V+++ L         PP +   L GE+ PSL+ L  L  LDLSF
Sbjct  59   CCQWRGIYCDN-NTGAVISIDLH-----NPHPPSFDWKLSGELRPSLMKLKSLRHLDLSF  112

Query  266  ndfERIP--SFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N F  IP   F+GSL NL YL+LS     G +PPHLGN+S L+ +D+ +N +       V
Sbjct  113  NTFGEIPIPKFLGSLVNLQYLNLSTAGFAGLIPPHLGNLSHLQSIDLTDNSLH------V  166

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVS  517
            + L+W++ L SL+YL MDGVDL SV+
Sbjct  167  ENLQWVTGLVSLKYLAMDGVDLSSVA  192



>ref|XP_006599589.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Glycine max]
Length=630

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 100/176 (57%), Gaps = 16/176 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFKH +        S     D CC W GV C+N  TG V+ ++L        G 
Sbjct  38   ERNALLSFKHGLADPSNRFSSWSDKSD-CCTWPGVHCNN--TGKVMEINL----YTPAGS  90

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P     L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDL+ +   G +
Sbjct  91   PYRE--LSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLNLSGFMGLI  148

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S+L +L++G N+        +D L WIS LSSLEYL++ G DLH   +W
Sbjct  149  PHQLGNLSNLHHLNLGYNYA-----LQIDNLNWISRLSSLEYLDLSGSDLHKQGNW  199



>gb|EMS60284.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Triticum 
urartu]
Length=1016

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 16/184 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK  I SD  + L SW   D CC+W+G+GC+N  TGHVV LHL    +  D P
Sbjct  41   ERAALLSFKKGITSDSANLLISWDGQD-CCRWRGIGCNN-RTGHVVKLHLR-STIVEDNP  97

Query  182  -----PC-YPGLLQGEIxpsllhlpflnfldlsfn----dfERIPSFIGSLNNLVYLDLS  331
                 PC +   L GEI PSLL L  L  LDLS N       +I + +GS+ NL YLDLS
Sbjct  98   WGYYDPCEHDNSLFGEISPSLLSLKHLEHLDLSMNCLPGPNSKILNLMGSMTNLRYLDLS  157

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
                 G VP  LGN+S L+YLD+      G  +     + W++ L  L++L+M+GV L  
Sbjct  158  GIPFAGRVPSQLGNLSKLQYLDLAQT---GNSMMYSMDITWLAKLPFLQFLSMNGVQLSG  214

Query  512  VSDW  523
            ++DW
Sbjct  215  IADW  218



>gb|EAY81350.1| hypothetical protein OsI_36522 [Oryza sativa Indica Group]
Length=699

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 107/185 (58%), Gaps = 20/185 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL+FK  I +DP   L+S    + DCC+W+GV C N+T GHV+ LHL       + 
Sbjct  38   EREALLAFKRGITNDPAGRLASWKRGNHDCCRWRGVQCSNLT-GHVLELHLQ-----NNL  91

Query  179  PPCYPGL------LQGEIxpsllhlpflnfldlsfndfE----RIPSFIGSLNNLVYLDL  328
            P  Y         L G+I   LL L  L  LDLS N+      R P FIGSL NL+Y++ 
Sbjct  92   PEYYSDFEFKVTALVGKITTPLLALEHLEHLDLSNNNLTGPAGRFPGFIGSLRNLIYVNF  151

Query  329  SYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLH  508
            S   L G VPP LGN++ L+YLD+     +G  +   D ++W+++L SL YL++  V+L 
Sbjct  152  SGMPLTGMVPPQLGNLTKLQYLDLSRG--NGIGMYSTD-IQWLTHLPSLRYLDLSNVNLS  208

Query  509  SVSDW  523
             +SDW
Sbjct  209  RISDW  213



>ref|XP_006475703.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
ERL2-like [Citrus sinensis]
Length=543

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 103/176 (59%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALL FK  +I       S  GD++DCC W GV CDN  TGHV  L L          
Sbjct  4    EKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNF-TGHVRMLQL-------RNN  55

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P    +L G+I PSLL+L  L +LDLSFNDF   +IP F+GS+ NL YLDLS     G +
Sbjct  56   PSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYLDLSSAGFLGMI  115

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  L N+S+L+YLD+   ++        + L W+S LSSLE+L++  VDL   SDW
Sbjct  116  PHQLANLSNLQYLDLSQKYLG----LYAENLRWLSGLSSLEHLDLSNVDLSRASDW  167



>ref|XP_002315858.2| scab resistance family protein [Populus trichocarpa]
 gb|EEF02029.2| scab resistance family protein [Populus trichocarpa]
Length=995

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 108/176 (61%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  +  D    LS  G+D  CC WKGV C +  TGHVV L L    +     
Sbjct  35   EREALLKFKQGLTDDSGQLLSWVGED--CCTWKGVSCSH-RTGHVVQLELRNRQVSFANK  91

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L+GEI  SLL+L  L++LDLS N+F+   IP+F+GSL NL YL+LS+ +  G V
Sbjct  92   TT----LRGEINHSLLNLTRLDYLDLSLNNFQGAEIPAFLGSLKNLKYLNLSHASFNGQV  147

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              HLGN+S+L+YLD+  N+     LK VDTL+W S L SL++L++ G+ L    DW
Sbjct  148  SHHLGNLSNLQYLDLSWNY----GLK-VDTLQWASTLPSLKHLDLSGLKLTKAIDW  198



>gb|EEC68371.1| hypothetical protein OsI_36508 [Oryza sativa Indica Group]
Length=652

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 79/147 (54%), Gaps = 6/147 (4%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+W+GV C N+T GHVV L L  +   T       G +   +            ++   
Sbjct  75   CCQWRGVRCSNLT-GHVVKLRLRNDHAGT----ALAGEIGQSLISLEHLRYLDLSMNNLA  129

Query  266  ndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQ-DLKVVD  442
                 +P F+GS  +L YL+LS     G VPP LGN+S+L+YLD+    + G      ++
Sbjct  130  GSTGHVPEFLGSFRSLRYLNLSGIVFSGMVPPQLGNLSNLRYLDLSGIRLSGMVSFLYIN  189

Query  443  TLEWISYLSSLEYLNMDGVDLHSVSDW  523
               W+++LS+L+YLN+DGV+L +V DW
Sbjct  190  DGSWLAHLSNLQYLNLDGVNLSTVVDW  216



>ref|XP_006663530.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710-like [Oryza brachyantha]
Length=1006

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 94/181 (52%), Gaps = 10/181 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss----wgddddCCKWKGVGCDNITTGHVVALHLGLEGLC  169
            ER ALL+FK  I+ DP   L S     G   DCC+W+GV CD+  TGHVV LHL  +   
Sbjct  36   ERDALLAFKEGIVGDPAGLLRSWRRGRGQLQDCCRWRGVRCDS-RTGHVVKLHLRNDH--  92

Query  170  TDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFG  349
             D      G +   +            ++       R+P F+GS+ +L  L+LS     G
Sbjct  93   GDTETALVGEIGRSLISLEHLRYLDLSMNNLAGPTGRLPEFLGSMKSLRCLNLSGTMFSG  152

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLK---VVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
             VPP LGN+S+LKYLD+    +    +        + W++ LS L+YLN+DGV+L +V D
Sbjct  153  VVPPQLGNLSNLKYLDLSGMSLSSASMAPSLYSRDVSWLAQLSRLQYLNLDGVNLSTVLD  212

Query  521  W  523
            W
Sbjct  213  W  213



>gb|KHN42550.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Glycine 
soja]
Length=884

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 102/184 (55%), Gaps = 24/184 (13%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgdd-------ddCCKWKGVGCDNITTGHVVALHLGLE  160
            ER ALLSFKH +        S             DCC W G+ C+N  TG V+ ++L   
Sbjct  7    ERNALLSFKHGLADPSNRLSSWSDKSDCCTWPGVDCCTWPGIHCNN--TGQVMEINL---  61

Query  161  GLCTDGPPCYP-GLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLS  331
                D P   P   L GEI PSLL L +LN LDLS N      IPSF+GSL +L YLDLS
Sbjct  62   ----DTPVGSPYRELSGEISPSLLELKYLNRLDLSSNYFVLTPIPSFLGSLESLRYLDLS  117

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
             +   G +P  LGN+S+L++L++G N+        +D L W+S LSSLEYL++ G DLH 
Sbjct  118  LSGFMGLIPHQLGNLSNLQHLNLGYNYA-----LQIDNLNWLSRLSSLEYLDLSGSDLHK  172

Query  512  VSDW  523
              +W
Sbjct  173  QGNW  176



>ref|XP_010662805.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=945

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 95/149 (64%), Gaps = 10/149 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGL-LQGEIxpsllhlpflnfldls  262
            CC+W+ V C+N+ TG VV LHLG     TD    Y    L GEI P+LL L FL++L+LS
Sbjct  115  CCRWEAVRCNNV-TGRVVELHLG-NPYDTDDYEFYSKFELGGEISPALLELEFLSYLNLS  172

Query  263  fndf--ERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKV  436
            +NDF    IPSF+GS+ +L YLDLSY    G VP  LGN+S+L++LD+G N+        
Sbjct  173  WNDFGGSPIPSFLGSMGSLRYLDLSYAGFGGLVPHQLGNLSTLRHLDLGRNYG-----LY  227

Query  437  VDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            V+ L WIS+L  L+YL M+ VDLH    W
Sbjct  228  VENLGWISHLVFLKYLGMNRVDLHKEVHW  256



>ref|XP_007021422.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
 gb|EOY12947.1| Disease resistance family protein / LRR family protein [Theobroma 
cacao]
Length=969

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 89/188 (47%), Gaps = 23/188 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgd--dddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK S+                 DCC W GV C NI TG+V AL LG E     
Sbjct  39   ERQALLDFKQSLQLVDQVGDGDLSSWDGKDCCAWTGVYC-NIFTGYVEALDLG-EHFWLV  96

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                 P LL+ +             L  +  +  RIP FIGSL NL YLDLS  N  G +
Sbjct  97   AGTISPSLLKLQ-------HLSQLDLRKNDFNGSRIPEFIGSLKNLTYLDLSLGNFEGPI  149

Query  356  PPHLGNISSLKYLDIGNNFIDGQ------------DLKVVDTLEWISYLSSLEYLNMDGV  499
            P  LGN+S L+ L +G + +D               L  V  LEW+S L+SL+YL++   
Sbjct  150  PSQLGNLSKLETLRLGGDVLDPNHLYSMRFNKKFPKLFSVGNLEWLSRLTSLKYLDLSFT  209

Query  500  DLHSVSDW  523
            +L   SDW
Sbjct  210  NLSKASDW  217



>ref|XP_008338558.1| PREDICTED: receptor-like protein 12 [Malus domestica]
Length=979

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 102/177 (58%), Gaps = 12/177 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +  DCC W GV CD+IT GH+  LHL      +  
Sbjct  41   ERQALLMFKQDLKDPANRLSSWVAEEGSDCCSWTGVVCDHIT-GHIHELHLN----SSYS  95

Query  179  PPCYPGLLQGEIxpsllhlpflnfl-dlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
               +     G+I  SLL L  LN+L   +     +IPSF+GS+ +L +L+L  N+ FG V
Sbjct  96   DWHFNSFFSGKIISSLLSLKHLNYLDLSNNEFITQIPSFLGSMTSLTHLNLG-NSAFGGV  154

Query  356  PPH-LGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             PH LGN+SSL+YL+I N  I G  LK V+ L+WIS LS LE+L++  VDL   SDW
Sbjct  155  IPHKLGNLSSLRYLNISN--IYGTSLK-VENLKWISGLSLLEHLDLSSVDLSKASDW  208



>gb|KDO37541.1| hypothetical protein CISIN_1g045139mg [Citrus sinensis]
Length=820

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 105/178 (59%), Gaps = 19/178 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK  +I +     S  +  D  DCCKW+GV C N  TGHV  L+L        
Sbjct  45   ERQALLMFKQGLIDEYGHLSSWGNEDDKKDCCKWRGVSCSN-QTGHVTMLNLQFRSYMP-  102

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLDLSYNNLFG  349
                    L+G I  SL+ L  LN+L++ +NDF  ++IP+FIGSL N+ +LDLS     G
Sbjct  103  --------LRGNISSSLIGLQHLNYLNMKYNDFGGKQIPAFIGSLKNIRHLDLSNAGFTG  154

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             VP  LGN++SL+YLD+  NF    D+ +   LEW+S LS LEY+ ++ V+L   +DW
Sbjct  155  RVPYQLGNLTSLQYLDLSFNF----DM-LSKKLEWLSQLSFLEYVRLNQVNLGEATDW  207



>ref|XP_008232803.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Prunus mume]
Length=379

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 94/180 (52%), Gaps = 19/180 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FK  ++ +  S  S  S     DCC+W GV C N  T HV+ L+L  + +  D
Sbjct  44   ERQALLAFKRGLVDEDNSLSSWGSEAQKQDCCRWIGVYCSN-QTSHVIGLNLSYKVIGED  102

Query  176  ----GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                G    P L++       LH      L         IP FIGSL+NL YLDLS+ N 
Sbjct  103  YFLQGKMISPKLIE-------LHHLQHLDLYGIKFSGSEIPDFIGSLSNLRYLDLSWTNF  155

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G  P  +GN+++L+YL +  N     D   ++ L+W+  LSSL YL++   +L +V DW
Sbjct  156  GGKFPSQVGNLTNLQYLALSAN-----DFTNIENLDWLPLLSSLRYLDLSFANLSNVFDW  210



>ref|XP_008670802.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Zea mays]
 tpg|DAA42145.1| TPA: hypothetical protein ZEAMMB73_745147 [Zea mays]
Length=969

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 95/184 (52%), Gaps = 15/184 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss--wgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER ALL+FKH I SDP+  L+S       DCC+W+GV C N  TGHV  L L L  +   
Sbjct  43   ERDALLAFKHGISSDPMGLLASWHQKGYGDCCRWRGVRCSN-RTGHV--LKLRLRNVHVT  99

Query  176  GPPCYP--------GLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLS  331
                Y         G +   +      +     ++       +IP F+GSL NL YL++S
Sbjct  100  SSISYSLFRDTALIGHISHSLLALDQLVHLDLSMNNVTGSSGQIPDFLGSLVNLRYLNIS  159

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
                 G VPPHLGN+S L YLD+ +    GQ       + W++ LS LEYL+M  V+L +
Sbjct  160  GIPFSGTVPPHLGNLSKLMYLDLSSWVFQGQPYST--DISWLAGLSLLEYLDMSKVNLST  217

Query  512  VSDW  523
            V+DW
Sbjct  218  VADW  221



>gb|KEH16821.1| LRR receptor-like kinase family protein, partial [Medicago truncatula]
Length=260

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 101/175 (58%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL F+ +I  +     S  G+D  CCKW+G+ C+N T  HV+ L+L         P
Sbjct  11   ERRALLKFRDAINLNREFISSWKGED--CCKWEGISCNNFT-HHVIGLNLE--------P  59

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              Y   L+G++  S+  L  L  L+L  N+ E +IP  IGSL+ L+ L+L YN   G +P
Sbjct  60   LNYTKELRGKLDSSICELKHLTSLNLYRNNLEGKIPKCIGSLDKLIELNLGYNYFDGVIP  119

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P LGN+S+L+ LD+  N+         + LEW+S+LS+L YL++  V+L    DW
Sbjct  120  PSLGNLSNLQTLDLSENYYGMS----ANDLEWLSHLSNLRYLDLSYVNLTLAVDW  170



>ref|XP_010046667.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Eucalyptus grandis]
Length=990

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 80/160 (50%), Gaps = 20/160 (13%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHL---------------GLEGLCTD-GPPCYPGLLQGEIx  217
            CCKW GV CDN  TGHVV L L                 E    D  P C  G  Q    
Sbjct  67   CCKWVGVSCDN-DTGHVVKLDLRSPDICDDMGDDDDDASESAQEDYKPMCLSG--QVSPS  123

Query  218  psllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLD  397
               L       L  +      IPSF+GSL  L YL+LS  +  G +PP LGN+S+L YLD
Sbjct  124  LLALKYLTYLDLSHNNFQGNPIPSFLGSLKTLTYLNLSQASFGGLIPPQLGNLSNLHYLD  183

Query  398  IGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +  +F   Q+L+V D L W+S L SL YLN++GV+L   S
Sbjct  184  LTFDFYSRQELRVSD-LNWLSGLFSLNYLNLEGVNLRKGS  222



