BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035H24

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620566.1|  PREDICTED: probable methyltransferase PMT13        162   6e-43   Nicotiana tomentosiformis
ref|XP_009782445.1|  PREDICTED: probable methyltransferase PMT13        162   8e-43   Nicotiana sylvestris
gb|KDO86019.1|  hypothetical protein CISIN_1g007645mg                   155   1e-40   Citrus sinensis [apfelsine]
ref|XP_006445145.1|  hypothetical protein CICLE_v10019404mg             156   1e-40   Citrus clementina [clementine]
ref|XP_006491019.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    155   1e-40   
ref|XP_006396269.1|  hypothetical protein EUTSA_v10028525mg             154   6e-40   Eutrema salsugineum [saltwater cress]
ref|XP_010457020.1|  PREDICTED: probable methyltransferase PMT13        150   7e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006286483.1|  hypothetical protein CARUB_v10000518mg             152   2e-39   
ref|XP_004229834.1|  PREDICTED: probable methyltransferase PMT13        152   2e-39   Solanum lycopersicum
ref|XP_006339458.1|  PREDICTED: probable methyltransferase PMT13-...    152   2e-39   Solanum tuberosum [potatoes]
ref|XP_010427357.1|  PREDICTED: probable methyltransferase PMT13        152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006286484.1|  hypothetical protein CARUB_v10000518mg             152   2e-39   Capsella rubella
ref|XP_010419629.1|  PREDICTED: probable methyltransferase PMT13        152   2e-39   Camelina sativa [gold-of-pleasure]
emb|CDY07198.1|  BnaCnng02130D                                          150   2e-38   
gb|KDP28683.1|  hypothetical protein JCGZ_14454                         148   5e-38   Jatropha curcas
gb|EYU32065.1|  hypothetical protein MIMGU_mgv1a003241mg                147   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_007220546.1|  hypothetical protein PRUPE_ppa003145mg             147   1e-37   Prunus persica
ref|XP_008383241.1|  PREDICTED: probable methyltransferase PMT13        147   2e-37   
ref|XP_011091711.1|  PREDICTED: probable methyltransferase PMT13        147   2e-37   Sesamum indicum [beniseed]
gb|KJB22349.1|  hypothetical protein B456_004G042500                    146   2e-37   Gossypium raimondii
ref|XP_010529254.1|  PREDICTED: probable methyltransferase PMT13        146   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_010278571.1|  PREDICTED: probable methyltransferase PMT13        146   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009343540.1|  PREDICTED: probable methyltransferase PMT13        146   4e-37   Pyrus x bretschneideri [bai li]
gb|AAD17338.1|  F15P23.2 gene product                                   145   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567184.1|  type II membrane pectin methyltransferase             145   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111460.1|  PREDICTED: probable methyltransferase PMT13        145   7e-37   Brassica rapa
ref|XP_002872932.1|  hypothetical protein ARALYDRAFT_490495             144   1e-36   
ref|XP_008385702.1|  PREDICTED: probable methyltransferase PMT13        144   2e-36   
ref|XP_002272714.1|  PREDICTED: probable methyltransferase PMT13        144   2e-36   Vitis vinifera
ref|XP_009349940.1|  PREDICTED: probable methyltransferase PMT13        144   2e-36   Pyrus x bretschneideri [bai li]
gb|KJB41229.1|  hypothetical protein B456_007G095900                    144   3e-36   Gossypium raimondii
gb|KJB41230.1|  hypothetical protein B456_007G095900                    143   3e-36   Gossypium raimondii
gb|KHG02077.1|  hypothetical protein F383_25150                         143   3e-36   Gossypium arboreum [tree cotton]
gb|KJB41231.1|  hypothetical protein B456_007G095900                    143   3e-36   Gossypium raimondii
ref|XP_011469063.1|  PREDICTED: probable methyltransferase PMT13 ...    143   3e-36   Fragaria vesca subsp. vesca
ref|XP_008232740.1|  PREDICTED: probable methyltransferase PMT13        143   4e-36   Prunus mume [ume]
ref|XP_008438089.1|  PREDICTED: probable methyltransferase PMT13        143   4e-36   Cucumis melo [Oriental melon]
ref|XP_004306834.1|  PREDICTED: probable methyltransferase PMT13 ...    143   5e-36   Fragaria vesca subsp. vesca
ref|XP_009134532.1|  PREDICTED: probable methyltransferase PMT13        142   1e-35   Brassica rapa
emb|CDX74348.1|  BnaA03g26990D                                          142   1e-35   
emb|CDX91893.1|  BnaC03g31950D                                          142   1e-35   
ref|XP_007051915.1|  S-adenosyl-L-methionine-dependent methyltran...    141   2e-35   
ref|XP_004133879.1|  PREDICTED: probable methyltransferase PMT13-...    140   3e-35   Cucumis sativus [cucumbers]
ref|XP_002320756.1|  dehydration-responsive family protein              140   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_011035117.1|  PREDICTED: probable methyltransferase PMT13        139   7e-35   Populus euphratica
ref|XP_010255504.1|  PREDICTED: probable methyltransferase PMT13        139   8e-35   Nelumbo nucifera [Indian lotus]
emb|CDY51142.1|  BnaA09g51770D                                          138   3e-34   Brassica napus [oilseed rape]
emb|CDP08877.1|  unnamed protein product                                135   2e-33   Coffea canephora [robusta coffee]
ref|XP_011093168.1|  PREDICTED: probable methyltransferase PMT13        135   3e-33   Sesamum indicum [beniseed]
ref|XP_010671687.1|  PREDICTED: probable methyltransferase PMT13 ...    130   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010055223.1|  PREDICTED: probable methyltransferase PMT13        127   2e-30   Eucalyptus grandis [rose gum]
gb|KJB24669.1|  hypothetical protein B456_004G156600                    125   1e-29   Gossypium raimondii
gb|EPS64664.1|  hypothetical protein M569_10115                         124   1e-29   Genlisea aurea
ref|XP_007139954.1|  hypothetical protein PHAVU_008G072600g             124   4e-29   Phaseolus vulgaris [French bean]
gb|ACN78958.1|  dehydration responsive protein                          120   2e-28   Glycine max [soybeans]
ref|XP_003552360.1|  PREDICTED: probable methyltransferase PMT13-...    120   5e-28   Glycine max [soybeans]
gb|KEH18952.1|  methyltransferase                                       118   6e-27   Medicago truncatula
ref|XP_003528881.1|  PREDICTED: probable methyltransferase PMT13-...    117   1e-26   Glycine max [soybeans]
ref|XP_003534594.1|  PREDICTED: probable methyltransferase PMT13-...    116   2e-26   Glycine max [soybeans]
ref|XP_004492679.1|  PREDICTED: probable methyltransferase PMT13-...    116   3e-26   Cicer arietinum [garbanzo]
ref|XP_006857872.1|  hypothetical protein AMTR_s00069p00098800          114   1e-25   Amborella trichopoda
ref|XP_007134962.1|  hypothetical protein PHAVU_010G090400g             114   1e-25   Phaseolus vulgaris [French bean]
ref|XP_010091551.1|  putative methyltransferase PMT13                   112   5e-25   
ref|XP_009382296.1|  PREDICTED: probable methyltransferase PMT13        112   7e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003521295.1|  PREDICTED: probable methyltransferase PMT13-...    110   3e-24   Glycine max [soybeans]
ref|XP_010919248.1|  PREDICTED: probable methyltransferase PMT13 ...    107   2e-23   
ref|XP_010919247.1|  PREDICTED: probable methyltransferase PMT13 ...    107   2e-23   Elaeis guineensis
ref|XP_010919246.1|  PREDICTED: probable methyltransferase PMT13 ...    107   3e-23   Elaeis guineensis
ref|XP_009401770.1|  PREDICTED: probable methyltransferase PMT13        105   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK25383.1|  unknown                                                 105   1e-22   Picea sitchensis
ref|XP_008799525.1|  PREDICTED: probable methyltransferase PMT13        104   3e-22   
ref|XP_003623833.1|  hypothetical protein MTR_7g076150                  102   2e-21   Medicago truncatula
ref|XP_010053663.1|  PREDICTED: probable methyltransferase PMT13      97.4    1e-19   Eucalyptus grandis [rose gum]
gb|AIU48613.1|  quasimodo 3                                           95.1    4e-19   Erythranthe guttata [common monkey flower]
gb|AIU48602.1|  quasimodo 3                                           94.7    7e-19   Buxus sinica
gb|AIU48595.1|  quasimodo 3                                           94.4    8e-19   Citrus clementina [clementine]
gb|AIU48617.1|  quasimodo 3                                           94.0    1e-18   Prunus persica
gb|AIU48615.1|  quasimodo 3                                           94.0    1e-18   Solanum tuberosum [potatoes]
gb|AIU48627.1|  quasimodo 3                                           94.0    1e-18   Schrenkiella parvula
gb|AIU48625.1|  quasimodo 3                                           94.0    1e-18   Solanum lycopersicum
gb|AIU48632.1|  quasimodo 3                                           93.6    1e-18   Platanus x hispanica [London plane tree]
gb|AIU48612.1|  quasimodo 3                                           92.4    4e-18   Manihot esculenta [manioc]
gb|AIU48610.1|  quasimodo 3                                           92.0    5e-18   Medicago truncatula
gb|AIU48594.1|  quasimodo 3                                           92.0    6e-18   Sarcandra glabra
gb|AIU48600.1|  quasimodo 3                                           91.3    9e-18   Eucalyptus grandis [rose gum]
gb|AIU48598.1|  quasimodo 3                                           91.3    1e-17   Capsella rubella
gb|AIU48585.1|  quasimodo 3                                           90.9    1e-17   Arabidopsis lyrata [lyrate rockcress]
gb|AIU48586.1|  quasimodo 3                                           90.9    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48584.1|  quasimodo 3                                           90.9    1e-17   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU48597.1|  quasimodo 3                                           90.5    2e-17   Carica papaya [mamon]
gb|AIU48628.1|  quasimodo 3                                           90.1    2e-17   Vitis vinifera
gb|AIU48592.1|  quasimodo 3                                           90.1    3e-17   Theobroma cacao [chocolate]
gb|AIU48619.1|  quasimodo 3                                           89.7    4e-17   Phaseolus vulgaris [French bean]
gb|AIU48609.1|  quasimodo 3                                           89.4    4e-17   Aristolochia tagala
gb|AIU48589.1|  quasimodo 3                                           89.4    4e-17   Musa acuminata [banana]
gb|AIU48634.1|  quasimodo 3                                           89.0    6e-17   Houttuynia cordata [chameleon-plant]
gb|AIU48593.1|  quasimodo 3                                           88.6    7e-17   Acorus calamus [flagroot]
gb|AIU48601.1|  quasimodo 3                                           87.4    2e-16   Illicium henryi
gb|AIU48638.1|  quasimodo 3                                           87.4    2e-16   Cabomba caroliniana
gb|AIU48606.1|  quasimodo 3                                           87.0    2e-16   Chimonanthus praecox [wintersweet]
gb|AIU48596.1|  quasimodo 3                                           86.3    5e-16   Gossypium raimondii
gb|AIU48607.1|  quasimodo 3                                           85.5    8e-16   Pandanus utilis
gb|AIU48636.1|  quasimodo 3                                           85.5    9e-16   Alisma plantago-aquatica
gb|AIU48630.1|  quasimodo 3                                           84.3    2e-15   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48616.1|  quasimodo 3                                           84.3    2e-15   Populus trichocarpa [western balsam poplar]
gb|AIU48611.1|  quasimodo 3                                           84.0    3e-15   Canna indica [canna]
gb|AIU48631.1|  quasimodo 3                                           83.6    4e-15   Cinnamomum camphora
gb|AIU48623.1|  quasimodo 3                                           83.2    6e-15   Yucca filamentosa [Adam's-needle]
gb|AIU48588.1|  quasimodo 3                                           83.2    6e-15   Magnolia denudata [haku-mokuren]
gb|AIU48629.1|  quasimodo 3                                           82.8    7e-15   Lactuca sativa [cultivated lettuce]
gb|AIU48590.1|  quasimodo 3                                           82.8    7e-15   Pinellia ternata
gb|AIU48605.1|  quasimodo 3                                           81.3    2e-14   Ceratophyllum demersum [hornwort]
gb|AIU48608.1|  quasimodo 3                                           80.5    5e-14   Asparagus officinalis
ref|XP_002961169.1|  hypothetical protein SELMODRAFT_74065            79.3    1e-13   Selaginella moellendorffii
ref|XP_002966837.1|  hypothetical protein SELMODRAFT_168608           79.3    1e-13   Selaginella moellendorffii
gb|AIU48587.1|  quasimodo 3                                           76.6    2e-13   Lilium brownii [Hong Kong lily]
gb|AIU48622.1|  quasimodo 3                                           78.2    3e-13   Dioscorea oppositifolia
gb|AIU48621.1|  quasimodo 3                                           77.4    4e-13   Ricinus communis
ref|XP_002511800.1|  conserved hypothetical protein                   77.4    4e-13   
gb|AIU48637.1|  quasimodo 3                                           77.4    5e-13   Trachycarpus fortunei
gb|AIU48603.1|  quasimodo 3                                           76.6    7e-13   Iris japonica
gb|AIU48633.1|  quasimodo 3                                           75.9    2e-12   Ginkgo biloba [ginkgo]
gb|EEE61526.1|  hypothetical protein OsJ_15828                        75.1    2e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02253.2|  OSJNBb0032E06.12                                     75.5    3e-12   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67036.1|  OSIGBa0139P06.9                                      75.5    3e-12   Oryza sativa [red rice]
gb|AIU48618.1|  quasimodo 3                                           74.3    4e-12   Panicum virgatum
gb|AIU48624.1|  quasimodo 3                                           73.2    1e-11   Setaria italica
dbj|BAJ98075.1|  predicted protein                                    71.6    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96685.1|  predicted protein                                    71.6    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96404.1|  predicted protein                                    70.5    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU48635.1|  quasimodo 3                                           70.5    8e-11   Zea mays [maize]
ref|XP_008669009.1|  PREDICTED: probable methyltransferase PMT13      70.9    8e-11   Zea mays [maize]
ref|XP_002448358.1|  hypothetical protein SORBIDRAFT_06g025780        70.5    9e-11   
gb|AIU48591.1|  quasimodo 3                                           70.5    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_003580350.1|  PREDICTED: probable methyltransferase PMT13      70.5    1e-10   Brachypodium distachyon [annual false brome]
gb|AIU48626.1|  quasimodo 3                                           70.5    1e-10   Sorghum bicolor [broomcorn]
ref|XP_004976531.1|  PREDICTED: probable methyltransferase PMT13-...  70.5    1e-10   Setaria italica
ref|XP_001769468.1|  predicted protein                                69.3    2e-10   
ref|XP_001772854.1|  predicted protein                                67.0    2e-09   
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17      58.5    9e-07   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP42862.1|  hypothetical protein JCGZ_23804                       58.5    1e-06   Jatropha curcas
ref|XP_002310457.2|  hypothetical protein POPTR_0007s02440g           57.4    2e-06   
ref|XP_011026358.1|  PREDICTED: probable methyltransferase PMT19      55.1    1e-05   Populus euphratica
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2       54.7    1e-05   Solanum lycopersicum
gb|EMS63450.1|  putative methyltransferase PMT21                      54.3    2e-05   Triticum urartu
ref|NP_001065036.1|  Os10g0510400                                     54.7    2e-05   
ref|XP_011016489.1|  PREDICTED: probable methyltransferase PMT17      54.3    2e-05   Populus euphratica
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18      54.3    2e-05   Pyrus x bretschneideri [bai li]
gb|AES77233.2|  S-adenosylmethionine-dependent methyltransferase,...  54.3    2e-05   Medicago truncatula
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18      54.3    2e-05   Pyrus x bretschneideri [bai li]
ref|XP_003621015.1|  hypothetical protein MTR_7g006060                53.9    3e-05   
ref|XP_002992272.1|  hypothetical protein SELMODRAFT_186660           53.9    3e-05   