>ref|XP_007224548.1| hypothetical protein PRUPE_ppa024613mg, partial [Prunus persica]
 gb|EMJ25747.1| hypothetical protein PRUPE_ppa024613mg, partial [Prunus persica]
Length=735

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 97/176 (55%), Gaps = 17/176 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL--GLEGLCTD  175
            ER+ALL+F H +     + LSSW  + DC  W  V CDN+T GHV  LHL   ++ L   
Sbjct  7    ERQALLNFTHDLEDPYSNQLSSWAGEGDCGNWTAVVCDNLT-GHVCELHLVGHVDMLSGK  65

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
              P  P L                 L  +     +IPSF+GSL +L YL+LS +   G +
Sbjct  66   INPSLPNL----------KHLTYLDLSNNDFRRMQIPSFLGSLKSLRYLNLSESLFTGLI  115

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+ SL+ LD+ +++++ +    V++L+WIS LS L++L+M G +L   SDW
Sbjct  116  PHQLGNLKSLQVLDLHDSYLELE----VESLQWISGLSQLQHLDMSGANLSKASDW  167



>ref|XP_010046666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Eucalyptus grandis]
Length=650

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCT----------DGPPCY-PGLLQGEIxpsllh  232
            CC+W  V CDN   G VV LHL    +C             P  Y P  L G + PSLL 
Sbjct  64   CCEWVRVSCDN-DMGRVVKLHLRGSDICDVVDDDDDAPESAPEDYKPLCLSGHVSPSLLA  122

Query  233  lpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGN  406
            L  L +LDLS N+F+   IPSF+GSL  L YL+LS  +  G +PP LGN+S+L YLD+  
Sbjct  123  LKHLTYLDLSRNNFQGNPIPSFLGSLKRLTYLNLSQASFGGLIPPQLGNLSNLHYLDLTF  182

Query  407  NFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +F   Q+L+V D L W+S L SL YLN++GV+L   S
Sbjct  183  DFYSRQELRVSD-LNWLSGLFSLNYLNLEGVNLRKGS  218



>ref|XP_010918705.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Elaeis guineensis]
Length=1052

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 12/146 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+W+GVGCDN ++GHVV L L   G  +   P    L+                L ++ 
Sbjct  98   CCQWRGVGCDN-SSGHVVKLKLRFLGPTSKVNPSISSLIH----------LRHLDLSMNS  146

Query  266  ndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDT  445
                 IP FIGSL +L YL+LS +   G +P  +GN+S+L  LD+G        L+  D 
Sbjct  147  FSGAPIPEFIGSLMHLKYLNLSNSGFGGPIPRQIGNLSNLHSLDLGTKMYGSYALQ-ADD  205

Query  446  LEWISYLSSLEYLNMDGVDLHSVSDW  523
            L+W+S + SL+YL++  V+L   S+W
Sbjct  206  LQWLSRIPSLQYLDLSSVNLSMASNW  231



>gb|KCW86892.1| hypothetical protein EUGRSUZ_B03475, partial [Eucalyptus grandis]
Length=934

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 80/160 (50%), Gaps = 20/160 (13%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHL---------------GLEGLCTD-GPPCYPGLLQGEIx  217
            CCKW GV CDN  TGHVV L L                 E    D  P C  G  Q    
Sbjct  27   CCKWVGVSCDN-DTGHVVKLDLRSPDICDDMGDDDDDASESAQEDYKPMCLSG--QVSPS  83

Query  218  psllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLD  397
               L       L  +      IPSF+GSL  L YL+LS  +  G +PP LGN+S+L YLD
Sbjct  84   LLALKYLTYLDLSHNNFQGNPIPSFLGSLKTLTYLNLSQASFGGLIPPQLGNLSNLHYLD  143

Query  398  IGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +  +F   Q+L+V D L W+S L SL YLN++GV+L   S
Sbjct  144  LTFDFYSRQELRVSD-LNWLSGLFSLNYLNLEGVNLRKGS  182



>ref|XP_009375566.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Pyrus x bretschneideri]
Length=964

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 102/177 (58%), Gaps = 16/177 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E+ ALL FK  +I       S     D CC+W+G+ C+N  TGHV+ L L     C    
Sbjct  34   EKTALLQFKQGLIDKSNVLASWKTGRD-CCEWRGITCNN-ETGHVITLDL-----CYSSS  86

Query  182  PCYPG--LLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGN  352
              Y G   L G I PSLL LP+L  LDLSFN F+ +IP FIGSL+ L  L L+  NL G 
Sbjct  87   DIYNGETPLTGVIAPSLLELPYLTNLDLSFNHFQGQIPKFIGSLSRLEQLKLAGANLSGP  146

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP L N+SSL  LD+  N++        + LEW+S+LSSL YLNM G++   V +W
Sbjct  147  IPPQLRNLSSLHTLDLALNYV------TFENLEWLSHLSSLRYLNMSGLNFSKVVNW  197



>gb|EAY74833.1| hypothetical protein OsI_02725 [Oryza sativa Indica Group]
Length=953

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 96/177 (54%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER AL+SFK  ++       S  GDD  C +W GV C+N  TGH+V L+L   G C   P
Sbjct  40   ERSALISFKSGLLDPGNLLSSWEGDD--CFQWNGVWCNN-ETGHIVELNLP-GGSCNILP  95

Query  182  P---CYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            P     PGL        L      +      N    +P F+GSL+NL  LDLS++   G 
Sbjct  96   PWVPLEPGLGGSIGPSLLGLKQLEHLDLSCNNFSGTLPEFLGSLHNLRSLDLSWSTFVGT  155

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            VPP LGN+S+L+Y  +G+N  D   L   D + W+S LSSLE+L+M  V+L +V DW
Sbjct  156  VPPQLGNLSNLRYFSLGSN--DNSSLYSTD-VSWLSRLSSLEHLDMSLVNLSAVVDW  209



>ref|XP_010655653.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=993

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 105/177 (59%), Gaps = 19/177 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKALL FKH +        S  G D  CCKWKGV C+N  TGHVV + L   G  +   
Sbjct  45   ERKALLEFKHGLKDPSGRLSSWVGAD--CCKWKGVDCNN-QTGHVVKVDLKSGGAFSR--  99

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L GEI  SLL L  LN+LDLSFNDF+   IP+F+GS   L YL+LS   L G +
Sbjct  100  ------LGGEISDSLLDLKHLNYLDLSFNDFQGIPIPNFLGSFERLRYLNLSRAQLGGMI  153

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL-HSVSDW  523
            PPHLGN+S L+YLD     ++G     V  L W+S LSSL+YL++  V+L  + ++W
Sbjct  154  PPHLGNLSQLRYLD-----LNGGYPMRVSNLNWLSGLSSLKYLDLGHVNLSKATTNW  205



>gb|EEE52293.1| hypothetical protein OsJ_34286 [Oryza sativa Japonica Group]
Length=1561

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 91/178 (51%), Gaps = 7/178 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK+SI  DP+  L  W   DDCC+W+G+ C N  TGHV+ L L       DG 
Sbjct  32   ERDALLEFKNSITDDPMGQLKFWRRGDDCCQWRGIRCSN-RTGHVIKLQLWKPKFDDDGM  90

Query  182  PC----YPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFG  349
                    GL+   +             +        IP FIGS  NL YL+LS     G
Sbjct  91   SLVGNGMVGLISPSLLSLEHLQHLDLSWNNLSGSDGHIPGFIGSFRNLRYLNLSGMPFIG  150

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             VPP LGN+S L++LD+ +    G +++    + W+  +  L+YLN++ VDL +V +W
Sbjct  151  VVPPQLGNLSKLQFLDLSSCI--GLEMQSRSGMTWLRNIPLLQYLNLNSVDLSAVDNW  206



>ref|XP_006475701.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=633

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALLSFK  +        S +     DCCKW GV CDNI TGHV+ L L         
Sbjct  39   EREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNI-TGHVLELRLRNPSRDDGS  97

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfE------RIPSFIGSLNNLVYLDLSYNN  340
            P  Y    + +I   +          +  +         +IP F+GSL NL+YL++S   
Sbjct  98   PAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENLMYLNISRAG  157

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
              G +P  +GN+S+L++LD+  N++ G     V+   W+S+LS L++L++ GVDL   SD
Sbjct  158  FVGIIPHQIGNLSNLQFLDLRPNYLGG---LYVEDFGWVSHLSLLKHLDLSGVDLSKTSD  214



>gb|ABA94375.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
Length=1500

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 91/178 (51%), Gaps = 7/178 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK+SI  DP+  L  W   DDCC+W+G+ C N  TGHV+ L L       DG 
Sbjct  32   ERDALLEFKNSITDDPMGQLKFWRRGDDCCQWRGIRCSN-RTGHVIKLQLWKPKFDDDGM  90

Query  182  PC----YPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFG  349
                    GL+   +             +        IP FIGS  NL YL+LS     G
Sbjct  91   SLVGNGMVGLISPSLLSLEHLQHLDLSWNNLSGSDGHIPGFIGSFRNLRYLNLSGMPFIG  150

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             VPP LGN+S L++LD+ +    G +++    + W+  +  L+YLN++ VDL +V +W
Sbjct  151  VVPPQLGNLSKLQFLDLSSCI--GLEMQSRSGMTWLRNIPLLQYLNLNSVDLSAVDNW  206



>gb|EMT18287.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=1016

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 104/184 (57%), Gaps = 16/184 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK  I SD  + L+SW   D CC+W+G+GC+N  TGHVV LHL    +  D P
Sbjct  41   ERAALLSFKKGITSDSTNLLTSWDSQD-CCQWRGIGCNN-RTGHVVKLHLR-STIVEDNP  97

Query  182  -----PC-YPGLLQGEIxpsllhlpflnfldlsfn----dfERIPSFIGSLNNLVYLDLS  331
                 PC +   L GEI PSLL L  L  LDLS N       +I + +GS+ NL YLDLS
Sbjct  98   WGYYDPCEHDNSLFGEISPSLLSLKHLEHLDLSMNCLPGPNSKILNLMGSMTNLRYLDLS  157

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
                 G VP  LGN+S L+YLD+      G  +     + W++ L  L++L+M GV L  
Sbjct  158  GIPFTGRVPSQLGNLSKLQYLDLAQT---GNSMMYSTDINWLAKLPFLKFLSMSGVQLSG  214

Query  512  VSDW  523
            + DW
Sbjct  215  IPDW  218



>ref|XP_010660819.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=1312

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 105/178 (59%), Gaps = 12/178 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK  +        S  G+D  CCKW+GV C+N  +GHV  L+L    L  DG 
Sbjct  44   ERVALLKFKQGLTDPSHRLSSWVGED--CCKWRGVVCNN-RSGHVNKLNL--RSLDDDG-  97

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
                G L GEI  SLL L +LN LDLS N+FE  RIP FIGSL  L YL+LS  +  G +
Sbjct  98   --THGKLGGEISHSLLDLKYLNHLDLSMNNFEGTRIPKFIGSLEKLRYLNLSGASFSGPI  155

Query  356  PPHLGNISSLKYLDIGN--NFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S L YLD+    +F    D    + L+WIS LSSL +LN++GV+L   S +
Sbjct  156  PPQLGNLSRLIYLDLKEYFDFNTYPDESSQNDLQWISGLSSLRHLNLEGVNLSRTSAY  213



>ref|XP_008218592.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Prunus mume]
Length=926

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 93/178 (52%), Gaps = 16/178 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FKH +        S  G+ D CC W GV C+N T GHV  LHL          
Sbjct  36   ERQALLKFKHDLEDPSNQLSSWAGEGD-CCNWAGVVCNNFT-GHVRDLHLANMSFSGKIN  93

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
            P    L                 L  +  +  +IPSF+GSL +L YL+LSY++  G +P 
Sbjct  94   PSLLNLTH----------LSYLDLSYNDFEEMQIPSFLGSLKSLRYLNLSYSSFVGLIPH  143

Query  362  HLGNISSLKYLDIGNNFIDGQDLKV----VDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN++SL+ LD+ +   +    ++    V++L+WIS LS L++L+M G +L   SDW
Sbjct  144  QLGNLTSLQVLDLDDLQYEDDHGEIHSLEVESLQWISGLSQLQHLDMSGANLSKASDW  201



>emb|CAN71913.1| hypothetical protein VITISV_032859 [Vitis vinifera]
Length=813

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 93/178 (52%), Gaps = 15/178 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLC--TD  175
            E++ALLSFKH++        S    +D CC W GV C NIT G V+ L L        + 
Sbjct  35   EKRALLSFKHTLFDPAHRLSSWSTHED-CCGWNGVYCHNIT-GRVIKLDLMNPSSSNFSL  92

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
            G    P LLQ E    L                  IP F+GS+ +L YLDLS+ +  G +
Sbjct  93   GGKVSPALLQLEFLNYLNLSGNDFGGTP-------IPGFLGSMRSLTYLDLSFASFGGLI  145

Query  356  PPHLGNISSLKYLDI--GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S+L+YL +  G++F + Q    V+ L WIS+LSSL++L M  VDL     W
Sbjct  146  PPQLGNLSNLQYLSLGGGDSFYEPQ--LYVENLGWISHLSSLKHLTMYEVDLQREVHW  201



>gb|EEE54946.1| hypothetical protein OsJ_02516 [Oryza sativa Japonica Group]
Length=820

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 100/180 (56%), Gaps = 9/180 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK + I+       S    ++CC+W GV C N  TGHV+ L+L    L  D P
Sbjct  52   ERDALLSFK-AGITRDPKKRLSSWLGENCCQWSGVRCSN-RTGHVIILNLSNTYLYYDDP  109

Query  182  PCYPGL-----LQGEIxpsllhlpflnfldlsfndf-ERIPSFIGSLNNLVYLDLSYNNL  343
              Y        L G I  SL+ L  L  LDLS N   E +P F+GS  +L +L+L+    
Sbjct  110  HYYKCAHVDFPLYGYISSSLVSLRQLKRLDLSGNVLGESMPEFLGSFQSLTHLNLARMGF  169

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G VP  LGN+S+L++LDI +   D   +   D + W++ L SL+YL+M  V+L SV DW
Sbjct  170  YGRVPHQLGNLSNLQFLDITSEIYDHPPMHTAD-ISWLARLPSLKYLDMSYVNLSSVVDW  228



>ref|XP_006452275.1| hypothetical protein CICLE_v10007379mg [Citrus clementina]
 gb|ESR65515.1| hypothetical protein CICLE_v10007379mg [Citrus clementina]
Length=942

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 103/176 (59%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALL FK  +I       S  GD++DCC W GV CDN  TGHV  L L          
Sbjct  43   EKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNF-TGHVRMLQL-------RNN  94

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P    +L G+I PSLL+L  L +LDLSFNDF   +IP F+GS+ NL YLDLS     G +
Sbjct  95   PSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYLDLSSAGFLGMI  154

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  L N+S+L+YLD+   ++        + L W+S LSSLE+L++  VDL   SDW
Sbjct  155  PHQLANLSNLQYLDLSQKYLG----LYAENLRWLSGLSSLEHLDLSNVDLSRASDW  206



>ref|XP_008226203.1| PREDICTED: receptor-like protein 12 [Prunus mume]
Length=982

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 107/182 (59%), Gaps = 16/182 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKAL+SFK  +        S  G D  CC+W+G+ C+N  TGHV  + L   G  +   
Sbjct  40   ERKALVSFKQDLTDPSGRLSSWVGHD--CCRWEGISCNN-RTGHVSQMDLRNPGPESTTD  96

Query  182  PCYPGL------LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYN  337
              +  L      L G+I PSLL L  L +LDLS N+FE  RIP+F G L  L YL++S  
Sbjct  97   EEWDELAFEQSCLGGKINPSLLSLKHLRYLDLSLNNFERIRIPNFFGELKILRYLNISST  156

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
               G +PP LGN+S+L YLD+ +++           L W+S+LSSL+YLN++GV+L+S +
Sbjct  157  EFVGEIPPSLGNLSNLNYLDVSDSYQLSS-----KNLNWLSHLSSLKYLNLNGVNLYSNT  211

Query  518  DW  523
            +W
Sbjct  212  NW  213



>dbj|BAD52656.1| HcrVf3 protein-like [Oryza sativa Japonica Group]
 dbj|BAD53124.1| HcrVf3 protein-like [Oryza sativa Japonica Group]
Length=718

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 100/180 (56%), Gaps = 9/180 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK + I+       S    ++CC+W GV C N  TGHV+ L+L    L  D P
Sbjct  49   ERDALLSFK-AGITRDPKKRLSSWLGENCCQWSGVRCSN-RTGHVIILNLSNTYLYYDDP  106

Query  182  PCYPGL-----LQGEIxpsllhlpflnfldlsfndf-ERIPSFIGSLNNLVYLDLSYNNL  343
              Y        L G I  SL+ L  L  LDLS N   E +P F+GS  +L +L+L+    
Sbjct  107  HYYKCAHVDFPLYGYISSSLVSLRQLKRLDLSGNVLGESMPEFLGSFQSLTHLNLARMGF  166

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G VP  LGN+S+L++LDI +   D   +   D + W++ L SL+YL+M  V+L SV DW
Sbjct  167  YGRVPHQLGNLSNLQFLDITSEIYDHPPMHTAD-ISWLARLPSLKYLDMSYVNLSSVVDW  225



>ref|XP_010650298.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=876

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 93/178 (52%), Gaps = 15/178 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLC--TD  175
            E++ALLSFKH++        S    +D CC W GV C NIT G V+ L L        + 
Sbjct  35   EKRALLSFKHTLFDPAHRLSSWSTHED-CCGWNGVYCHNIT-GRVIKLDLMNPSSSNFSL  92

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
            G    P LLQ E    L                  IP F+GS+ +L YLDLS+ +  G +
Sbjct  93   GGKVSPALLQLEFLNYLNLSGNDFGGTP-------IPGFLGSMRSLTYLDLSFASFGGLI  145

Query  356  PPHLGNISSLKYLDI--GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S+L+YL +  G++F + Q    V+ L WIS+LSSL++L M  VDL     W
Sbjct  146  PPQLGNLSNLQYLSLGGGDSFYEPQ--LYVENLGWISHLSSLKHLTMYEVDLQREVHW  201



>ref|XP_004980614.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1-like 
[Setaria italica]
Length=951

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 92/178 (52%), Gaps = 11/178 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNITTGHVVALHLGLE--GLCT  172
            ER+ALL FK  I SD    L S   D DDCC+W+GV C N  TGHV+ L LG E     +
Sbjct  48   EREALLGFKQGITSDEAGVLDSWRQDGDDCCRWRGVRCSN-RTGHVLELRLGNEHANYFS  106

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
             G     G +   +             +       RIP F+G L NL YLDLS  +  G+
Sbjct  107  SGDTLLVGQISRSLLALERLEHLDLSWNSVEGSDGRIPEFLGCLKNLEYLDLSGISFIGS  166

Query  353  VPPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            VP  LGN+S L+YLD+    F++ +D+       W++ L  L+YLN+  V+L  V DW
Sbjct  167  VPSQLGNLSELRYLDLSYMTFLNPRDVS------WLTRLPLLQYLNLKMVNLGEVVDW  218


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = +2

Query  278  RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWI  457
             IP  I +L+ LV L+LS N+  GNVP  +G I SL+ LD+  N + G+    +  L ++
Sbjct  766  EIPEEIATLHALVNLNLSQNHFSGNVPSRIGAIQSLESLDLSRNNLSGEVPASLSNLTFL  825

Query  458  SYLSSLEYLNMDG  496
            SYL  L Y N++G
Sbjct  826  SYL-DLSYNNLEG  837



>ref|XP_002318355.2| hypothetical protein POPTR_0012s01080g [Populus trichocarpa]
 gb|EEE96575.2| hypothetical protein POPTR_0012s01080g [Populus trichocarpa]
Length=822

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 92/176 (52%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK  +I D     S     +  DCCKW GVGCDNIT GHV  L L    +  D
Sbjct  37   ERRALLQFKEDLIDDYGVLSSWGGKEEKRDCCKWIGVGCDNIT-GHVTLLDLHSSPVYED  95

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                +  L+       L             N  E I  FIGSL +L YL+LSYN     +
Sbjct  96   R---FTPLIGKVSDSLLELQYLNYLDLSLNNFDESIMDFIGSLTSLRYLNLSYNFFTVTI  152

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S L+ LD+  +F DG     V+ L+W+S+LSSLE L + G +L  V+DW
Sbjct  153  PYQLGNLSRLQSLDLSYSF-DGS----VENLDWLSHLSSLERLYLSGSNLSKVNDW  203



>dbj|BAG90139.1| unnamed protein product [Oryza sativa Japonica Group]
Length=721

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 100/180 (56%), Gaps = 9/180 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK + I+       S    ++CC+W GV C N  TGHV+ L+L    L  D P
Sbjct  52   ERDALLSFK-AGITRDPKKRLSSWLGENCCQWSGVRCSN-RTGHVIILNLSNTYLYYDDP  109

Query  182  PCYPGL-----LQGEIxpsllhlpflnfldlsfndf-ERIPSFIGSLNNLVYLDLSYNNL  343
              Y        L G I  SL+ L  L  LDLS N   E +P F+GS  +L +L+L+    
Sbjct  110  HYYKCAHVDFPLYGYISSSLVSLRQLKRLDLSGNVLGESMPEFLGSFQSLTHLNLARMGF  169

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G VP  LGN+S+L++LDI +   D   +   D + W++ L SL+YL+M  V+L SV DW
Sbjct  170  YGRVPHQLGNLSNLQFLDITSEIYDHPPMHTAD-ISWLARLPSLKYLDMSYVNLSSVVDW  228



>gb|ACJ03068.1| HB04p [Malus floribunda]
Length=977

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 101/177 (57%), Gaps = 12/177 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +  DCC W GV CD+IT GH+  LHL      +  
Sbjct  41   ERQALLMFKQDLKDPANRLSSWVAEEGSDCCSWTGVVCDHIT-GHIHELHLN----SSYS  95

Query  179  PPCYPGLLQGEIxpsllhlpflnfl-dlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
               +     G+I  SLL L  LN+L   +     +IPSF GS+ +L +L+L  N+ FG V
Sbjct  96   DWHFNSFFSGKINSSLLSLKHLNYLDLSNNEFITQIPSFFGSMTSLTHLNLG-NSAFGGV  154

Query  356  PPH-LGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             PH LGN+SSL+YL+I N  I G  LK V+ L+WIS LS LE+L++  VDL   SDW
Sbjct  155  IPHKLGNLSSLRYLNISN--IYGPSLK-VENLKWISGLSLLEHLDLSSVDLSKASDW  208



>ref|XP_011001954.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X2 [Populus euphratica]
Length=944

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 108/180 (60%), Gaps = 19/180 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK  +I D     S     +  DCCKW+GVGCDNIT GHV  L L        
Sbjct  21   ERRALLQFKKDLIDDYGVLSSWGGEEEKRDCCKWRGVGCDNIT-GHVTLLDL-------H  72

Query  176  GPPCYPGL---LQGEIxpsllhlpflnfldlsfndf-ERIPSFIGSLNNLVYLDLSYNNL  343
              P Y  L   L G++  SLL L +LN+LDLS N+F E +  FIGSL +L YL+LSYN  
Sbjct  73   SSPVYENLFTPLGGKVSDSLLELQYLNYLDLSLNNFDESMIDFIGSLTSLRYLNLSYNFF  132

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
               +P  LGN+S L+ LD+  +F D      V+ L+W+S+LSSLE L++ G +L  V+DW
Sbjct  133  TVIIPYQLGNLSRLQSLDLSYSF-DAS----VENLDWLSHLSSLERLDLSGSNLSKVNDW  187



>ref|XP_007220831.1| hypothetical protein PRUPE_ppa027090mg, partial [Prunus persica]
 gb|EMJ22030.1| hypothetical protein PRUPE_ppa027090mg, partial [Prunus persica]
Length=1025

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 100/173 (58%), Gaps = 13/173 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHV-VALHLGLEGLCTDG  178
            ER+AL+ FK+ +        S  G +  CC+W G+ C+N T+  + V LH        D 
Sbjct  16   EREALIDFKNGLEDPENRLSSWRGSN--CCQWWGIHCNNTTSAVIAVDLHNPHPLNPLDD  73

Query  179  PPCYPGL--LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLF  346
             P   G   L GEI  SL  L  L  LDLSFN F    IP+F G++ NL YL+LS+    
Sbjct  74   SPGRYGFWNLSGEIRRSLKILQSLKHLDLSFNTFNGISIPAFFGTMKNLEYLNLSHAGFS  133

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL  505
            G + P+LGN+SSL+YLD+ +NF+       VD LEW++ + S+EYLNM+G DL
Sbjct  134  GGILPNLGNLSSLQYLDVSSNFVS------VDNLEWMTGMRSMEYLNMNGADL  180



>ref|XP_003579434.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Brachypodium distachyon]
Length=952

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 87/148 (59%), Gaps = 17/148 (11%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+WKGV C    TGHV  L L ++G        Y G+L G I  SL+ L  L +LDL  
Sbjct  68   CCRWKGVHCSR-RTGHV--LKLDVQG-------SYDGVLGGNISSSLVGLERLQYLDLGG  117

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N F   +I  F+ SL+NL YL LS +   G VPP LGN+S+L+YL  GNN     D    
Sbjct  118  NSFSGFQITEFLPSLHNLRYLSLSSSGFVGRVPPQLGNLSNLRYLSFGNN----PDTYST  173

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            D + W+S LSSLEYL+M  VDL ++ +W
Sbjct  174  D-ITWLSRLSSLEYLDMSSVDLSNIPNW  200



>ref|XP_006452261.1| hypothetical protein CICLE_v10010776mg, partial [Citrus clementina]
 gb|ESR65501.1| hypothetical protein CICLE_v10010776mg, partial [Citrus clementina]
Length=974

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 103/176 (59%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALL FK  +I       S  GD++DCC W GV CDN  TGHV  L L          
Sbjct  75   EKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNF-TGHVRMLQL-------RNN  126

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P    +L G+I PSLL+L  L +LDLSFNDF   +IP F+GS+ NL YLDLS     G +
Sbjct  127  PSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYLDLSSAGFLGMI  186

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  L N+S+L+YLD+   ++        + L W+S LSSLE+L++  VDL   SDW
Sbjct  187  PHQLANLSNLQYLDLSQKYLG----LYAENLRWLSGLSSLEHLDLSNVDLSRASDW  238



>ref|XP_006493981.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2-like [Citrus sinensis]
Length=923

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 103/176 (59%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALL FK  +I       S  GD++DCC W GV CDN  TGHV  L L          
Sbjct  4    EKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNF-TGHVRMLQL-------RNN  55

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P    +L G+I PSLL+L  L +LDLSFNDF   +IP F+GS+ NL YLDLS     G +
Sbjct  56   PSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYLDLSSAGFLGMI  115

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  L N+S+L+YLD+   ++        + L W+S LSSLE+L++  VDL   SDW
Sbjct  116  PHQLANLSNLQYLDLSQKYLG----LYAENLRWLSGLSSLEHLDLSNVDLSRASDW  167



>gb|KCW86891.1| hypothetical protein EUGRSUZ_B03474 [Eucalyptus grandis]
Length=992

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCT----------DGPPCY-PGLLQGEIxpsllh  232
            CC+W  V CDN   G VV LHL    +C             P  Y P  L G + PSLL 
Sbjct  64   CCEWVRVSCDN-DMGRVVKLHLRGSDICDVVDDDDDAPESAPEDYKPLCLSGHVSPSLLA  122

Query  233  lpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGN  406
            L  L +LDLS N+F+   IPSF+GSL  L YL+LS  +  G +PP LGN+S+L YLD+  
Sbjct  123  LKHLTYLDLSRNNFQGNPIPSFLGSLKRLTYLNLSQASFGGLIPPQLGNLSNLHYLDLTF  182

Query  407  NFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +F   Q+L+V D L W+S L SL YLN++GV+L   S
Sbjct  183  DFYSRQELRVSD-LNWLSGLFSLNYLNLEGVNLRKGS  218



>ref|XP_006452276.1| hypothetical protein CICLE_v10007373mg [Citrus clementina]
 gb|ESR65516.1| hypothetical protein CICLE_v10007373mg [Citrus clementina]
Length=949

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALLSFK  +        S +     DCCKW GV CDNI TGHV+ L L         
Sbjct  39   EREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNI-TGHVLELRLRNPSRDDGS  97

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfE------RIPSFIGSLNNLVYLDLSYNN  340
            P  Y    + +I   +          +  +         +IP F+GSL NL+YL++S   
Sbjct  98   PAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENLMYLNISRAG  157

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
              G +P  +GN+S+L++LD+  N++ G     V+   W+S+LS L++L++ GVDL   SD
Sbjct  158  FVGIIPHQIGNLSNLQFLDLRPNYLGGL---YVEDFGWVSHLSLLKHLDLSGVDLSKTSD  214



>gb|EEE52285.1| hypothetical protein OsJ_34275 [Oryza sativa Japonica Group]
Length=985

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-----wgddddCCKWKGVGCDNITTGHVVALHLGLEGL  166
            ER ALL+FK  +  DP    +S         +DCC+W+GV C N+T GHVV L L  +  
Sbjct  44   ERDALLAFKEGVTDDPAGLHASWRRGGGQLQEDCCQWRGVRCSNLT-GHVVKLRLRNDHA  102

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLF  346
             T       G +   +            ++        +P F+GS  +L YL+LS     
Sbjct  103  GT----ALAGEIGQSLISLEHLRYLDLSMNNLAGSTGHVPEFLGSFKSLRYLNLSGIVFS  158

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQ-DLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G VPP LGN+S+L+YLD+    + G      ++   W+ +LS+L+YLN+DGV+L +V DW
Sbjct  159  GMVPPQLGNLSNLRYLDLSGIRLSGMVSFLYINDGSWLGHLSNLQYLNLDGVNLSTVVDW  218



>gb|ACJ03074.1| HcrVf4 [Malus floribunda]
Length=962

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 94/177 (53%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgdddd---CCKWKGVGCDNITTGHVVALHLGLEGLCT  172
            ER+ALL FK  +        S   ++D    CC W GV CD+ TTGH+  LHL       
Sbjct  88   ERQALLMFKQDLKDPTNRLASWVAEEDSDSDCCSWTGVVCDH-TTGHIHELHLNNTDPFL  146

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            D    + G +   +             +  +    +IPSF GS+ +L +L+L+Y+   G 
Sbjct  147  DLKSSFGGKINPSLLSLKHLNFLDLSNNYFYPT--QIPSFFGSMTSLTHLNLAYSRFGGI  204

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ +N I  +    V+ L+WIS LS L++L++ GV+L   SDW
Sbjct  205  IPHKLGNLSSLRYLNLSSNSIYLK----VENLQWISGLSLLKHLDLSGVNLSKASDW  257



>ref|XP_008341680.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g34110 [Malus domestica]
Length=992

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 106/180 (59%), Gaps = 15/180 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLG---LEGLCT  172
            ERKALL  K  ++       S  G+D  CCKW+GVGC    TG V  L+L    ++GL  
Sbjct  42   ERKALLEVKQGLVDPSDRLSSWTGED--CCKWRGVGCXK-KTGRVTRLNLHNEYVDGL--  96

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLF  346
            DG       L GEI  SLL L  L +LDLS N+FE  R+PSF+GSL  L YL+LS  +  
Sbjct  97   DGEDGAMHALGGEINRSLLVLKDLIYLDLSMNNFEGVRVPSFMGSLEKLEYLNLSGASFG  156

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
            G +P +LGN+S L +LD+ NNF +         L W+  LSSL++LN+ GVDL+ V S W
Sbjct  157  GVIPHNLGNLSRLLFLDLSNNFFEPN----ATDLRWLPTLSSLKFLNLGGVDLNKVASSW  212



>gb|ABA94357.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
Length=976

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-----wgddddCCKWKGVGCDNITTGHVVALHLGLEGL  166
            ER ALL+FK  +  DP    +S         +DCC+W+GV C N+T GHVV L L  +  
Sbjct  44   ERDALLAFKEGVTDDPAGLHASWRRGGGQLQEDCCQWRGVRCSNLT-GHVVKLRLRNDHA  102

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLF  346
             T       G +   +            ++        +P F+GS  +L YL+LS     
Sbjct  103  GT----ALAGEIGQSLISLEHLRYLDLSMNNLAGSTGHVPEFLGSFKSLRYLNLSGIVFS  158