gb|EMT00863.1|  hypothetical protein F775_08090                       53.9    3e-05   
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18      53.9    3e-05   Populus euphratica
ref|XP_006443118.1|  hypothetical protein CICLE_v10019345mg           53.9    3e-05   Citrus clementina [clementine]
ref|XP_010940855.1|  PREDICTED: probable methyltransferase PMT21      53.9    4e-05   
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...  53.5    4e-05   Solanum tuberosum [potatoes]
ref|XP_002317647.1|  dehydration-responsive family protein            53.5    4e-05   Populus trichocarpa [western balsam poplar]
gb|EEC73773.1|  hypothetical protein OsI_08448                        53.1    5e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2       53.1    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_002530544.1|  S-adenosylmethionine-dependent methyltransfe...  53.1    6e-05   Ricinus communis
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630        52.8    7e-05   
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340        52.8    7e-05   Sorghum bicolor [broomcorn]
emb|CAH18000.1|  Ankyrin protein kinase-like                          52.4    9e-05   Poa pratensis
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg           52.4    1e-04   
gb|EEC67295.1|  hypothetical protein OsI_34283                        52.4    1e-04   Oryza sativa Indica Group [Indian rice]
gb|AAT38756.2|  Putative methyltransferase family protein             52.4    1e-04   Solanum demissum
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...  52.0    1e-04   Oryza brachyantha
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...  52.0    1e-04   Oryza brachyantha
ref|NP_192782.1|  putative methyltransferase PMT17                    52.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...  52.0    1e-04   Cicer arietinum [garbanzo]
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...  52.0    1e-04   Setaria italica
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...  52.0    1e-04   Setaria italica
ref|NP_001053603.1|  Os04g0570800                                     52.0    1e-04   
dbj|BAK00591.1|  predicted protein                                    52.0    1e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2       52.0    2e-04   Phoenix dactylifera
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18      52.0    2e-04   
ref|XP_006858634.1|  hypothetical protein AMTR_s00066p00040550        52.0    2e-04   Amborella trichopoda
dbj|BAJ94360.1|  predicted protein                                    51.6    2e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAT39937.2|  Putative methyltransferase family protein             52.0    2e-04   Solanum demissum
ref|XP_010055373.1|  PREDICTED: probable methyltransferase PMT19      51.6    2e-04   Eucalyptus grandis [rose gum]
gb|EYU22422.1|  hypothetical protein MIMGU_mgv1a003056mg              51.6    2e-04   Erythranthe guttata [common monkey flower]
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg              51.6    2e-04   Erythranthe guttata [common monkey flower]
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...  51.6    2e-04   Cicer arietinum [garbanzo]
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                51.6    2e-04   Medicago truncatula
dbj|BAJ98046.1|  predicted protein                                    51.6    2e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18      51.6    2e-04   Prunus mume [ume]
gb|ACJ85858.1|  unknown                                               51.6    2e-04   Medicago truncatula
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg           51.6    2e-04   
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                51.6    2e-04   Medicago truncatula
gb|KJB08229.1|  hypothetical protein B456_001G071800                  51.6    2e-04   Gossypium raimondii
emb|CDP05238.1|  unnamed protein product                              51.2    2e-04   Coffea canephora [robusta coffee]
gb|KDP31241.1|  hypothetical protein JCGZ_11617                       51.2    2e-04   Jatropha curcas
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...  51.2    3e-04   Oryza brachyantha
gb|AAT38682.2|  Methyltransferase family protein, putative            51.2    3e-04   Solanum demissum
gb|AIU48604.1|  quasimodo 3                                           50.8    3e-04   Chloranthus japonicus
ref|NP_001146334.1|  uncharacterized protein LOC100279910             50.8    3e-04   
gb|KDP35427.1|  hypothetical protein JCGZ_10810                       50.8    3e-04   Jatropha curcas
gb|AAU90305.2|  Methyltransferase, putative                           50.8    3e-04   Solanum tuberosum [potatoes]
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119            50.8    3e-04   
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2       50.8    4e-04   Populus euphratica
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg           50.8    4e-04   Capsella rubella
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2       50.8    4e-04   Nicotiana sylvestris
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18      50.8    4e-04   
ref|NP_001152470.1|  ankyrin protein kinase-like                      50.8    4e-04   
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...  50.8    4e-04   
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...  50.4    4e-04   Cicer arietinum [garbanzo]
ref|NP_001047721.1|  Os02g0675700                                     50.4    4e-04   
ref|XP_002874627.1|  dehydration-responsive family protein            50.4    4e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17      50.4    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17      50.4    4e-04   Camelina sativa [gold-of-pleasure]
gb|KJB60758.1|  hypothetical protein B456_009G324300                  50.1    5e-04   Gossypium raimondii
ref|NP_001063174.1|  Os09g0415700                                     50.4    5e-04   
ref|XP_009133584.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  50.4    5e-04   
gb|KJB60755.1|  hypothetical protein B456_009G324300                  50.4    5e-04   Gossypium raimondii
gb|KHG10506.1|  hypothetical protein F383_11349                       50.4    5e-04   Gossypium arboreum [tree cotton]
gb|KJB60756.1|  hypothetical protein B456_009G324300                  50.4    5e-04   Gossypium raimondii
gb|KJB24074.1|  hypothetical protein B456_004G127200                  50.4    5e-04   Gossypium raimondii
emb|CDX98606.1|  BnaA03g43910D                                        50.4    5e-04   
gb|KJB60757.1|  hypothetical protein B456_009G324300                  50.1    5e-04   Gossypium raimondii
gb|KJB25151.1|  hypothetical protein B456_004G178700                  50.1    5e-04   Gossypium raimondii
ref|XP_006662118.1|  PREDICTED: probable methyltransferase PMT20-...  50.1    5e-04   Oryza brachyantha
emb|CDP12267.1|  unnamed protein product                              50.1    5e-04   Coffea canephora [robusta coffee]
emb|CDY01583.1|  BnaC07g35730D                                        50.1    5e-04   
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18      50.1    5e-04   Malus domestica [apple tree]
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                 50.1    5e-04   Citrus sinensis [apfelsine]
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...  50.1    6e-04   Citrus sinensis [apfelsine]
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010        50.1    6e-04   Sorghum bicolor [broomcorn]
ref|XP_009136994.1|  PREDICTED: probable methyltransferase PMT21      50.1    6e-04   Brassica rapa
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g           50.1    6e-04   
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...  50.1    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...  50.1    7e-04   
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                  50.1    7e-04   Arabis alpina [alpine rockcress]
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2       50.1    7e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g           49.7    8e-04   Phaseolus vulgaris [French bean]
gb|EAZ09099.1|  hypothetical protein OsI_31366                        49.7    9e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...  49.7    9e-04   
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17      49.3    0.001   Phoenix dactylifera