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQ-DLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G VPP LGN+S+L+YLD+    + G      ++   W+ +LS+L+YLN+DGV+L +V DW
Sbjct  159  GMVPPQLGNLSNLRYLDLSGIRLSGMVSFLYINDGSWLGHLSNLQYLNLDGVNLSTVVDW  218



>emb|CAC40827.1| HcrVf3 protein [Malus floribunda]
Length=915

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 94/177 (53%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgdddd---CCKWKGVGCDNITTGHVVALHLGLEGLCT  172
            ER+ALL FK  +        S   ++D    CC W GV CD+ TTGH+  LHL       
Sbjct  41   ERQALLMFKQDLKDPTNRLASWVAEEDSDSDCCSWTGVVCDH-TTGHIHELHLNNTDPFL  99

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            D    + G +   +             +  +    +IPSF GS+ +L +L+L+Y+   G 
Sbjct  100  DLKSSFGGKINPSLLSLKHLNFLDLSNNYFYPT--QIPSFFGSMTSLTHLNLAYSRFGGI  157

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ +N I  +    V+ L+WIS LS L++L++ GV+L   SDW
Sbjct  158  IPHKLGNLSSLRYLNLSSNSIYLK----VENLQWISGLSLLKHLDLSGVNLSKASDW  210



>ref|XP_011001953.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 isoform X1 [Populus euphratica]
Length=971

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 101/180 (56%), Gaps = 19/180 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK  +I D     S     +  DCCKW+GVGCDNIT GHV  L L        
Sbjct  48   ERRALLQFKKDLIDDYGVLSSWGGEEEKRDCCKWRGVGCDNIT-GHVTLLDL-------H  99

Query  176  GPPCYPGL---LQGEIxpsllhlpfln-fldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
              P Y  L   L G++  SLL L +LN       N  E +  FIGSL +L YL+LSYN  
Sbjct  100  SSPVYENLFTPLGGKVSDSLLELQYLNYLDLSLNNFDESMIDFIGSLTSLRYLNLSYNFF  159

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
               +P  LGN+S L+ LD+  +F D      V+ L+W+S+LSSLE L++ G +L  V+DW
Sbjct  160  TVIIPYQLGNLSRLQSLDLSYSF-DAS----VENLDWLSHLSSLERLDLSGSNLSKVNDW  214



>gb|KDO62592.1| hypothetical protein CISIN_1g045210mg, partial [Citrus sinensis]
Length=873

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALLSFK  +        S +     DCCKW GV CDNI TGHV+ L L         
Sbjct  39   EREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNI-TGHVLELRLRNPSRDDGS  97

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfE------RIPSFIGSLNNLVYLDLSYNN  340
            P  Y    + +I   +          +  +         +IP F+GSL NL+YL++S   
Sbjct  98   PAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENLMYLNISRAG  157

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
              G +P  +GN+S+L++LD+  N++ G     V+   W+S+LS L++L++ GVDL   SD
Sbjct  158  FVGIIPHQIGNLSNLQFLDLRPNYLGG---LYVEDFGWVSHLSLLKHLDLSGVDLSKTSD  214



>gb|AEQ27748.1| receptor-like protein [Malus micromalus]
Length=915

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 94/177 (53%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgdddd---CCKWKGVGCDNITTGHVVALHLGLEGLCT  172
            ER+ALL FK  +        S   ++D    CC W GV CD+ TTGH+  LHL       
Sbjct  41   ERQALLMFKQDLKDPTNRLASWVAEEDSDSDCCSWTGVVCDH-TTGHIHELHLNNTDPFL  99

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            D    + G +   +             +  +    +IPSF GS+ +L +L+L+Y+   G 
Sbjct  100  DLKSSFGGKINPSLLSLKHLNFLDLSNNYFYPT--QIPSFFGSMTSLTHLNLAYSRFGGI  157

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ +N I  +    V+ L+WIS LS L++L++ GV+L   SDW
Sbjct  158  IPHKLGNLSSLRYLNLSSNSIYLK----VENLQWISGLSLLKHLDLSGVNLSKASDW  210



>ref|XP_010662757.1| PREDICTED: receptor-like protein 12 isoform X1 [Vitis vinifera]
Length=899

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 91/174 (52%), Gaps = 17/174 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALLSFKH+++       S    +D CC W+GV C N+T   V+ L L    L   G 
Sbjct  33   EKQALLSFKHALLDPANQLSSWSIKED-CCGWRGVHCSNVT-ARVLKLELAEMNL---GG  87

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
               P LL+ E    L                  IPSF+GS+ +L YL+L+     G VP 
Sbjct  88   EISPALLKLEFLDHLDLSSNDFKGSP-------IPSFLGSMGSLRYLNLNDARFAGLVPH  140

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S+L++LD+G N         V+ L WIS+L+ L+YL+MD VDLH    W
Sbjct  141  QLGNLSTLRHLDLGYN-----SGLYVENLGWISHLAFLKYLSMDSVDLHREVHW  189



>ref|XP_010662758.1| PREDICTED: receptor-like protein 12 isoform X2 [Vitis vinifera]
Length=877

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 91/174 (52%), Gaps = 17/174 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALLSFKH+++       S    +D CC W+GV C N+T   V+ L L    L   G 
Sbjct  11   EKQALLSFKHALLDPANQLSSWSIKED-CCGWRGVHCSNVT-ARVLKLELAEMNL---GG  65

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
               P LL+ E    L                  IPSF+GS+ +L YL+L+     G VP 
Sbjct  66   EISPALLKLEFLDHLDLSSNDFKG-------SPIPSFLGSMGSLRYLNLNDARFAGLVPH  118

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S+L++LD+G N         V+ L WIS+L+ L+YL+MD VDLH    W
Sbjct  119  QLGNLSTLRHLDLGYN-----SGLYVENLGWISHLAFLKYLSMDSVDLHREVHW  167



>emb|CBI22735.3| unnamed protein product [Vitis vinifera]
Length=627

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 93/180 (52%), Gaps = 20/180 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            E+ ALL FK ++ +      S   + D CC+W+ V C+N+T G VV LHLG      D  
Sbjct  35   EKHALLRFKKALSNPGNRLSSWSVNQD-CCRWEAVRCNNVT-GRVVELHLGNPYDADDYE  92

Query  176  ----GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                G    P LL+ E    L                  IPSF+GS+ +L YLDL+    
Sbjct  93   FYRLGGEISPALLELEFLSYLNLSWNDFGG-------SPIPSFLGSMGSLRYLDLTSVGF  145

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G VP  LGN+S+L++LD+G N     +   V+ L WIS+L+ L+YL M+GVDLH    W
Sbjct  146  GGLVPHQLGNLSTLRHLDLGYN-----NGLYVENLGWISHLAFLKYLGMNGVDLHREVHW  200



>ref|XP_007220752.1| hypothetical protein PRUPE_ppa025491mg [Prunus persica]
 gb|EMJ21951.1| hypothetical protein PRUPE_ppa025491mg [Prunus persica]
Length=859

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 89/176 (51%), Gaps = 12/176 (7%)
 Frame = +2

Query  2    ERKALLSFK-HsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            E++ALL+FK H        S     +D +CC W GV CDN+T GHV+ LHLG      + 
Sbjct  9    EKQALLTFKQHLKDPANRLSSWVGEEDSNCCNWTGVVCDNLT-GHVLELHLGNSNSLLNS  67

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
                 G +   +             +       +IP F GSL +L YL+LS     G +P
Sbjct  68   NTSLGGKVSRSLLSLKHLNYLDLSNNDFQGI--QIPKFFGSLISLRYLNLSKAGFEGIIP  125

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKV-VDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              LGN++SL+YL +G       D K+ V+ L+W+S LS LE+L+M   DL   SDW
Sbjct  126  HQLGNLTSLRYLCLG-------DYKLKVENLQWVSGLSHLEHLDMSSADLSKASDW  174



>ref|XP_006452262.1| hypothetical protein CICLE_v10010520mg [Citrus clementina]
 gb|ESR65502.1| hypothetical protein CICLE_v10010520mg [Citrus clementina]
Length=949

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALLSFK  +        S +     DCCKW GV CDNI TGHV+ L L         
Sbjct  39   EREALLSFKQDLEDPSNRLASWNNIGVGDCCKWYGVVCDNI-TGHVLELRLRNPSRDDGS  97

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfE------RIPSFIGSLNNLVYLDLSYNN  340
            P  Y    + +I   +          +  +         +IP F+GSL NL+YL++S   
Sbjct  98   PAEYEAYERSKIVGKINPSLLGLKHLIHLDLSYNDFQGIQIPRFLGSLENLMYLNISRAG  157

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
              G +P  +GN+S+L++LD+  N++ G     V+   W+S+LS L++L++ GVDL   SD
Sbjct  158  FVGIIPHQIGNLSNLQFLDLRPNYLGGL---YVEDFGWVSHLSLLKHLDLSGVDLSKTSD  214



>ref|XP_009352118.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 [Pyrus x bretschneideri]
Length=946

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 103/177 (58%), Gaps = 16/177 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL--GLEGLCTD  175
            E+ ALL FK  +I       S     D CCKW+G+ C+N  TGHVV L L      +   
Sbjct  34   EKTALLQFKQGLIDQSNVLASWETGKD-CCKWRGIACNN-KTGHVVTLDLYYNYSDISNV  91

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGN  352
            G P     L G I PSLL LP+L +LDLSFN+F+ +IP FIGS N L  L L+  +L G 
Sbjct  92   GTP-----LSGVIAPSLLELPYLTYLDLSFNNFQGQIPKFIGSFNRLEQLKLAGADLSGP  146

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP LGN+SSL  LD+  N++        + LEW+S+LSSL YLNM  ++   V +W
Sbjct  147  IPPQLGNLSSLYTLDLAWNYV------TFENLEWLSHLSSLMYLNMSRLNFSEVVNW  197



>gb|AEQ27752.1| receptor-like protein [Malus micromalus]
Length=915

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 94/177 (53%), Gaps = 10/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgdddd---CCKWKGVGCDNITTGHVVALHLGLEGLCT  172
            ER+ALL FK  +        S   ++D    CC W GV CD+ TTGH+  LHL       
Sbjct  41   ERQALLMFKQDLKDPTNRLASWVAEEDSDSDCCSWTGVVCDH-TTGHIHELHLNNTDPFL  99

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
            D    + G +   +             +  +    +IPSF GS+ +L +L+L+Y+   G 
Sbjct  100  DLKSSFGGKINPSLLSLKHLNFLDLSNNYFYPT--QIPSFFGSMTSLTHLNLAYSRFGGI  157

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ +N I  +    V+ L+WIS LS L++L++ GV+L   SDW
Sbjct  158  IPHKLGNLSSLRYLNLSSNSIYLK----VENLQWISGLSLLKHLDLSGVNLSKASDW  210



>ref|XP_006485564.1| PREDICTED: receptor-like protein kinase HSL1-like [Citrus sinensis]
Length=948

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 102/176 (58%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALL FK  +I       S  GD++DCC W GV CDN  TGHV  L L          
Sbjct  36   EKEALLRFKQDLIDPSNRLASWIGDEEDCCTWAGVVCDNF-TGHVRMLQL-------RNN  87

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
            P    +L G+I PSLL+L  L +LDLSFNDF   +IP F+GS+ NL YLDLS     G +
Sbjct  88   PSQISMLGGKISPSLLNLKHLVYLDLSFNDFGGIQIPPFLGSMVNLSYLDLSSAGFLGMI  147

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  L N+S+L+YLD+   ++          L W+S LSSLE+L++  VDL   SDW
Sbjct  148  PHQLANLSNLQYLDLSQKYLG----LYAGNLRWLSGLSSLEHLDLSNVDLSRASDW  199



>gb|AEQ27747.1| receptor-like protein [Malus baccata]
Length=980

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 99/180 (55%), Gaps = 17/180 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLG-----LEG  163
            ER+ALL FK  +        S    +D DCC W GV CD++T GH+  LHL       E 
Sbjct  41   ERRALLMFKQDLKDPVNRLASWVAEEDSDCCSWTGVVCDHVT-GHIHELHLNSSYSDWEF  99

Query  164  LCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                G    P LL        L       L  +  +  +IPSF GS+ +L +L+L+Y+ L
Sbjct  100  NSFFGGKINPSLLS-------LKHLNYLDLSNNDFNGTQIPSFFGSMTSLTHLNLAYSEL  152

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G +P  LGN+SSL+YL++ + +  G +LK V+ L+WIS LS L++L++  V+L   SDW
Sbjct  153  YGIIPHKLGNLSSLRYLNLSSFY--GSNLK-VENLQWISGLSLLKHLDLSSVNLSKASDW  209



>gb|AAD50430.1|AF166121_1 Cf2/Cf5 disease resistance protein homolog [Hordeum vulgare subsp. 
vulgare]
Length=893

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 83/174 (48%), Gaps = 14/174 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+ K  I        S      DCC+W G+ C N+T G V+ L L          
Sbjct  40   ERDALLALKQGINDTDDELRSWQRGSQDCCRWAGITCSNMT-GRVIGLDLSRRFSLV---  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
                G +   +                     RIP F+GSLNNL +LDLSY +  G +PP
Sbjct  96   ----GQISPSLLSLEHLQYLNLKSTSLCGHGGRIPEFLGSLNNLRHLDLSYMSFSGVLPP  151

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S L+YLD+ N      ++ V+D + W+S L  L YL++   +L S++ W
Sbjct  152  QLGNLSKLEYLDLSN-----MEMDVID-ISWLSRLPRLMYLDISYTNLSSIAAW  199



>emb|CAC40826.1| HcrVf2 protein [Malus floribunda]
 gb|AEQ27750.1| receptor-like protein [Malus micromalus]
 gb|AIW65095.1| scab resistance protein [Plant transformation vector p9-Dao-FLPi-HcrVf2]
Length=980

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 99/180 (55%), Gaps = 17/180 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLG-----LEG  163
            ER+ALL FK  +        S    +D DCC W GV CD++T GH+  LHL       E 
Sbjct  41   ERRALLMFKQDLKDPVNRLASWVAEEDSDCCSWTGVVCDHVT-GHIHELHLNSSYSDWEF  99

Query  164  LCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                G    P LL        L       L  +  +  +IPSF GS+ +L +L+L+Y+ L
Sbjct  100  NSFFGGKINPSLLS-------LKHLNYLDLSNNDFNGTQIPSFFGSMTSLTHLNLAYSEL  152

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G +P  LGN+SSL+YL++ + +  G +LK V+ L+WIS LS L++L++  V+L   SDW
Sbjct  153  YGIIPHKLGNLSSLRYLNLSSFY--GSNLK-VENLQWISGLSLLKHLDLSSVNLSKASDW  209



>gb|AEQ27746.1| receptor-like protein [Malus baccata]
Length=980

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 99/180 (55%), Gaps = 17/180 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLG-----LEG  163
            ER+ALL FK  +        S    +D DCC W GV CD++T GH+  LHL       E 
Sbjct  41   ERRALLMFKQDLKDPVNRLASWVAEEDSDCCSWTGVVCDHVT-GHIHELHLNSSYSDWEF  99

Query  164  LCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
                G    P LL        L       L  +  +  +IPSF GS+ +L +L+L+Y+ L
Sbjct  100  NSFFGGKINPSLLS-------LKHLNYLDLSNNDFNGTQIPSFFGSMTSLTHLNLAYSEL  152

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +G +P  LGN+SSL+YL++ + +  G +LK V+ L+WIS LS L++L++  V+L   SDW
Sbjct  153  YGIIPHKLGNLSSLRYLNLSSFY--GSNLK-VENLQWISGLSLLKHLDLSSVNLSKASDW  209



>ref|XP_002274689.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=985

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 101/176 (57%), Gaps = 16/176 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALLSFK  I        S   ++  CC W+GV C N TTGHV+ L+L  + L  D  
Sbjct  39   EREALLSFKRGIHDPSNRLSSWANEE--CCNWEGVCCHN-TTGHVLKLNLRWD-LYQDH-  93

Query  182  PCYPGLLQGEIxpsllhlpflnfldls--fndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                G L GEI  SLL L  L +LDLS        IP F+GSL+NL YL+LS     G +
Sbjct  94   ----GSLGGEISSSLLDLKHLQYLDLSCNDFGSLHIPKFLGSLSNLRYLNLSSAGFGGVI  149

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S L YLDIGN+     D   V+ LEWIS L+ L++L+M  V+L   S+W
Sbjct  150  PHQLGNLSKLHYLDIGNS-----DSLNVEDLEWISGLTFLKFLDMANVNLSKASNW  200



>ref|XP_008376669.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At2g33170 [Malus domestica]
Length=964

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 106/178 (60%), Gaps = 18/178 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL---GLEGLCT  172
            E+ ALL FK  ++ +     S     D CC+W+G+ C N  TGHVV L L     +    
Sbjct  34   EKTALLQFKQGLVDESNVLASWETGKD-CCEWRGITCSN-ETGHVVTLDLYYNSSDVYNV  91

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFG  349
            + P      L G I PSLL LP+L +LDLSFN+F+ +IP FIGSL+ L +L L+  +L G
Sbjct  92   ETP------LSGVIAPSLLELPYLTYLDLSFNNFKGKIPKFIGSLSRLKHLKLAGASLSG  145

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             +PP LGN+SSL  LD+  NF+        + LEW+S+LSSL YLNM G++   V +W
Sbjct  146  PIPPQLGNLSSLYALDLAWNFV------TFENLEWLSHLSSLRYLNMSGLNFSEVVNW  197



>gb|EEC68383.1| hypothetical protein OsI_36529 [Oryza sativa Indica Group]
Length=565

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 109/183 (60%), Gaps = 21/183 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNITTGHVVALHLG----LEGL  166
            ER ALL+FK  I SDPL  L+S   DD DCC+W+GV C N+T GHV+ LHL     L+  
Sbjct  36   ERDALLAFKRGITSDPLGLLTSWKEDDHDCCRWRGVTCSNLT-GHVLRLHLNGGYDLDRF  94

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE----RIPSFIGSLNNLVYLDLSY  334
               G       L GEI P LLHL  +  LDLS N  E    +IP F+GS+N+L YL+LS 
Sbjct  95   ELVG-------LVGEISPQLLHLNHIEHLDLSINSLEEPSGQIPKFLGSMNSLRYLNLSS  147

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                G VPP LGN+S+L+YLD+     D +    +  + W+  L SL++LN+  +DL + 
Sbjct  148  IPFTGTVPPQLGNLSNLRYLDLS----DMEGGVHLTDISWLPRLGSLKFLNLTYIDLSAA  203

Query  515  SDW  523
            SDW
Sbjct  204  SDW  206



>gb|EYU31382.1| hypothetical protein MIMGU_mgv1a018210mg [Erythranthe guttata]
Length=949

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (63%), Gaps = 21/147 (14%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC W+GV CDNIT GHV  LHLG              +L+G+I PSLL+L  L +LDLS 
Sbjct  69   CCNWEGVVCDNIT-GHVDQLHLG------------SSILRGKIDPSLLNLKHLTYLDLSR  115

Query  266  ndfER-IPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVD  442
            ++FE+ IPSFIGSL +L YLDLS    +G +P  +GN+S+L+ L +  +  + Q      
Sbjct  116  SNFEQPIPSFIGSLTSLEYLDLSNAGFYGTIPNTIGNLSNLRTLILEGDGYESQ------  169

Query  443  TLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LEW+S LS L+YLNM+ V+L    +W
Sbjct  170  -LEWLSGLSQLKYLNMNYVNLSRAGNW  195



>gb|EMS35655.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Triticum 
urartu]
Length=957

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 102/178 (57%), Gaps = 18/178 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER AL++F+        ++  S     DCC+WKGV C NIT G V+ L L        GP
Sbjct  43   ERSALVTFR--AGLSDTANRLSSWKGGDCCQWKGVHCSNIT-GRVIRLDL-------HGP  92

Query  182  PCYPGLLQ---GEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFG  349
             C+  ++Q   G I  SLL L  L +LDLS N FE +IP F+GSL NL Y+DLS +   G
Sbjct  93   DCHNSIVQVLGGNISSSLLGLQHLQYLDLSCNRFELQIPEFLGSLYNLKYIDLSNSYFVG  152

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             VPP LGN+S+L+Y  + +   D     +     W+S L+SL++L+M  V+L +++ W
Sbjct  153  RVPPQLGNLSNLRYFSLDSTLGDTYSRDIT----WLSRLTSLQHLDMTFVNLSTIAHW  206



>gb|AAS48164.1| LRR protein WM1.10 [Aegilops tauschii]
Length=1060

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 105/183 (57%), Gaps = 13/183 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-----GLEGL  166
            ER ALLSFK  I S+  + L+SW   D CC+W+GV C N  TGHV+ LHL      L+  
Sbjct  41   ERAALLSFKEGITSNNTNLLASWKGQD-CCRWRGVSCCN-QTGHVIKLHLRNPNVTLDAY  98

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfn----dfERIPSFIGSLNNLVYLDLSY  334
              D        L GEI PSLL L  L  LDLS N       +IP  +GS+ NL YL+LS 
Sbjct  99   GYDHACASASALFGEISPSLLSLKHLKHLDLSMNCLLGPNSQIPHLLGSMGNLRYLNLSG  158

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                G VP HLGN+S ++YLD+G    D  D+  +D + W++ L  L++L M GV+L  +
Sbjct  159  IPFTGRVPSHLGNLSKMQYLDLGQAG-DYSDMYSMD-ITWLTKLPFLKFLGMSGVNLSGI  216

Query  515  SDW  523
            +DW
Sbjct  217  ADW  219



>ref|XP_010087503.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
 gb|EXB29184.1| Probably inactive leucine-rich repeat receptor-like protein kinase 
[Morus notabilis]
Length=358

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 102/175 (58%), Gaps = 16/175 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALLSFK  ++    S  S   + +DCC+W G+ CDNIT GH+  LHL          
Sbjct  41   EKQALLSFKQDLVDIFDSLSSWIAEAEDCCRWTGIVCDNIT-GHINELHLT---------  90

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                G L+G+I PSLL+L  L  L+L+  +    +IP F+ SL +L YLDL+  N  G +
Sbjct  91   ---TGSLRGKINPSLLNLTHLTHLELNSFNANGAQIPKFLSSLVHLRYLDLTNANFSGMI  147

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
            P  LGN+S+L +L +G      ++L   + LEW+  LSSLE+L++  V+L   SD
Sbjct  148  PQQLGNLSNLYHLSLGYYLSSPKEL-YANNLEWLCGLSSLEFLDLSFVNLSKASD  201



>gb|KEH16825.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=876

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 99/176 (56%), Gaps = 20/176 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-GLEGLCTDG  178
            ER+ALL FK ++I       S  G++  CCKW+G+ CDN+T GHV  L L  L+      
Sbjct  35   ERRALLKFKDALILGRNDLTSWKGEE--CCKWEGISCDNLT-GHVTILDLHALD------  85

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGNV  355
               Y   LQG++  S+  L  L  L+L  N  E +IP  IGSL  L+ L+L  N L   +
Sbjct  86   ---YTKGLQGKLDSSICELQHLTSLNLDNNRIEGKIPKCIGSLGKLIELNLIGNKLVSVI  142

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PP LGN+S+L+ LD+G N +   D      LEWIS+LS+L YL +  V+L    DW
Sbjct  143  PPSLGNLSNLQTLDLGFNDLTAND------LEWISHLSNLRYLGLSNVNLTLAVDW  192



>gb|EMT19055.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=1060

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 105/183 (57%), Gaps = 13/183 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-----GLEGL  166
            ER ALLSFK  I S+  + L+SW   D CC+W+GV C N  TGHV+ LHL      L+  
Sbjct  41   ERAALLSFKEGITSNNTNLLASWKGQD-CCRWRGVSCCN-QTGHVIKLHLRNPNVTLDAY  98

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfn----dfERIPSFIGSLNNLVYLDLSY  334
              D        L GEI PSLL L  L  LDLS N       +IP  +GS+ NL YL+LS 
Sbjct  99   GYDHACASASALFGEISPSLLSLKHLKHLDLSMNCLLGPNSQIPHLLGSMGNLRYLNLSG  158

Query  335  NNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
                G VP HLGN+S ++YLD+G    D  D+  +D + W++ L  L++L M GV+L  +
Sbjct  159  IPFTGRVPSHLGNLSKMQYLDLGQAG-DYSDMYSMD-ITWLTKLPFLKFLGMSGVNLSGI  216

Query  515  SDW  523
            +DW
Sbjct  217  ADW  219



>gb|KDO36276.1| hypothetical protein CISIN_1g047285mg, partial [Citrus sinensis]
Length=552

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 102/184 (55%), Gaps = 12/184 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL--------GL  157
            ER+ALL  K  +I       S    D DCCKW GV C NIT GHV+ L L        G 
Sbjct  41   EREALLKLKQDLIDPSNRLASWNTGDGDCCKWAGVFCSNIT-GHVLQLSLQNPFSYLGGD  99

Query  158  EGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLS  331
                  G       L G++ PSL+ L  L  LDLS NDFE  +IP ++GSL NL YL+LS
Sbjct  100  LREVKAGSNYERSKLGGKVNPSLVDLKHLIHLDLSGNDFEGIQIPKYLGSLENLRYLNLS  159

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
                 G +P  LGN+S+L+YLD+   F+   DL  VD+L W+S L  LE+L++  ++L  
Sbjct  160  GAKFAGMIPLQLGNLSNLQYLDLSGTFLSNYDLH-VDSLSWLSGLYMLEHLDLSQMNLSK  218

Query  512  VSDW  523
             SDW
Sbjct  219  ASDW  222



>ref|XP_008349566.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Malus domestica]
Length=1025

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 90/152 (59%), Gaps = 13/152 (9%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHL-GLEGLCTDGPPCYPGL--LQGEIxpsllhlpflnfld  256
            CC+W+G+ C N TTG V+ + L         G P   G   L GEI PSL  L  L  LD
Sbjct  57   CCEWRGIHCHN-TTGAVLTVDLHNPHPQDPFGSPSRYGFWNLSGEISPSLKMLESLKHLD  115

Query  257  lsfndfERIP--SFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDL  430
            LSFN F  IP   F GSL NL YL+LS+    G + P+LGN+SSL++LD+ +N I     
Sbjct  116  LSFNTFNGIPIXEFFGSLKNLQYLNLSHAGFSGRILPNLGNLSSLQFLDVSSNXIS----  171

Query  431  KVVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
              VD LEW++ + S+EYLNM+G DL  V  DW
Sbjct  172  --VDNLEWVTGIVSMEYLNMNGADLSXVGPDW  201



>ref|XP_010908803.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At1g35710 [Elaeis guineensis]
Length=967

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 97/176 (55%), Gaps = 9/176 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL FK          L S     +CC W GV CDN  TGHV+A+ L    L  D  
Sbjct  37   ERLALLRFK--AGLKDPHQLLSSWMGANCCAWTGVSCDN-ETGHVIAIDLRYHHLSNDHS  93

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLDLSYNNLFGNV  355
              +   L GEI  SLL L  L  LDLS N+F    IP +IGS+  L YL+LS     G +
Sbjct  94   TDWR--LGGEIGSSLLDLKDLKHLDLSSNNFGGRTIPHYIGSMAELRYLNLSNAGFSGRI  151

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S+L+YLD+ N+F    DL   D++ W+S L+SL YL+M  V L   SDW
Sbjct  152  PHQLGNLSNLEYLDL-NSFHSLYDLN-ADSIRWLSNLASLRYLDMTRVTLAKASDW  205



>gb|EMT24091.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Aegilops 
tauschii]
Length=964

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 92/175 (53%), Gaps = 10/175 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-wgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER ALL+FK  +  DP   L S   +  DCC+W G+ CDN+T GHVV L LG +G    G
Sbjct  13   ERDALLAFKQGVSDDPKDYLGSWRQERQDCCQWAGITCDNVT-GHVVELDLG-QGNYLAG  70

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
                P LL  E            +         R+P F+GSL NL YLDLS  +  G VP
Sbjct  71   Q-ISPSLLSLE-----HLEYLNLWGTGLCGPGGRVPEFLGSLKNLKYLDLSGMSFSGMVP  124

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  GN+S L+YLD+     +   + + D + W++ L  L  L+M  ++L S++DW
Sbjct  125  PQFGNLSKLEYLDLSRIHFNNTQMVLTD-ISWLTRLPLLVQLDMSLINLSSIADW  178



>gb|EMT21339.1| DNA-damage-repair/toleration protein [Aegilops tauschii]
Length=274

 Score = 81.3 bits (199),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 87/148 (59%), Gaps = 11/148 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKWKGV C +    HVV L L   G C         +L G I  SLL L  L +L+LS 
Sbjct  82   CCKWKGVYCSS-RNNHVVKLDLPGHG-CDHNDDTMTQVLGGNISSSLLGLQQLKYLNLSC  139

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N F+  +IP FIGSL+ L Y+DLS +   G +PP LGN+SSL+YL++ +N          
Sbjct  140  NGFDGVQIPKFIGSLHKLRYIDLSMSMFTGRIPPQLGNLSSLRYLNLASN-------TYS  192

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            + + W+S L+SLE+L++  VDL +V  W
Sbjct  193  NGITWLSRLTSLEHLDLTFVDLSTVVHW  220



>ref|XP_009405127.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Musa acuminata subsp. malaccensis]
Length=982

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 110/178 (62%), Gaps = 15/178 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-GLEGLCTDG  178
            ER ALL+F+ + I DP   LSSW    DCC+W GV CD+ TTG VV L+L   E +  + 
Sbjct  33   ERDALLTFR-TRIVDPSHRLSSWRRLVDCCRWNGVVCDD-TTGRVVELNLQNSEDMTVE-  89

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLDLSYNNLFGN  352
                   L+GEI PSLL L  L+ LDL+ NDF    IP+F+GS   L YL+LS++N  G+
Sbjct  90   --ANQAALRGEISPSLLSLTHLDRLDLNHNDFGGSPIPTFLGSFPKLTYLNLSWSNFSGS  147

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS-DW  523
            +PP LGN+SSL+ LD+ +  +        D L W+S LSSL YL+M GV+L   S DW
Sbjct  148  IPPQLGNLSSLRSLDLYSYGLSS------DGLHWLSRLSSLRYLDMSGVNLSMASHDW  199



>gb|KJB26099.1| hypothetical protein B456_004G225800, partial [Gossypium raimondii]
Length=906

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 101/174 (58%), Gaps = 14/174 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  +       +S   ++++CC W GVGCDN +TGHVV L L          
Sbjct  17   ERRALLDFKKGLTVVANHLVSWTSEEEECCNWIGVGCDN-STGHVVKLDL----------  65

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
              Y     GEI  SLL L  L+ LDLSFN F +IP FIGSL+ L YLDLSYN L G +P 
Sbjct  66   --YWMFTTGEIGYSLLELKHLSHLDLSFNSFHKIPDFIGSLSELTYLDLSYNPLTGIIPH  123

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S L YLD+  +      LK  D LEW+S+LSSL+ L +   +    ++W
Sbjct  124  QLGNLSRLLYLDLVPDLFYLHSLK-SDNLEWLSHLSSLKSLKIGSTNFTKATNW  176



>gb|EMT27475.1| Lysyl-tRNA synthetase [Aegilops tauschii]
Length=1519

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 101/176 (57%), Gaps = 11/176 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALLSFK S +       S  G D  CC+W+GV CDN +TGHVV   + L     D  
Sbjct  704  EREALLSFKESFLDPTGRLSSWRGRD--CCRWQGVRCDN-STGHVV--RINLRNTAQDPW  758

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfER--IPSFIGSLNNLVYLDLSYNNLFGNV  355
                 L  GE+  S+  L +L +LDLS+NDF R  IP F G+LNNL YL+LS  N  G +
Sbjct  759  SADLMLSSGELSSSITGLRYLRYLDLSYNDFNRTSIPMFFGALNNLRYLNLSCANFEGRI  818

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PPH+GN+S L+YLD+ +   D   L  V    W+  LS L +L++  V + S  +W
Sbjct  819  PPHIGNLSKLRYLDVSD---DTGSLS-VSHFSWLRRLSVLIHLDVSRVFVRSARNW  870



>gb|EEC68364.1| hypothetical protein OsI_36499 [Oryza sativa Indica Group]
Length=720

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 12/155 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+W+GV C + T GHV+ L L       D    +   L GEI  SL+ L  L +LDLS 
Sbjct  73   CCRWRGVQCSDQTAGHVIKLDLR-NAFQDDH--HHDATLVGEIGQSLISLEHLEYLDLSM  129