>ref|XP_009620566.1| PREDICTED: probable methyltransferase PMT13 [Nicotiana tomentosiformis]
Length=599

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 110/128 (86%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ+LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQSLLRSASGD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QRS LV+ VESGR+   I  CPADYVDHMPCEDPR+NSQLSREMNYYRERHCPLP +T
Sbjct  61   PRQRSRLVSQVESGRQTTGIDACPADYVDHMPCEDPRLNSQLSREMNYYRERHCPLPKDT  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_009782445.1| PREDICTED: probable methyltransferase PMT13 [Nicotiana sylvestris]
Length=599

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 109/128 (85%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ+LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQSLLRSASGD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QRS LV  VESGR+   I  CPADYVDHMPCEDPR+NSQLSREMNYYRERHCPLP +T
Sbjct  61   PRQRSRLVAQVESGRQTTGIDACPADYVDHMPCEDPRLNSQLSREMNYYRERHCPLPKDT  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>gb|KDO86019.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=527

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RNAR+W+LLD+V A FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E+G  + PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_006445145.1| hypothetical protein CICLE_v10019404mg [Citrus clementina]
 gb|ESR58385.1| hypothetical protein CICLE_v10019404mg [Citrus clementina]
 gb|KDO86018.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=595

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RNAR+W+LLD+V A FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E+G  + PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_006491019.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT13-like 
[Citrus sinensis]
Length=598

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RNAR+W+LLD+V A FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E+G  + PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_006396269.1| hypothetical protein EUTSA_v10028525mg [Eutrema salsugineum]
 gb|ESQ37722.1| hypothetical protein EUTSA_v10028525mg [Eutrema salsugineum]
Length=599

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLNLPASKRNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE+G+ + PI++CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_010457020.1| PREDICTED: probable methyltransferase PMT13, partial [Camelina 
sativa]
Length=328

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFVLLFTPLGDSMAASGRQTLLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVALVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_006286483.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
 gb|EOA19381.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
Length=536

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_004229834.1| PREDICTED: probable methyltransferase PMT13 [Solanum lycopersicum]
Length=599

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQTLLRSASGD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QRS L+  VESGR    I  C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +T
Sbjct  61   PRQRSRLIAQVESGRHNTAIDACSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDT  120

Query  619  PICLIPP  639
            P+CLIPP
Sbjct  121  PLCLIPP  127



>ref|XP_006339458.1| PREDICTED: probable methyltransferase PMT13-like [Solanum tuberosum]
Length=599

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQTLLRSASGD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QRS L+  VESGR    I  C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +T
Sbjct  61   PRQRSRLIAQVESGRHNTAIDACSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDT  120

Query  619  PICLIPP  639
            P+CLIPP
Sbjct  121  PLCLIPP  127



>ref|XP_010427357.1| PREDICTED: probable methyltransferase PMT13 [Camelina sativa]
Length=599

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFVLLFTPLGDSMAASGRQTLLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_006286484.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
 gb|EOA19382.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
Length=599

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_010419629.1| PREDICTED: probable methyltransferase PMT13 [Camelina sativa]
Length=599

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 106/128 (83%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHLSL +S RN R+W+LLD+V A FF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAVFFGIVLLFFVLLFTPLGDSMAASGRQTLLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>emb|CDY07198.1| BnaCnng02130D [Brassica napus]
Length=599

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 105/128 (82%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            M HL+L  S RN R+W+LLD++ AAFFA V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MKHLNLPFSKRNPRQWRLLDIITAAFFAVVLLFFILLFTPLGDSMAASGRQTLLVSTTSD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVESG  + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVESGHHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>gb|KDP28683.1| hypothetical protein JCGZ_14454 [Jatropha curcas]
Length=598

 Score =   148 bits (374),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLDLV A FF  VF+FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDLVSAVFFGLVFLFFLLVFTPLGDSLAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E+GR   PI+ C AD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRHRLVELIETGRHPQPIEACTADAVDHMPCEDPRRNSQLSREMNFYRERHCPLPDDTP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>gb|EYU32065.1| hypothetical protein MIMGU_mgv1a003241mg [Erythranthe guttata]
Length=597

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +1

Query  268  MGHLSLFSS-HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQ  444
            MG L+L SS +R+AR+W+LLD+V AAFFAAV +FFLLVFTPLGDSLAASGRQ LL  D +
Sbjct  1    MGLLNLSSSKNRHARQWRLLDIVTAAFFAAVLLFFLLVFTPLGDSLAASGRQTLLRSDPR  60