Query  266  ndfE----RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLK  433
            N+ E    R+P F+GS  +L YL+LS     G VPPH+GN+S+L+ LD+  + +   D+ 
Sbjct  130  NNLEGPTGRLPEFLGSFKSLRYLNLSGIRFSGMVPPHIGNLSNLQILDLSISTVHQDDIY  189

Query  434  VVDTL-----EWISYLSSLEYLNMDGVDLHSVSDW  523
             +  L      W++ LSSL+YLN++GV+L +  DW
Sbjct  190  YLPFLYSGDASWLARLSSLQYLNLNGVNLSAALDW  224



>gb|EMS60635.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Triticum 
urartu]
Length=1077

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 91/158 (58%), Gaps = 20/158 (13%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPG-----LLQGEIxpsllhlpflnf  250
            CC+WKGV C N  T HVV L L        GP    G     +L G I  SLL L  L +
Sbjct  70   CCRWKGVYCSN-RTRHVVRLDL-------RGPDYRNGNQSRQVLAGNISSSLLGLHHLRY  121

Query  251  ldlsfndfER--IPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQ  424
            LDLS N F++  IP FIGSL+ L YLDLS++   G +PPHLGN+S+L+YL++  N     
Sbjct  122  LDLSQNRFDKKQIPEFIGSLHQLRYLDLSWSQFTGRIPPHLGNLSNLQYLNLDTNSYVSV  181

Query  425  DLKV-----VDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            D           + W+S L+SLE+L+M GV+L ++  W
Sbjct  182  DSSFHSGTYSTNITWLSRLTSLEHLDMTGVNLSTIVHW  219



>gb|ABA94303.1| Leucine Rich Repeat family protein [Oryza sativa Japonica Group]
 gb|EAZ18747.1| hypothetical protein OsJ_34268 [Oryza sativa Japonica Group]
Length=921

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 12/155 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC+W+GV C + T GHV+ L L       D    +   L GEI  SL+ L  L +LDLS 
Sbjct  55   CCRWRGVQCSDQTAGHVIKLDLR-NAFQDDHH--HDATLVGEIGQSLISLEHLEYLDLSM  111

Query  266  ndfE----RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLK  433
            N+ E    R+P F+GS  +L YL+LS     G VPPH+GN+S+L+ LD+  + +   D+ 
Sbjct  112  NNLEGPTGRLPEFLGSFKSLRYLNLSGIRFSGMVPPHIGNLSNLQILDLSISTVHQDDIY  171

Query  434  VVDTL-----EWISYLSSLEYLNMDGVDLHSVSDW  523
             +  L      W++ LSSL+YLN++GV+L +  DW
Sbjct  172  YLPFLYSGDASWLARLSSLQYLNLNGVNLSAALDW  206



>ref|XP_009378842.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=983

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +D DCC W GV CD++T GH+  LHL       D 
Sbjct  41   ERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHMT-GHIHELHLNNSDSDWDC  99

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              C+ G +   +             +       +IPSF GS+ +L +L+L+Y+   G +P
Sbjct  100  NSCFGGKINPSLLSLKHLNYLDLSNNDFRTT--QIPSFFGSMTSLTHLNLAYSQFDGVIP  157

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              LGN+SSL+YL++ + +        V+ L+WIS LS L++L++  V+L   SDW
Sbjct  158  HKLGNLSSLRYLNVSSLYYSS---LTVENLQWISGLSLLKHLDLSSVNLSKASDW  209



>gb|EYU31380.1| hypothetical protein MIMGU_mgv1a023932mg [Erythranthe guttata]
Length=964

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 87/176 (49%), Gaps = 14/176 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL-GLEGLCTDG  178
            E++ALL+FK  +        S      +CC W GV C N  TG V  L L   +G    G
Sbjct  34   EKEALLNFKKYLKDPSNLLSSWNSAHVNCCNWNGVVCSN-KTGRVHQLRLQNYDGFQELG  92

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
                P LL                     +  E IPSFIGSL  L YLDLS    +G +P
Sbjct  93   GKLNPSLLN--------LKHLKYLDLSQNDFEETIPSFIGSLTRLEYLDLSNAGFYGTIP  144

Query  359  PHLGNISSLKYLDI-GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              +GN+S+L+ L++ GN++  G D    D++EW+S LS LE LNM+ V+L    +W
Sbjct  145  HSIGNLSNLRTLNLEGNSYRSGLD---GDSIEWLSGLSQLEQLNMNYVNLSKQDNW  197



>gb|EMT24090.1| Somatic embryogenesis receptor kinase 1 [Aegilops tauschii]
Length=217

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 77/166 (46%), Gaps = 15/166 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+FK  +        S      DCC+W G+ C+N+T GHVV L LG   L     
Sbjct  38   ERDALLAFKQGMNDTYGELGSWQRGHQDCCQWAGITCNNVT-GHVVKLELGERYLVGQIS  96

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
            P    L   E         +            R+P F+GSL NL +LDLS     G VPP
Sbjct  97   PSLLSLEHLEYLDLNWTRLYGPDG--------RVPVFLGSLKNLRHLDLSGMPFSGRVPP  148

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGV  499
             LGN+S L+YLD+  N+  G           +  LS LEYL++  +
Sbjct  149  QLGNLSKLEYLDLSGNYFTGA------VPPQLGNLSKLEYLDLSAI  188



>ref|XP_004513677.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Cicer arietinum]
Length=1047

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 94/154 (61%), Gaps = 16/154 (10%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVA--LHLGLEGLCTDGPPCYPGL-LQGEIxpsllhlpflnfld  256
            CC+W G+ CDNIT G VVA  LH     L    P  Y    L GE+ PSL+ L  L+ LD
Sbjct  74   CCQWHGIYCDNIT-GSVVAIDLHNPHPVLFASSPSKYGTWNLSGELRPSLMKLKSLSHLD  132

Query  257  lsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDL  430
            LSFN F    IP F GSL NL YL+LS     G +PPHLGN+S L++LD+       +D 
Sbjct  133  LSFNTFMGIPIPMFFGSLVNLQYLNLSNAGFAGMIPPHLGNLSQLQFLDL-------KDF  185

Query  431  KV-VDTLEWISYLSSLEYLNMDGVDLHSVS--DW  523
             + V+ L+W++ L SL++L MDGVDL S+S  DW
Sbjct  186  SLHVENLQWVAGLVSLKHLAMDGVDLSSISRTDW  219



>ref|XP_009398960.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Musa acuminata subsp. malaccensis]
Length=984

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 106/177 (60%), Gaps = 13/177 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+F+ + I DP   LSSW    DCC+W GV CDN TTG VV L+L  E       
Sbjct  34   ERDALLAFR-ARIVDPSHRLSSWRRRVDCCRWNGVVCDN-TTGRVVELNL--ENSADMTF  89

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                  L+GEI PSLL L  L+ LDL+ NDF    IP+F+GS   L YL+LS++N  G +
Sbjct  90   ESNQAALRGEISPSLLSLTHLDRLDLNHNDFGGSPIPAFLGSFPKLTYLNLSWSNFSGAI  149

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS-DW  523
            PP LGN+SSL+ LD+ +  +        D L W+S LSSL YL+M  V+L   S DW
Sbjct  150  PPQLGNLSSLRSLDLHSYGLS------TDGLHWLSRLSSLRYLDMSSVNLSMASPDW  200



>ref|XP_006490686.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1-like [Citrus sinensis]
Length=907

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 96/180 (53%), Gaps = 21/180 (12%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FK S++ +     S     +  D CKW GVGC N  TGHV+ L +  + +  D
Sbjct  37   EREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSN-RTGHVIKLEI--QPIDFD  93

Query  176  GPPCY----PGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNL  343
              P      P LLQ       LH      L L+      IP FIGSL  L YLDLS+   
Sbjct  94   SFPLRGTISPALLQ-------LHRLTYLDLSLNNFSGSPIPEFIGSLTTLSYLDLSFAEF  146

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             G +P HLGN+S+L++LD+  N      L  V  L+W+S+LSSL YL++   +L   +DW
Sbjct  147  EGPIPSHLGNLSALQHLDLSLN-----HLFSVGNLDWLSHLSSLTYLDLGSNNLSRSTDW  201



>ref|XP_009346363.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Pyrus x bretschneideri]
 ref|XP_009346364.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Pyrus x bretschneideri]
Length=921

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 93/148 (63%), Gaps = 12/148 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC W GV C N+T GHV  LHL   G   +      GL  G++ PSLL+L  L+ LDLSF
Sbjct  64   CCNWTGVACSNLT-GHVRELHLA--GYQDEVTGENRGL-GGKVNPSLLNLKHLSHLDLSF  119

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            N+FE  +IPSF+GSL  L YLDLS     G +P  LGN+SSL+YLD+  N +      +V
Sbjct  120  NNFEGLQIPSFLGSLKRLRYLDLSGAGFNGTIPHQLGNLSSLRYLDLSYNLL------MV  173

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            + LEW+S LS L++L+M  VDL + S W
Sbjct  174  ENLEWLSGLSLLKHLDMSRVDLTNASRW  201



>ref|XP_008362832.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Malus domestica]
Length=964

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 101/178 (57%), Gaps = 18/178 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVAL---HLGLEGLCT  172
            E+ ALL FK  +I       S     D CC+W+G+ C+N  TGHVV L   H   +    
Sbjct  34   EKTALLQFKQGLIDQSNVLASWETGKD-CCEWRGIACNN-ETGHVVTLDLYHSSFDIYGV  91

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFG  349
              P      L G I PSLL LP+L +LDLSFN F+ +IP FIGSL+ L  L L+  NL G
Sbjct  92   KTP------LSGVIAPSLLELPYLTYLDLSFNHFQGQIPKFIGSLSRLEQLKLAGANLSG  145

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             +PP LGN+SSL  LD+  N +        + LEW+S+LSSL YLNM  ++   V +W
Sbjct  146  PIPPQLGNLSSLYTLDLARNHV------TFENLEWLSHLSSLRYLNMSRLNFSKVVNW  197



>ref|XP_011080440.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Sesamum indicum]
Length=984

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 100/176 (57%), Gaps = 19/176 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E++ALLSFK  +        S     D CC+W GV CDN+T GHV  LHL         P
Sbjct  33   EKQALLSFKQELDDPSNLLSSWDATVD-CCEWDGVLCDNLT-GHVSELHL-------QSP  83

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfn--dfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
                GL  G+I PSLL L  L FLDLS N     +IP F GSL +L Y++LSY    G +
Sbjct  84   DSGSGL-GGKIAPSLLSLKHLRFLDLSQNDFTGTQIPGFFGSLVSLEYVNLSYAGFRGII  142

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P HLGN+S+L+ LD+  +         VD+LEW+S LS LE+LN + V+L  V +W
Sbjct  143  PHHLGNLSNLRTLDLSGSL-------EVDSLEWLSGLSHLEFLNFNYVNLSKVPNW  191



>ref|XP_009375612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=964

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 103/177 (58%), Gaps = 16/177 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL--GLEGLCTD  175
            E+ ALL FK  +I       S     D CCKW+G+ C+N  TGHVV L L      +   
Sbjct  34   EKTALLQFKQGLIDQSNVLASWETGKD-CCKWRGIACNN-KTGHVVTLDLYYNYSDISHV  91

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFGN  352
            G P     L G I PSLL LP+L +LDLSFN+F+  IP FIGSL+ L  L L+  +L G 
Sbjct  92   GTP-----LSGVISPSLLELPYLTYLDLSFNNFQGEIPKFIGSLSRLEQLKLAGADLSGP  146

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP LGN+SSL  LD+  N++        + LEW+S+LSSL YLNM  ++   V +W
Sbjct  147  IPPQLGNLSSLYTLDLAWNYV------TFENLEWLSHLSSLRYLNMSRLNFSEVVNW  197



>emb|CAN63882.1| hypothetical protein VITISV_002032 [Vitis vinifera]
Length=898

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 103/177 (58%), Gaps = 11/177 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKALL FK+ +        S  G D  CCKWKGV C+N  TGHVV + L   G  +   
Sbjct  45   ERKALLEFKNGLKDPSGRLSSWVGAD--CCKWKGVDCNN-QTGHVVKVDLKSGGXFSRLG  101

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNV  355
              +   L GEI  SLL L  L +LDLS NDF+   IP+F+GS   L YL+LS     G +
Sbjct  102  GGF-SRLGGEISGSLLDLKHLTYLDLSLNDFQGIPIPNFLGSFERLRYLNLSNARFGGMI  160

Query  356  PPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDL-HSVSDW  523
            PPHLGN+S L+YLDI    + G     V  L W+S LSSL+YL++  VDL  + ++W
Sbjct  161  PPHLGNLSQLRYLDI----LGGDYPMRVSNLNWLSGLSSLKYLDLAYVDLSKATTNW  213



>ref|XP_009389804.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PEPR1 
[Musa acuminata subsp. malaccensis]
Length=998

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 101/189 (53%), Gaps = 20/189 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL----------  151
            ERKAL+ FK  +        S  G+D  CC W+G+ C N+T GHV+ LHL          
Sbjct  8    ERKALMEFKQRVRDPSHRLSSWVGED--CCSWEGIRCSNVT-GHVIELHLRNRHRSDVSY  64

Query  152  ---GLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLV  316
                      D   C   L  G I PSLL L  LN LDLS N+FE  RIP F+GS   L 
Sbjct  65   MDCSETNFDDDDVGCRWAL-HGGITPSLLSLQHLNHLDLSGNNFEGNRIPEFLGSFRRLT  123

Query  317  YLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDG  496
            YL+LS     G VP  LGNIS+L  LD+  NF    DL  ++ + WIS L+SL++L M+ 
Sbjct  124  YLNLSSAGFGGRVPDQLGNISTLHQLDLSYNFYSNYDLH-IENIGWISRLTSLQHLYMNW  182

Query  497  VDLHSVSDW  523
            V   +VS+W
Sbjct  183  VSFRNVSNW  191



>gb|EMT32765.1| LRR receptor-like serine/threonine-protein kinase FLS2 [Aegilops 
tauschii]
Length=896

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 84/174 (48%), Gaps = 14/174 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALL+FK  I        S      DCC+W G+ C N+T G V+ L L          
Sbjct  40   ERDALLAFKQGINDTGDELGSWQPGRQDCCRWAGITCSNVT-GRVIGLDLSRRFSLV---  95

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
                G +   +                     RIP F+GSL NL +LDLSY      VPP
Sbjct  96   ----GQISPSLLSLEHLQYLNLQSTSLCGHDGRIPEFLGSLKNLRHLDLSYIYCSDTVPP  151

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S L+YLD+ N      ++ ++D + W+++L  L YL++  ++L S++DW
Sbjct  152  QLGNLSKLEYLDLSN-----MEMDLID-ISWLAHLPRLMYLDISYMNLSSIADW  199



>ref|XP_007030467.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY10969.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=1016

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 102/182 (56%), Gaps = 12/182 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALL FK  II       +     D CC W GV CDN+T GHV  L L    +     
Sbjct  38   ERQALLKFKQDIIDRSNRLSAWADGGD-CCNWVGVSCDNLT-GHVYKLDLRPSSISDYAS  95

Query  182  PCYPG-----LLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNN  340
                G     LL+G I PSLL L  L+ LDLS N+F   +IP F+GS+ +L YLDLS   
Sbjct  96   DAEIGVYWRSLLRGRINPSLLLLKHLSHLDLSLNNFGGLQIPQFLGSMESLTYLDLSKAG  155

Query  341  LFGNVPPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
              G +P  LGN+S L++L++G  NF     L     L+W+S LSSL+YL++ GVDL   +
Sbjct  156  FGGALPHQLGNLSKLQHLNLGVTNF--RYPLVEARNLQWLSGLSSLQYLDLSGVDLSKAT  213

Query  518  DW  523
            DW
Sbjct  214  DW  215



>ref|XP_010249615.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Nelumbo nucifera]
Length=902

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 103/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL+ K  +        S      +DCC+W+GVGCDN  TGHVV L+L         
Sbjct  36   ERQALLNLKQGLSDPTNFLSSWDSTSKEDCCRWRGVGCDN-RTGHVVQLNLR--------  86

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndf--ERIPSFIGSLNNLVYLDLSYNNLFGN  352
               Y   + G+I   LL L  L +LDLS NDF    IP F+GSL NL YL+LS +   G 
Sbjct  87   -NSYESFIGGDINHHLLQLKHLRYLDLSGNDFGGNPIPEFLGSLQNLNYLNLSQSGFGGT  145

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +PP LGN+SSL+YLD+GN+         V+ LEW+S+LS L++L+M  V L  V DW
Sbjct  146  LPPQLGNLSSLRYLDLGNSVG-----LTVENLEWLSHLSLLQHLDMTSVSLSHVDDW  197



>ref|XP_011462016.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Fragaria vesca subsp. vesca]
Length=1044

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 104/182 (57%), Gaps = 23/182 (13%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER+ALLSFK ++        S  G D  CC+WKG+ C+N  TGHV  + L         P
Sbjct  107  ERQALLSFKRNVNDSSGRLSSWVGLD--CCRWKGISCNN-RTGHVAQMDL-------RNP  156

Query  182  PCYPGL--------LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLS  331
              +P          L G I PSLL L  L  LDLS NDF   RIP F G L +L YL+LS
Sbjct  157  NYHPEYDSSDQDTSLGGNINPSLLSLKKLYSLDLSGNDFRGLRIPDFFGKLTSLRYLNLS  216

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
            Y +  G +PP LGN+S+L YLD+ + +    D    + L W+S+LSSL+YLN+ GV+L S
Sbjct  217  YASFKGEIPPTLGNLSNLNYLDLNSYYY---DYCYSNNLNWLSHLSSLKYLNLGGVNLSS  273

Query  512  VS  517
            ++
Sbjct  274  LA  275



>gb|EMS47944.1| LRR receptor-like serine/threonine-protein kinase GSO2 [Triticum 
urartu]
Length=965

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 97/174 (56%), Gaps = 11/174 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ER ALLSFK  I SDP+  L SW  +D CC+W+GV C N  TGHV  L L L  L TDG 
Sbjct  42   ERDALLSFKRGITSDPMGVLDSWHKED-CCQWRGVKCSN-RTGHV--LRLQLRNLHTDGY  97

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
                G +   +      +     ++       R+P F+GSL  L YL+LS    +G VPP
Sbjct  98   YMV-GQISNSLLSMDRLVHLDLSMNYLEGPSGRMPEFLGSLTRLRYLNLSGIPFYGRVPP  156

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S+L+++D+    +  +D      + W++ + SL+ L M+GV+L ++ DW
Sbjct  157  QLGNLSNLQHIDLSWCGMYSRD------ISWVARIPSLQSLEMNGVNLSTIVDW  204



>ref|XP_009378848.1| PREDICTED: uncharacterized protein LOC103967297 [Pyrus x bretschneideri]
Length=1903

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +D DCC W GV CD++T GH+  LHL       D 
Sbjct  41   ERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHMT-GHIHELHLNNSDSDWDC  99

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              C+ G +   +             +       +IPSF GS+ +L +L+L+Y+   G +P
Sbjct  100  NSCFGGKINPSLLSLKHLNYLDLSNNDFRTT--QIPSFFGSMTSLTHLNLAYSQFDGVIP  157

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              LGN+SSL+YL++ + +        V+ L+WIS LS L++L++  V+L   SDW
Sbjct  158  HKLGNLSSLRYLNVSSLYYSS---LTVENLQWISGLSLLKHLDLSSVNLSKASDW  209



>emb|CBI22733.3| unnamed protein product [Vitis vinifera]
Length=558

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 78/155 (50%), Gaps = 22/155 (14%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTD---------GPPCYPGLLQGEIxpsllhlp  238
            CC+W+ V C+N+T G VV LHLG      D         G    P LL+ E    L    
Sbjct  86   CCRWEAVRCNNVT-GRVVELHLGNPYDTDDLEFNSKFELGGEISPALLELEFLSYLNLSG  144

Query  239  flnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFID  418
                          IPSF+GS+ +L YLDLSY    G V   LGN+S+L++LD+G     
Sbjct  145  NDFGG-------SPIPSFLGSMGSLRYLDLSYAGFGGLVLHQLGNLSTLRHLDLG-----  192

Query  419  GQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G     V+ L WIS+L+ L+YL MD VDLH    W
Sbjct  193  GNSGLYVENLGWISHLAFLKYLGMDWVDLHREVHW  227



>ref|XP_009362742.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Pyrus x bretschneideri]
Length=979

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 101/177 (57%), Gaps = 15/177 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER ALL FK  +        S    +  DCC W GV CD+IT GH+  LHL       D 
Sbjct  41   ERDALLMFKQDLKDPANRLSSWVAEEGSDCCSWTGVVCDHIT-GHIHELHLNSSHSEWDS  99

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsf--ndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
                  LL G+I PSLL L  LN+LDLS       RIPSF GS+ +L +L+L ++  +G 
Sbjct  100  -----DLLSGKINPSLLSLKHLNYLDLSHNDFSTTRIPSFFGSMTSLTHLNLGHSQFYGI  154

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ +N ++      V+ L+WIS LS L++ ++  V+L   SDW
Sbjct  155  IPHKLGNLSSLRYLNLSSNILE------VENLQWISGLSMLKHFDLSYVNLGKASDW  205



>ref|XP_010662661.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO2 [Vitis vinifera]
Length=676

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 101/179 (56%), Gaps = 18/179 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL FK  I+ D     S  +  D  DCC+W+GV C N+ TGHVV L LG  G    
Sbjct  43   ERQALLKFKQGIVDDFGILSSWGNEEDKTDCCRWEGVQCSNL-TGHVVMLDLGAYGYNES  101

Query  176  GPPCYPGLLQGEIxpsllhlpflnf--ldlsfndfERIPSFIGSLNNLVYLDLSYNNLFG  349
                    L+G+I  SLL L  L    L  +  + E +P FIGS   + YL+LS  + FG
Sbjct  102  ------RYLRGKISHSLLGLQHLRHLDLSGNNFEGESMPEFIGSFTKMRYLNLSSTHFFG  155

Query  350  NVPPHLGNISSLKYLDI-GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             +P  LGN+S+L  LD+ GN+ +  ++      L+W+S+LSSL +LN++G +L  V  W
Sbjct  156  TLPCQLGNLSNLNSLDLSGNSHMSSEN------LDWLSHLSSLTHLNLNGANLSKVIQW  208



>ref|XP_007035263.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY06189.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=1011

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 107/185 (58%), Gaps = 16/185 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            ER+AL  FKH +I           ++D CC W GV CDN+ TGHV+ LHL    L +   
Sbjct  28   EREALFMFKHDLIDHANRLAFWTLNED-CCGWVGVVCDNV-TGHVLELHLRNPSLSSSVG  85

Query  176  ---GPPCYPGL----LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDL  328
                   Y  L    L+G+I PSLL L  L +LDLS N FE   IP F+GS+ +L YL+L
Sbjct  86   FYANDAEYEALERSKLRGKINPSLLELKHLTYLDLSNNAFEGIPIPQFLGSIESLRYLNL  145

Query  329  SYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLH  508
            S     G VP  LGN+SSL+YL++   + D +D   V  L+W+S LSSLE+L++  V+L 
Sbjct  146  SNAGFGGLVPHQLGNLSSLRYLNL---YADDKDHLHVANLQWLSGLSSLEHLDLGNVNLT  202

Query  509  SVSDW  523
              S+W
Sbjct  203  KASNW  207



>gb|AGO64661.1| receptor-like protein [Pyrus communis]
Length=1011

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 96/175 (55%), Gaps = 7/175 (4%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +       LS    +  DCC W GV CD++T GH+  LHL       D 
Sbjct  37   ERQALLMFKQDLEDPTNRLLSWVAEEGSDCCSWTGVVCDHMT-GHIHELHLNNSDFDWDC  95

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
              C+ G +   +             +       RIPSF GS+ +L +L+L+ ++  G +P
Sbjct  96   NSCFSGKINPSLLSLKHLDFLDLSNNDFNGT--RIPSFFGSMTSLTHLNLAPSSFHGVIP  153

Query  359  PHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
              LGN+SSL+YL++ ++F D  +LK V+ L+WIS LS L++L++  V+L   SDW
Sbjct  154  HKLGNLSSLRYLNL-SSFYD-PNLK-VENLQWISGLSLLKHLDLSYVNLSKASDW  205



>ref|XP_011091762.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein 12 [Sesamum 
indicum]
Length=1040

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 102/177 (58%), Gaps = 18/177 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGH-VVALHLGLEGLCTDG  178
            +R+ALL FK+ +        S  G D  CC W+G+ CDN+T G  V+ LH          
Sbjct  38   DRRALLDFKNGLNDPENVLSSWQGAD--CCGWRGIVCDNVTGGVLVIDLH-------NPY  88

Query  179  PPCYPGL--LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLF  346
            PP Y GL  L GEI  SL+ L  L  LDLS N+F    IP F+GSL NL YL+LS     
Sbjct  89   PPGY-GLWNLSGEIRSSLVQLESLKHLDLSSNEFGGITIPEFLGSLKNLQYLNLSNCGFS  147

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            G +PP+LGN+S L++LD+ N    G      D L+W++ L SL++L+M+ VDL  VS
Sbjct  148  GTIPPNLGNLSRLEFLDVSNQVFPGL---AADHLQWMTGLVSLKHLDMNSVDLSLVS  201



>ref|XP_010920367.1| PREDICTED: receptor-like protein 12 [Elaeis guineensis]
Length=1056

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 98/183 (54%), Gaps = 31/183 (17%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKALL FK  +        S  G +  CC+W+GV CDN  TG V+         C D  
Sbjct  39   ERKALLQFKSGLSDPENRLSSWQGRN--CCRWRGVSCDN-QTGSVI---------CIDLH  86

Query  182  PCYPGL-------------LQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLV  316
              YP               L G I PSLL L  L  LDLS+N FE  RIP FIG LNNL 
Sbjct  87   NPYPNYFGSVSNNRNGFWNLSGRIDPSLLQLKSLRHLDLSYNTFEGIRIPEFIGCLNNLR  146

Query  317  YLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDG  496
            YL+LS     G +P  LGN+S L YLD+ + F   Q L  V++ +W++ LSSL +L MDG
Sbjct  147  YLNLSNAGFVGIIPSQLGNLSRLHYLDLSSGF---QPL-TVESFQWVTDLSSLVHLAMDG  202

Query  497  VDL  505
            VDL
Sbjct  203  VDL  205



>ref|XP_008375192.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Malus domestica]
Length=1017

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 99/181 (55%), Gaps = 20/181 (11%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLG------LE  160
            ER+ALL FK  +        S    +D DCC W GV CD+IT GHV  LHL       L+
Sbjct  41   ERQALLMFKQDLKDPANRLASWVSEEDSDCCSWTGVVCDHIT-GHVHELHLNSSYHSFLD  99

Query  161  GLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNN  340
               + G    P LL        L       L  +  +  +IPSF GS+ +L +L+L+Y+ 
Sbjct  100  VKSSFGGMINPSLL-------GLKHLNFLDLSYNHFNGTQIPSFFGSMTSLTHLNLAYSE  152

Query  341  LFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSD  520
             +G VP  LGN+SSL+YL++ + +    +LK V+ L+WIS LS L++L++  V+L   SD
Sbjct  153  FYGIVPHKLGNLSSLRYLNLSSYY----NLK-VENLQWISGLSLLKHLDLSSVNLSKASD  207

Query  521  W  523
            W
Sbjct  208  W  208



>ref|XP_010908117.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g63930 [Elaeis guineensis]
Length=994

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 102/178 (57%), Gaps = 12/178 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCT--D  175
            ER ALL FK  +        S  GDD  CC W+GV CDN  TGHVV L L      +  D
Sbjct  35   ERNALLGFKEGLKDPSNRLSSWVGDD--CCTWEGVACDN-RTGHVVKLDLRNPHPFSFID  91

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYNNLFG  349
             PP     L GE+ PSLL L  LN+LDLS N F   RIP F+GS   L YL+LS   L G
Sbjct  92   YPPNNNWSLGGELRPSLLGLKHLNYLDLSMNYFGGIRIPEFMGSFRQLKYLNLSNAGLGG  151

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             +P HLGN+SSL+YLD+ N+     DL + + L WIS+LSSL YL+M  V     + W
Sbjct  152  LIPHHLGNLSSLQYLDLVNDL----DLSIDNAL-WISHLSSLRYLDMTDVKFREDAHW  204



>ref|NP_001068100.1| Os11g0558900 [Oryza sativa Japonica Group]
 gb|ABA94299.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28463.1| Os11g0558900 [Oryza sativa Japonica Group]
 gb|EEE52281.1| hypothetical protein OsJ_34267 [Oryza sativa Japonica Group]
Length=986

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslss-----wgddddCCKWKGVGCDNITTGHVVALHLGLEGL  166
            ER ALL+FK  +  DP   L+S         +DCC+W+GV C N  TGHVV L L  +  
Sbjct  50   ERDALLAFKEGVTDDPAGLLASWRRGGGQLQEDCCQWRGVRCSN-RTGHVVKLRLRNDHA  108

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLF  346
             T       G +   +            ++        +P F+GS  +L YL+LS     
Sbjct  109  GT----ALAGEIGQSLISLEHLRYLDLSMNNLAGSTGHVPEFLGSFRSLRYLNLSGIVFS  164

Query  347  GNVPPHLGNISSLKYLDIGNNFIDGQ-DLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G VPP LGN+S+L+YLD+    + G      ++   W+++LS+L+YL +DGV+L +V DW
Sbjct  165  GMVPPQLGNLSNLRYLDLSRIRLSGMVPFLYINDGSWLAHLSNLQYLKLDGVNLSTVVDW  224



>gb|AEQ27754.1| receptor-like protein [Malus sieversii]
Length=982

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 97/176 (55%), Gaps = 9/176 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +D DCC W GV CD+ TTGH+  LHL       D 
Sbjct  41   ERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDH-TTGHIHELHLNNTDSFLDF  99

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
               + G +   +             +       +IPSF GS+ +L +L+L+Y+ +FG V 
Sbjct  100  ESSFGGKINPSLLSLKHLNFLDLSNNNFNGT--QIPSFFGSMTSLKHLNLAYS-VFGGVI  156

Query  359  PH-LGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PH LGN+SSL+YL++ + +  G +LK V+ ++WIS LS L++L++  V+L   SDW
Sbjct  157  PHKLGNLSSLRYLNLSSFY--GSNLK-VENIQWISGLSLLKHLDLSSVNLSKASDW  209



>ref|XP_010646026.1| PREDICTED: leucine-rich repeat receptor-like protein kinase PXL1 
[Vitis vinifera]
Length=562

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 89/148 (60%), Gaps = 9/148 (6%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CC W+GV C N TTG V+ L+L  + LC D      G L GEI  SLL L  L +LDLS 
Sbjct  69   CCNWEGVHCHN-TTGIVLKLNLRWD-LCQDH-----GSLGGEISSSLLDLKHLRYLDLSC  121

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV  439
            NDF    IP F GSL+NL YL+L      G +P  LGN+S L YLDIGN++ D ++    
Sbjct  122  NDFGILNIPKFFGSLSNLRYLNLFTAGFGGVIPHQLGNLSKLHYLDIGNSYYDPRNSLNA  181

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            + LEWIS  + LE+L M  V+L   S+W
Sbjct  182  EDLEWISGPTFLEFLYMSNVNLRKASNW  209



>gb|KDO36772.1| hypothetical protein CISIN_1g041155mg, partial [Citrus sinensis]
Length=471

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 95/184 (52%), Gaps = 29/184 (16%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLG-------  154
            ER+ALL+FK S++ +     S     +  D CKW GVGC N  TGHV+ L +        
Sbjct  115  EREALLTFKESLVDESGVLSSWGPEDEKRDRCKWAGVGCSN-RTGHVIKLEIQPIDFGSF  173

Query  155  -LEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLS  331
             L G  +      P LLQ       LH      L L+      IP FIGSL  L YLDLS
Sbjct  174  PLRGTIS------PALLQ-------LHRLTYLDLSLNNFSGSPIPEFIGSLTKLSYLDLS  220

Query  332  YNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHS  511
            +    G +P HLGN+S+L++LD+  N      L  V  L+W+S+LSSL YL++   +L  
Sbjct  221  FAEFEGPIPSHLGNLSALQHLDLSLNH-----LFSVGNLDWLSHLSSLTYLDLGSNNLSR  275

Query  512  VSDW  523
             +DW
Sbjct  276  STDW  279



>ref|XP_010646954.1| PREDICTED: receptor-like protein 12 [Vitis vinifera]
Length=453