Query  445  QRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  624
             R  LV LVE GR+   I  CPAD V HMPCEDPRINSQLSREMN+YRERHCPLP ETP+
Sbjct  61   HRGRLVALVELGRQAVAIDACPADMVAHMPCEDPRINSQLSREMNFYRERHCPLPTETPL  120

Query  625  CLIPPP  642
            CLIPPP
Sbjct  121  CLIPPP  126



>ref|XP_007220546.1| hypothetical protein PRUPE_ppa003145mg [Prunus persica]
 gb|EMJ21745.1| hypothetical protein PRUPE_ppa003145mg [Prunus persica]
Length=599

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R+ R+W+LLDLV AAFF  V VFFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRQWRLLDLVSAAFFGIVIVFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE G+   PI+ CP D VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRHRLVALVELGQHQQPIEACPVDAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_008383241.1| PREDICTED: probable methyltransferase PMT13 [Malus domestica]
Length=599

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R+ R+W+LLDL+ A FF  V VFFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRQWRLLDLISAXFFGIVIVFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE G+   PI+ CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVALVELGQHHQPIEACPANAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_011091711.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
Length=597

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 1/126 (1%)
 Frame = +1

Query  268  MGHLSLFSS-HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQ  444
            MG L+L SS HR+ R+W+LLD+V AAFF AV +FFLLVFTPLGDSLAASGR+ LL  D +
Sbjct  1    MGLLNLPSSKHRHTRQWRLLDIVTAAFFGAVLLFFLLVFTPLGDSLAASGRRTLLRTDPR  60

Query  445  QRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  624
             R  LV LVE GR+ A I  CP D VDHMPCEDPRINSQLSREMNYYRERHCP P ETP+
Sbjct  61   LRERLVALVEFGRQTAAIDACPVDMVDHMPCEDPRINSQLSREMNYYRERHCPRPEETPL  120

Query  625  CLIPPP  642
            CLIPPP
Sbjct  121  CLIPPP  126



>gb|KJB22349.1| hypothetical protein B456_004G042500 [Gossypium raimondii]
Length=598

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L  S RN R+W+LLD+V A FFA V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPPSKRNPRQWKLLDIVSAFFFALVLLFFLLVFTPLGDSLAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E G    PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP
Sbjct  61   KQRHRLVELLELGHHHQPIEACPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDETP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_010529254.1| PREDICTED: probable methyltransferase PMT13 [Tarenaya hassleriana]
Length=599

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R +R+W+LLD+V AAFFA VF+FFLL+FTPLGDS+AASGRQALL   + D
Sbjct  1    MGHLNLPASKRGSRQWRLLDIVSAAFFAIVFLFFLLIFTPLGDSMAASGRQALLLSTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
              QR  LV LVE+G+   PI++C ++ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PAQRQRLVALVEAGQHQQPIEYCSSEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_010278571.1| PREDICTED: probable methyltransferase PMT13 [Nelumbo nucifera]
Length=595

 Score =   146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQQ  447
            MGHL+L SS RN+R+W+LLDLV AA F AVFVFFLLVFTPLGDSLAASGRQ L   D +Q
Sbjct  1    MGHLNLPSSKRNSRQWRLLDLVSAALFGAVFVFFLLVFTPLGDSLAASGRQTLSMADPRQ  60

Query  448  RSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPIC  627
            R  ++ L+E+G++   I+ CPAD VD+MPCEDPR NSQLSREMN+YRERHCPLP ETP+C
Sbjct  61   RQRMIALIEAGQQ-QTIEACPADAVDYMPCEDPRRNSQLSREMNFYRERHCPLPEETPLC  119

Query  628  LIPPP  642
            LIPPP
Sbjct  120  LIPPP  124



>ref|XP_009343540.1| PREDICTED: probable methyltransferase PMT13 [Pyrus x bretschneideri]
Length=599

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 105/128 (82%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R++R+ +LLDL+ AAFF  V  FFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSSRQCRLLDLISAAFFGIVIFFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVTLVELGQHHQPIEACPADAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>gb|AAD17338.1| F15P23.2 gene product [Arabidopsis thaliana]
 emb|CAB80883.1| predicted protein of unknown function [Arabidopsis thaliana]
Length=590

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +1

Query  268  MGHLSLFSSHR-NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SG  435
            MGH++L +S R N R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + 
Sbjct  1    MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTAS  60

Query  436  DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  615
            D +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP E
Sbjct  61   DPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEE  120

Query  616  TPICLIPPP  642
            TP+CLIPPP
Sbjct  121  TPLCLIPPP  129



>ref|NP_567184.1| type II membrane pectin methyltransferase [Arabidopsis thaliana]
 sp|Q93W95.1|PMTD_ARATH RecName: Full=Probable methyltransferase PMT13 [Arabidopsis thaliana]
 gb|AAL24317.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL24395.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15470.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37736.1| At4g00740 [Arabidopsis thaliana]
 gb|AEE81928.1| type II membrane pectin methyltransferase [Arabidopsis thaliana]
Length=600

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 4/129 (3%)
 Frame = +1

Query  268  MGHLSLFSSHR-NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SG  435
            MGH++L +S R N R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + 
Sbjct  1    MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTAS  60

Query  436  DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  615
            D +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP E
Sbjct  61   DPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEE  120

Query  616  TPICLIPPP  642
            TP+CLIPPP
Sbjct  121  TPLCLIPPP  129



>ref|XP_009111460.1| PREDICTED: probable methyltransferase PMT13 [Brassica rapa]
Length=591

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            M HL+L  S RN R+W+L+D++ AAFFA V +FF+L+FTPL DS+AASGRQ LL   + D
Sbjct  1    MKHLNLPFSKRNPRQWRLVDIITAAFFAVVLLFFILLFTPLRDSMAASGRQTLLISTASD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVESG  + PI++CPAD V HMPCEDP+ NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVESGHHLQPIEYCPADAVAHMPCEDPKRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_002872932.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49191.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. 
lyrata]
Length=602

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 106/130 (82%), Gaps = 5/130 (4%)
 Frame = +1

Query  268  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---S  432
            MGHL+L +S R  N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   +
Sbjct  1    MGHLNLPASKRSSNPRQWCLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTA  60

Query  433  GDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  612
             D +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP 
Sbjct  61   SDPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPE  120

Query  613  ETPICLIPPP  642
            ETP+CLIPPP
Sbjct  121  ETPLCLIPPP  130



>ref|XP_008385702.1| PREDICTED: probable methyltransferase PMT13 [Malus domestica]
Length=599

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 106/128 (83%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R++R+ +LLDL+ AAFF  V VFFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSSRQCRLLDLISAAFFGIVIVFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LVTLVE G+   PI+ CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVTLVELGQHHQPIEACPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_002272714.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 ref|XP_010661563.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 ref|XP_010661564.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 emb|CBI38767.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 3/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L SS RNAR+++LLDLV A+FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPSSKRNARQYRLLDLVTASFFGIVIIFFLLVFTPLGDSLAASGRQALLLSTADP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV LVE+G++ A I+ CPA+ VDHMPCEDPR NSQLSREMN+YRER CPLP ETP
Sbjct  61   RQRQRLVALVEAGQQQA-IEACPAEEVDHMPCEDPRRNSQLSREMNFYRERQCPLPAETP  119

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  120  LCLIPPP  126



>ref|XP_009349940.1| PREDICTED: probable methyltransferase PMT13 [Pyrus x bretschneideri]
Length=599

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R+ R+W+LLDL+ AAFF  V VFF+LVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRQWRLLDLISAAFFGIVIVFFVLVFTPLGDSLAASGRQALLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE G+   PI+ C A+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVALVELGQHHQPIEACLANAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>gb|KJB41229.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
 gb|KJB41232.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=597

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>gb|KJB41230.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=493

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>gb|KHG02077.1| hypothetical protein F383_25150 [Gossypium arboreum]
Length=525

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>gb|KJB41231.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=525

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_011469063.1| PREDICTED: probable methyltransferase PMT13 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=527

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R  R+W+LLDLV AAFF  V +FFLLVFTPLGDS+AASGRQ+LL   + D
Sbjct  1    MGHLNLPASKRIPRQWRLLDLVSAAFFGIVILFFLLVFTPLGDSMAASGRQSLLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP P ET
Sbjct  61   PKQRHRLVALVEQGQHQQPIEACPADAVDHMPCEDPRRNSQLSREMNFYRERHCPPPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_008232740.1| PREDICTED: probable methyltransferase PMT13 [Prunus mume]
Length=599

 Score =   143 bits (361),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 102/128 (80%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R+ R W+LLDLV AAFF  V VFFLLVFT LGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRHWRLLDLVSAAFFGIVIVFFLLVFTRLGDSLAASGRQALLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE G+   PI+ CP D VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVALVELGQHQQPIEACPVDAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_008438089.1| PREDICTED: probable methyltransferase PMT13 [Cucumis melo]
Length=593

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGH++L +S RN R+W+LLD+V A FF  V +FFLLVFT LGDSLAASGRQ LL  + D 
Sbjct  1    MGHVNLPASKRNGRQWRLLDIVSAVFFGLVLLFFLLVFTRLGDSLAASGRQTLLLSNADP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  ++ LVE+G++ A I+ CPAD VDHMPCEDPR NSQLSREMNYYRERHCPLP+ETP
Sbjct  61   RQRQRIMELVEAGQKQA-IEACPADAVDHMPCEDPRRNSQLSREMNYYRERHCPLPYETP  119

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  120  LCLIPPP  126



>ref|XP_004306834.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   143 bits (360),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 103/128 (80%), Gaps = 3/128 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGHL+L +S R  R+W+LLDLV AAFF  V +FFLLVFTPLGDS+AASGRQ+LL   + D
Sbjct  1    MGHLNLPASKRIPRQWRLLDLVSAAFFGIVILFFLLVFTPLGDSMAASGRQSLLLSTNAD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  618
             +QR  LV LVE G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP P ET
Sbjct  61   PKQRHRLVALVEQGQHQQPIEACPADAVDHMPCEDPRRNSQLSREMNFYRERHCPPPEET  120

Query  619  PICLIPPP  642
            P+CLIPPP
Sbjct  121  PLCLIPPP  128



>ref|XP_009134532.1| PREDICTED: probable methyltransferase PMT13 [Brassica rapa]
Length=597

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = +1

Query  289  SSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLL  459
            S   N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D +QR  L
Sbjct  6    SKRNNQRQWSLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASDPRQRQRL  65

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            VTLVESG+ + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPP
Sbjct  66   VTLVESGQHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPP  125

Query  640  P  642
            P
Sbjct  126  P  126



>emb|CDX74348.1| BnaA03g26990D [Brassica napus]
Length=597

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = +1

Query  289  SSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLL  459
            S   N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D +QR  L
Sbjct  6    SKRNNQRQWSLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASDPRQRQRL  65

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            VTLVESG+ + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPP
Sbjct  66   VTLVESGQHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPP  125

Query  640  P  642
            P
Sbjct  126  P  126



>emb|CDX91893.1| BnaC03g31950D [Brassica napus]
Length=597

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = +1

Query  289  SSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLL  459
            S   N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D +QR  L
Sbjct  6    SKRNNQRQWSLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASDPRQRQRL  65

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            VTLVESG+ + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPP
Sbjct  66   VTLVESGQHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPP  125

Query  640  P  642
            P
Sbjct  126  P  126



>ref|XP_007051915.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX96072.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=598

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 98/127 (77%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLD++   FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIISTIFFGLVLLFFLLVFTPLGDSLAASGRQALLLSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
             QR  LV LVE G     I+ CPAD VDHMPCEDPR NSQLSREMN+YRER CPLP E P
Sbjct  61   GQRHRLVALVELGHHHQAIEACPADSVDHMPCEDPRRNSQLSREMNFYRERQCPLPDEMP  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_004133879.1| PREDICTED: probable methyltransferase PMT13-like [Cucumis sativus]
 ref|XP_004155811.1| PREDICTED: probable methyltransferase PMT13-like [Cucumis sativus]
 gb|KGN56547.1| hypothetical protein Csa_3G123200 [Cucumis sativus]
Length=593

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGH++L +S RN R+W+LLD+V AAFF  V +FFLLVFT LGDSLAASGRQ LL  + D 
Sbjct  1    MGHVNLPASKRNGRQWRLLDIVSAAFFGLVLLFFLLVFTRLGDSLAASGRQTLLLSNADP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
             QR  ++ LVE+G++ A I+ CPA+ VDHMPCEDPR NSQLSREMNYYRERHCPLP+ETP
Sbjct  61   GQRQRIMELVEAGQKQA-IEACPAEAVDHMPCEDPRRNSQLSREMNYYRERHCPLPYETP  119

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  120  LCLIPPP  126



>ref|XP_002320756.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE99071.1| dehydration-responsive family protein [Populus trichocarpa]
Length=594

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLDLV A FF  VF+FFLLVFTPLGDSLAASGRQ LL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDLVTATFFGLVFLFFLLVFTPLGDSLAASGRQTLLRSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E+G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP   +T 
Sbjct  61   RQRHRLVALIEAGQNAQPIEACPADEVDHMPCEDPRRNSQLSREMNFYRERHCPPVEDTH  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_011035117.1| PREDICTED: probable methyltransferase PMT13 [Populus euphratica]
Length=594