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 84/148 (57%), Gaps = 9/148 (6%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKW+GV C N  +GHV+ L+L    L  DG     G L GEI  SL +L  L+    +F
Sbjct  70   CCKWRGVVC-NHRSGHVIKLNL--RSLDDDGTH---GKLGGEISHSLKYLNQLDLSMNNF  123

Query  266  ndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGN--NFIDGQDLKVV  439
                RIP  IGSL  L YL+LS  +  G +PP LGN+S L YLD+    +F    D    
Sbjct  124  EGT-RIPKLIGSLEKLRYLNLSGASFSGPIPPQLGNLSRLIYLDLKEYFDFNTYPDESSQ  182

Query  440  DTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            + L+WIS LSSL +LN+ GV+L   S +
Sbjct  183  NDLQWISGLSSLRHLNLGGVNLSRASAY  210



>ref|XP_009781238.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
FLS2 [Nicotiana sylvestris]
Length=1053

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 87/151 (58%), Gaps = 10/151 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGL--LQGEIxpsllhlpflnfldl  259
            CCKW+GV C N TTG V+ + L              G   L GEI PSLL +  L +LDL
Sbjct  62   CCKWRGVRCSN-TTGSVIKIDLHNPFPVNSADVTRYGFWNLSGEIRPSLLKIQSLQYLDL  120

Query  260  sfndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDLK  433
            S N F    IP F+GSL NL YL+LS    FG +PP LGN+S L+YLD+ + F       
Sbjct  121  SLNTFGGIPIPRFVGSLKNLEYLNLSKAGFFGTIPPTLGNLSHLQYLDVSSEF----SAL  176

Query  434  VVDTLEWISYLSSLEYLNMDGVDLHSV-SDW  523
             V+  +W+++L SL++L M+ VDL  V S W
Sbjct  177  TVENFQWVTHLVSLKHLGMNQVDLSMVGSSW  207



>ref|XP_008361472.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
isoform X1 [Malus domestica]
Length=1041

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +D DCC W GV CD+IT GH+  LHL      TD 
Sbjct  41   ERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHIT-GHIHELHLN----NTDR  95

Query  179  PPCYPGLLQGEIxpsllhlpflnfl--dlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               +     G+I PSLL L  LN+L    +     +IPSF GS+ +L +L+L  +  +G 
Sbjct  96   YFGFKSSFGGKINPSLLSLKHLNYLDLSYNNFSTTQIPSFFGSMTSLTHLNLGQSKFYGI  155

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ ++F   +    V+ L+WIS LS L++L++  V+L   SDW
Sbjct  156  IPHKLGNLSSLRYLNLNSSFNFYRSTLQVENLQWISGLSLLKHLDLSYVNLSKASDW  212



>ref|XP_003634127.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
GSO1 isoform X1 [Vitis vinifera]
Length=892

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 78/155 (50%), Gaps = 22/155 (14%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTD---------GPPCYPGLLQGEIxpsllhlp  238
            CC+W+ V C+N+T G VV LHLG      D         G    P LL+ E    L    
Sbjct  62   CCRWEAVRCNNVT-GRVVELHLGNPYDTDDLEFNSKFELGGEISPALLELEFLSYLNLSG  120

Query  239  flnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFID  418
                          IPSF+GS+ +L YLDLSY    G V   LGN+S+L++LD+G     
Sbjct  121  NDFGG-------SPIPSFLGSMGSLRYLDLSYAGFGGLVLHQLGNLSTLRHLDLG-----  168

Query  419  GQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            G     V+ L WIS+L+ L+YL MD VDLH    W
Sbjct  169  GNSGLYVENLGWISHLAFLKYLGMDWVDLHREVHW  203



>ref|XP_009347195.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 
[Pyrus x bretschneideri]
Length=1048

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 77/152 (51%), Gaps = 19/152 (13%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLG-----LEG-LCTDGPPCYPGLLQGEIxpsllhlpfln  247
            CC W GV CDN+T GHV  LHL      + G L   G    P LL        L      
Sbjct  63   CCTWTGVACDNLT-GHVRELHLAGYYDEVTGELHWLGGKVNPSLLN-------LKHLTYL  114

Query  248  fldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQD  427
             L  +     + PSF+GSL  L YL+LS+    G VP  LGN+SSL+YLD+  NF     
Sbjct  115  DLSYNDFGGRQFPSFLGSLKGLRYLNLSHAGFIGTVPHQLGNLSSLRYLDLSWNFGSK--  172

Query  428  LKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
               V+ LEW+S LS L++L M  +DL   S W
Sbjct  173  ---VENLEWLSGLSQLKHLGMGYIDLTRASHW  201



>emb|CAN75074.1| hypothetical protein VITISV_026259 [Vitis vinifera]
Length=540

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 90/148 (61%), Gaps = 10/148 (7%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHLGLEGLCTDGPPCYPGLLQGEIxpsllhlpflnfldlsf  265
            CCKW+GV C N  +GHV+ L+L    L  DG     G L GEI  SLL L +LN LDLS 
Sbjct  70   CCKWRGVVC-NXRSGHVIKLNL--RSLDDDG---THGKLGGEISHSLLDLKYLNXLDLSM  123

Query  266  ndfE--RIPSFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGN--NFIDGQDLK  433
            N+FE  RIP  IGSL  L YL+LS  +  G +PP LGN+S L YLD+    +F    D  
Sbjct  124  NNFEGTRIPKXIGSLEKLRYLNLSGASFSGPIPPQLGNLSRLIYLDLKEYFDFNTYPDES  183

Query  434  VVDTLEWISYLSSLEYLNMDGVDLHSVS  517
              + L+WIS LSSL +LN+ GV+L   S
Sbjct  184  SQNDLQWISGLSSLRHLNLGGVNLSRAS  211



>ref|XP_002268170.2| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180 [Vitis vinifera]
Length=905

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 88/174 (51%), Gaps = 12/174 (7%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            E+ ALLSFK++++    S  S    +D CC W GV C NIT G VV L L   GL     
Sbjct  35   EKHALLSFKNALLDLEHSLSSWSAQED-CCGWNGVRCHNIT-GRVVDLDLFNFGLVGK--  90

Query  182  PCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVPP  361
               P L Q E    L                  IPSF+GS+ +L YLDLS+ +  G +PP
Sbjct  91   -VSPTLFQLEFLNYLDLSWNDFGGTP-------IPSFLGSMKSLTYLDLSFASFGGLIPP  142

Query  362  HLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             LGN+S+L +L +G      +     + L WIS+LSSL+ L M  VDLH    W
Sbjct  143  QLGNLSNLLHLRLGGADSSNEPQLYAENLRWISHLSSLKLLFMHEVDLHREVQW  196



>gb|AEQ27749.1| receptor-like protein [Malus micromalus]
Length=982

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 97/176 (55%), Gaps = 9/176 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +D DCC W GV CD+ TTGH+  LHL       D 
Sbjct  41   ERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDH-TTGHIHELHLNNTDSFLDF  99

Query  179  PPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNVP  358
               + G +   +             +       +IPSF GS+ +L +L+L+Y+ +FG V 
Sbjct  100  ESSFGGKINPSLLSLKHLNFLDLSNNNFNGT--QIPSFFGSMTSLKHLNLAYS-VFGGVI  156

Query  359  PH-LGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            PH LGN+SSL+YL++ + +  G +LK V+ ++WIS LS L++L++  V+L   SDW
Sbjct  157  PHKLGNLSSLRYLNLSSFY--GSNLK-VENIQWISGLSLLKHLDLSSVNLSKASDW  209



>ref|XP_009368771.1| PREDICTED: receptor-like protein kinase 5 [Pyrus x bretschneideri]
Length=516

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 104/178 (58%), Gaps = 18/178 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHL---GLEGLCT  172
            E+ ALL FK  ++ +     S     D CC+W+G+ C N  TGHVV L L     +    
Sbjct  34   EKTALLQFKQGLVDESNVLASWETGKD-CCEWRGIACSN-ETGHVVTLDLYYNSSDVYNV  91

Query  173  DGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNLFG  349
            + P      L G I PSLL LP+L +LDLSFN+F+ +IP FIGSL+ L  L L+  +L G
Sbjct  92   ETP------LSGVIAPSLLELPYLTYLDLSFNNFKGKIPKFIGSLSRLKQLKLAGASLSG  145

Query  350  NVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
             +PP LGN+SSL  LD+  N++        + LEW+S+LSSL YLNM  ++   V +W
Sbjct  146  PIPPQLGNLSSLYALDLARNYV------TFENLEWLSHLSSLRYLNMSRLNFSEVVNW  197



>gb|AEQ27756.1| receptor-like protein [Malus domestica]
Length=1041

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 100/177 (56%), Gaps = 8/177 (5%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls-swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDG  178
            ER+ALL FK  +        S    +D DCC W GV CD+IT GH+  LHL      TD 
Sbjct  41   ERQALLMFKQDLKDPANRLASWVAEEDSDCCSWTGVVCDHIT-GHIHELHLN----NTDR  95

Query  179  PPCYPGLLQGEIxpsllhlpflnfl--dlsfndfERIPSFIGSLNNLVYLDLSYNNLFGN  352
               +     G I PSLL L  LN+L    +     +IPSF GS+ +L +L+L  +  +G 
Sbjct  96   YFGFKSSFGGRINPSLLSLKHLNYLDLSYNNFSTTQIPSFFGSMTSLTHLNLGQSKFYGI  155

Query  353  VPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            +P  LGN+SSL+YL++ ++F   +    V+ L+WIS LS L++L++  V+L   SDW
Sbjct  156  IPHKLGNLSSLRYLNLNSSFNFYRSTLQVENLQWISGLSLLKHLDLSYVNLSKASDW  212



>ref|XP_007038269.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
 gb|EOY22770.1| Disease resistance family protein / LRR family protein, putative 
[Theobroma cacao]
Length=1025

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 102/184 (55%), Gaps = 19/184 (10%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGL-----EGL  166
            ER+ALL F   +  +     S     D CC W GV CDN+T GHV+ LHLG      + +
Sbjct  41   ERQALLRFTQDLTDNSSRLASWSNGGD-CCDWTGVVCDNLT-GHVLELHLGNIHDPNDDV  98

Query  167  CTDGPPCYPGLLQGEIxpsllhlpflnfldlsfndfE-RIPSFIGSLNNLVYLDLSYNNL  343
               G       L G+I  SLL L  L +LDLS N+F  +IP F+GSL NL YL+LS    
Sbjct  99   LVPGKAFERSRLSGKINTSLLDLKHLQYLDLSGNNFGGQIPGFLGSLQNLRYLNLSTAGF  158

Query  344  FGNVPPHLGNISSLKYLDIGNNFIDGQDLKVV----DTLEWISYLSSLEYLNMDGVDLHS  511
             G +PP LGN++ L+YLD+        DL  V    + L+W++ L+ L++L++ G+ L  
Sbjct  159  EGLIPPQLGNLTKLQYLDL-------HDLLSVFLYAENLQWLTSLAQLQHLDLSGISLSK  211

Query  512  VSDW  523
             SDW
Sbjct  212  ASDW  215



>gb|EMT13342.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Aegilops 
tauschii]
Length=992

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 105/183 (57%), Gaps = 14/183 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD--  175
            ER ALLSFK + ++   ++        +CC W GV CDN  TGHV  L L  +    D  
Sbjct  43   ERAALLSFK-AGVTSDPANRLVSWHGHNCCHWSGVRCDNW-TGHVTKLDLRNDLSMKDLY  100

Query  176  GPPCYPGL-LQGEIxpsllhlpflnfldlsfn----dfERIPSFIGSLNNLVYLDLSYNN  340
            G P  P   L+G++  SLL L  L  LDLS N    +   IP F+GSL+ L YL+LS  N
Sbjct  101  GFPKAPSRSLRGQVSSSLLALRHLKHLDLSGNFLGGENMPIPGFMGSLDRLAYLNLSNMN  160

Query  341  LFGNVPPHLGNISSLKYLDI--GNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSV  514
             +G VPP LGN+S L +LDI  G++++    L  +D + W++ L SLE+L+M  VDL   
Sbjct  161  FYGRVPPQLGNLSKLVHLDISPGDSYL--YSLHSMD-ISWLARLYSLEHLDMGSVDLKGA  217

Query  515  SDW  523
            +DW
Sbjct  218  TDW  220



>ref|XP_007144181.1| hypothetical protein PHAVU_007G135200g [Phaseolus vulgaris]
 gb|ESW16175.1| hypothetical protein PHAVU_007G135200g [Phaseolus vulgaris]
Length=913

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 104/181 (57%), Gaps = 16/181 (9%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplsslsswgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTDGP  181
            ERKALL FK S+        S  G D  CCKW GV C N  TG+VV LHL    +C+   
Sbjct  21   ERKALLKFKQSLNDLFHCLSSWVGSD--CCKWVGVRC-NKHTGNVVRLHLRGTDICSKAT  77

Query  182  ------PCYPGLLQGEIxpsllhlpflnfldlsfndfE--RIPSFIGSLNNLVYLDLSYN  337
                    +P  L GE+  SLL L + N+LDLS ND E  ++PSF+GSL NL YL+LS++
Sbjct  78   NKSATHTKWP--LSGELNASLLDLKYFNYLDLSHNDCENVQVPSFLGSLGNLWYLNLSHS  135

Query  338  NLFGNVPPHLGNISSLKYLDIGNNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVS  517
            +  G VP  LGN+S L+YL +   F     L   D L W+S L+SL+YL+M  V+L   S
Sbjct  136  SFTGKVPSQLGNLSHLQYLSLATPF--SSSLWASD-LSWLSGLTSLQYLDMSSVNLSRAS  192

Query  518  D  520
             
Sbjct  193  S  193



>ref|XP_008344651.1| PREDICTED: LOW QUALITY PROTEIN: LRR receptor-like serine/threonine-protein 
kinase GSO1 [Malus domestica]
Length=901

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 87/145 (60%), Gaps = 12/145 (8%)
 Frame = +2

Query  86   CCKWKGVGCDNITTGHVVALHL-GLEGLCTDGPPCYPGL--LQGEIxpsllhlpflnfld  256
            CC+W+G+ C N TTG V+ + L         G P   G   L GEI PSL  L  L  LD
Sbjct  57   CCEWRGIHCHN-TTGAVLTVDLHNPHPQDPFGSPSRYGFWNLSGEISPSLKMLESLKHLD  115

Query  257  lsfndfERIP--SFIGSLNNLVYLDLSYNNLFGNVPPHLGNISSLKYLDIGNNFIDGQDL  430
            LSFN F  IP   F GSL NL YL+LS+    G + P+LGN+SSL++LD+ +N I     
Sbjct  116  LSFNTFNGIPIXEFFGSLKNLQYLNLSHAGFSGRILPNLGNLSSLQFLDVSSNLIS----  171

Query  431  KVVDTLEWISYLSSLEYLNMDGVDL  505
              VD LEW++ + S+EYLNM+G DL
Sbjct  172  --VDNLEWVTGIVSMEYLNMNGADL  194



>ref|XP_006490687.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g36180-like [Citrus sinensis]
 gb|KDO56859.1| hypothetical protein CISIN_1g046848mg [Citrus sinensis]
Length=956

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 89/177 (50%), Gaps = 14/177 (8%)
 Frame = +2

Query  2    ERKALLSFKHsiisdplssls--swgddddCCKWKGVGCDNITTGHVVALHLGLEGLCTD  175
            ER+ALL+FK  ++ +     S     +  DCC W+GV C N  TGHV  L L +  L   
Sbjct  40   EREALLAFKQGLVDESGILSSWGREDEKRDCCGWRGVNCSN-RTGHVYKLDLHI--LQVF  96

Query  176  GPPCYPGLLQGEIxpsllhlpflnfldlsfndfERIPSFIGSLNNLVYLDLSYNNLFGNV  355
              PC  G +   +             +        IP FIGSL+ L YL LS     G +
Sbjct  97   PSPCLKGTISSSLLILQHLTYLDLSGNNFSG--SSIPEFIGSLSKLSYLGLSNTEFAGPI  154

Query  356  PPHLGNISSLKYLDIG-NNFIDGQDLKVVDTLEWISYLSSLEYLNMDGVDLHSVSDW  523
            P  LGN+S L+ LDIG N+ I G++      LEW+S+LSSL YL++   +L   S+W
Sbjct  155  PLQLGNLSRLQVLDIGFNSLISGEN------LEWLSHLSSLIYLDLSFSNLSKFSNW  205



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960