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 101/127 (80%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  441
            MGHL+L +S RN R+W+LLDLV A FF  VF+FFLLVFTPLGDSLAASGRQ LL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDLVTATFFGLVFLFFLLVFTPLGDSLAASGRQTLLRSTSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR  LV L+E+G    PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP   +T 
Sbjct  61   RQRHRLVALIEAGHNAQPIEACPADEVDHMPCEDPRRNSQLSREMNFYRERHCPPVEDTH  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_010255504.1| PREDICTED: probable methyltransferase PMT13 [Nelumbo nucifera]
Length=593

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +1

Query  271  GHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDSQ  444
            G L+L  S RNAR+W+LLDLV AAFF A+FVFFLLVFTPLGDSLAASGRQ L+  +GD +
Sbjct  3    GQLNLPFSKRNARQWRLLDLVSAAFFGAIFVFFLLVFTPLGDSLAASGRQTLVLSTGDPR  62

Query  445  QRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  624
            QR  +V L+E+G++ + I+ CPA+ VDHMPCEDPR NSQLSREMN+YRER+CPLP ETP+
Sbjct  63   QRQRMVALIEAGKQQS-IEACPAEAVDHMPCEDPRRNSQLSREMNFYRERNCPLPEETPL  121

Query  625  CLIPPP  642
            CLIPPP
Sbjct  122  CLIPPP  127



>emb|CDY51142.1| BnaA09g51770D [Brassica napus]
Length=617

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 3/118 (3%)
 Frame = +1

Query  298  RNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLLVTL  468
            RN R+W+L D++ AAFFA V +FF+L+FTPL DS+AASGRQ LL   + D +QR  LVTL
Sbjct  37   RNPRQWRLFDIITAAFFAVVLLFFILLFTPLRDSMAASGRQTLLVTTTSDPRQRQRLVTL  96

Query  469  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            VESG  + PI++CPAD V HMPCEDP+ NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  97   VESGHHLQPIEYCPADAVAHMPCEDPKRNSQLSREMNFYRERHCPLPEETPLCLIPPP  154



>emb|CDP08877.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 104/133 (78%), Gaps = 10/133 (8%)
 Frame = +1

Query  268  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL----  429
            MGHL+L SS +  NAR+W+LLDLV A  F AVF+FF+LVFTPLGDSLAASGRQ LL    
Sbjct  1    MGHLNLPSSKQRNNARQWRLLDLVTAILFGAVFIFFVLVFTPLGDSLAASGRQTLLRSSM  60

Query  430  -SGDSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCP  603
             + D  QR+ LV LVES G  +  I  CPA+ VDHMPCEDPRINSQLSREMN+YRERHCP
Sbjct  61   GAADPLQRARLVALVESTGNPV--IDSCPAEMVDHMPCEDPRINSQLSREMNFYRERHCP  118

Query  604  LPHETPICLIPPP  642
             P +TP+CLIPPP
Sbjct  119  APEQTPLCLIPPP  131



>ref|XP_011093168.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
 ref|XP_011093169.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
Length=601

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = +1

Query  265  EMGHLSLFSS-HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSG--  435
            +MG  +L SS  RNARKW+LLD++ AAFF AV V FLLVFTPLGD+ AASGR+  L    
Sbjct  3    QMGLFNLASSKQRNARKWRLLDIITAAFFLAVLVLFLLVFTPLGDAFAASGRKTALQSPV  62

Query  436  -DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  612
             D + R+ L+ L+E GR+   I  CPAD VDHMPCEDPRINSQLSREMNYYRERHCP   
Sbjct  63   LDPRNRAKLLALLELGRQGVTIDACPADMVDHMPCEDPRINSQLSREMNYYRERHCPKAE  122

Query  613  ETPICLIPPP  642
            ETP+CLIPPP
Sbjct  123  ETPLCLIPPP  132



>ref|XP_010671687.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            MGH++L SS +  ++W+LLDLV A FF  V +FFLL+FTPLGDSLAASGRQ LL   + D
Sbjct  1    MGHINLSSSKKAGKQWKLLDLVIACFFGIVVLFFLLIFTPLGDSLAASGRQTLLRTSASD  60

Query  439  SQQR-SLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  615
             +QR  L+V L E+      I  CPA++VD+MPCEDP+ NSQLSREMN+YRERHCPLP +
Sbjct  61   PRQRMKLIVALEETSNGGQMIDACPAEFVDYMPCEDPKRNSQLSREMNFYRERHCPLPED  120

Query  616  TPICLIPPP  642
            +P+CLIPPP
Sbjct  121  SPLCLIPPP  129



>ref|XP_010055223.1| PREDICTED: probable methyltransferase PMT13 [Eucalyptus grandis]
 gb|KCW71691.1| hypothetical protein EUGRSUZ_E00210 [Eucalyptus grandis]
Length=596

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 2/126 (2%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQQ  447
            MGHLSL +S R+ R+W+LLDLV A     V +FFLLVFT LGDSLAASGRQ+LL   S+ 
Sbjct  1    MGHLSLPASKRSPRQWKLLDLVIAVLLGLVLLFFLLVFTRLGDSLAASGRQSLLLA-SRD  59

Query  448  RSLLVTLVESGREI-APIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  624
             + LV  VESG+   + I+ CP DY DHMPCEDPR NSQLSREMN+YRERHCP P  TP+
Sbjct  60   HARLVAAVESGKLYPSHIESCPDDYADHMPCEDPRRNSQLSREMNFYRERHCPPPEGTPL  119

Query  625  CLIPPP  642
            CL+PPP
Sbjct  120  CLVPPP  125



>gb|KJB24669.1| hypothetical protein B456_004G156600 [Gossypium raimondii]
Length=586

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = +1

Query  295  HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDSQQRSLLVTL  468
            +RNAR+W+ LD+  A FF+ V +FFLLVFTP GD LA SGRQALL  + D +QR   V+L
Sbjct  5    NRNARQWKFLDIFTAMFFSLVLLFFLLVFTPFGDPLAYSGRQALLLSTSDPKQRHRFVSL  64

Query  469  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            VE G    PI  CP D VDHMPCEDP+ NSQLSR MN+YRERHCPLP E P+CLIPPP
Sbjct  65   VELGEHRQPIDPCPPDSVDHMPCEDPKRNSQLSRYMNFYRERHCPLPDEMPLCLIPPP  122



>gb|EPS64664.1| hypothetical protein M569_10115, partial [Genlisea aurea]
Length=522

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 95/127 (75%), Gaps = 2/127 (2%)
 Frame = +1

Query  268  MGHLSL--FSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDS  441
            MG L+L   S HR++R+  LLDL+ AA F  V +FF+LVFTPLGDS AASG+ ALL  D 
Sbjct  1    MGLLNLQPSSKHRHSRQVHLLDLITAAIFGIVVLFFVLVFTPLGDSWAASGKLALLRSDP  60

Query  442  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  621
            +QR   V+ +  GR  A +  CPAD VDHMPCEDPRINSQLSR+MN+YRERHCP P +T 
Sbjct  61   KQRWSTVSELLVGRHAALVDSCPADMVDHMPCEDPRINSQLSRDMNFYRERHCPAPEDTQ  120

Query  622  ICLIPPP  642
            +CLIPPP
Sbjct  121  LCLIPPP  127



>ref|XP_007139954.1| hypothetical protein PHAVU_008G072600g [Phaseolus vulgaris]
 gb|ESW11948.1| hypothetical protein PHAVU_008G072600g [Phaseolus vulgaris]
Length=592

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 97/130 (75%), Gaps = 8/130 (6%)
 Frame = +1

Query  268  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SG  435
            MGH +  S  +  +ARKWQLLDLV   FF  V +FF++VFTPLGDSLAASGRQ LL    
Sbjct  1    MGHSNSSSPSKRGHARKWQLLDLVSGVFFFLVLLFFVMVFTPLGDSLAASGRQTLLLSGA  60

Query  436  DSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  612
            DS+ R  LV  VE+ GR +   + CPAD  D+MPCEDPR+NSQLSREMNYYRERHCP P 
Sbjct  61   DSRHRHQLVEAVETAGRGV---EACPADMADYMPCEDPRLNSQLSREMNYYRERHCPRPE  117

Query  613  ETPICLIPPP  642
            ++P+CLIPPP
Sbjct  118  DSPLCLIPPP  127



>gb|ACN78958.1| dehydration responsive protein [Glycine max]
Length=496

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = +1

Query  382  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRIN  555
            TPLGDSLAASGRQ LL    D QQR  LV  +E+G     ++ CPA   DHMPCEDPR+N
Sbjct  45   TPLGDSLAASGRQTLLRSGADPQQRHRLVAAIEAGGR--GVEACPAADADHMPCEDPRLN  102

Query  556  SQLSREMNYYRERHCPLPHETPICLIPPP  642
            SQLSREMNYYRERHCP P ++P+CLIPPP
Sbjct  103  SQLSREMNYYRERHCPRPEDSPLCLIPPP  131



>ref|XP_003552360.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=596

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 68/89 (76%), Gaps = 4/89 (4%)
 Frame = +1

Query  382  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRIN  555
            TPLGDSLAASGRQ LL    D QQR  LV  +E+G     ++ CPA   DHMPCEDPR+N
Sbjct  45   TPLGDSLAASGRQTLLRSGADPQQRHRLVAAIEAGGR--GVEACPAADADHMPCEDPRLN  102

Query  556  SQLSREMNYYRERHCPLPHETPICLIPPP  642
            SQLSREMNYYRERHCP P ++P+CLIPPP
Sbjct  103  SQLSREMNYYRERHCPRPEDSPLCLIPPP  131



>gb|KEH18952.1| methyltransferase [Medicago truncatula]
Length=602

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 95/138 (69%), Gaps = 15/138 (11%)
 Frame = +1

Query  268  MGHLSLFSSHR-----------NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASG  414
            MGH++L  S R           N R W+L+DL+ AAFF  VF+FF+ VFT LGDSLAASG
Sbjct  1    MGHVNLPPSKRTPTITNIINNYNPRHWRLIDLISAAFFGLVFLFFVFVFTSLGDSLAASG  60

Query  415  RQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYR  588
            RQ LL    D QQR  LV  +E G+ +  I  CPAD VDHMPCE+PR+NSQLSREMNYYR
Sbjct  61   RQTLLMSGSDPQQRLRLVAAIEVGQRV--IDACPADAVDHMPCENPRLNSQLSREMNYYR  118

Query  589  ERHCPLPHETPICLIPPP  642
            ERHCP    T +CL+PPP
Sbjct  119  ERHCPPVENTVLCLVPPP  136



>ref|XP_003528881.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=594

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 97/129 (75%), Gaps = 5/129 (4%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  438
            M HL+L +S R  R+W++LDL+ AAFF  VF+FF+LVFTP GDSLAASGRQ LL   S D
Sbjct  1    MPHLNLPASKR-VRQWRVLDLISAAFFGLVFLFFMLVFTPAGDSLAASGRQTLLLSASAD  59

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYV-DHMPCEDPRINSQLSREMNYYRERHCPLPHE  615
             +QR  +   +E+G++   I  CPAD   DHMPCEDPR+NSQLSREMNYYRERHCP    
Sbjct  60   PRQRLHVAAAIEAGQQSRVIDACPADTAADHMPCEDPRLNSQLSREMNYYRERHCPPLET  119

Query  616  TPICLIPPP  642
            +P+CL+PPP
Sbjct  120  SPLCLVPPP  128



>ref|XP_003534594.1| PREDICTED: probable methyltransferase PMT13-like isoform X1 [Glycine 
max]
 ref|XP_006587869.1| PREDICTED: probable methyltransferase PMT13-like isoform X2 [Glycine 
max]
Length=597

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 67/89 (75%), Gaps = 4/89 (4%)
 Frame = +1

Query  382  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRIN  555
            TPLGDSLAASGRQ LL    D +Q   LV  +E+G     ++ CPA   DHMPCEDPR+N
Sbjct  46   TPLGDSLAASGRQTLLRSGADPRQHHRLVAAIEAGGR--GLEACPAADADHMPCEDPRLN  103

Query  556  SQLSREMNYYRERHCPLPHETPICLIPPP  642
            SQLSREMNYYRERHCP P ++P+CLIPPP
Sbjct  104  SQLSREMNYYRERHCPRPEDSPLCLIPPP  132



>ref|XP_004492679.1| PREDICTED: probable methyltransferase PMT13-like [Cicer arietinum]
Length=595

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 94/129 (73%), Gaps = 4/129 (3%)
 Frame = +1

Query  268  MGHLSLFSSHR-NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGD  438
            MGH +     R N R+W+L+DL+  AFF+ +F+FF+  +T + DSLA SGR+A++  + D
Sbjct  1    MGHSNFPPWKRTNTRQWRLIDLISIAFFSLLFLFFIFFYTTISDSLAVSGRRAVVPSTVD  60

Query  439  SQQRSLLVTLVESGREIA-PIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  615
             QQR+ LV  +E+G      I+ C AD VDHMPCEDPR NSQLSREMNYYRERHCP P E
Sbjct  61   PQQRNRLVVEIETGLSNGRTIEACSADEVDHMPCEDPRRNSQLSREMNYYRERHCPPPEE  120

Query  616  TPICLIPPP  642
            TP+CLIPPP
Sbjct  121  TPLCLIPPP  129



>ref|XP_006857872.1| hypothetical protein AMTR_s00069p00098800 [Amborella trichopoda]
 gb|ERN19339.1| hypothetical protein AMTR_s00069p00098800 [Amborella trichopoda]
Length=599

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 95/130 (73%), Gaps = 7/130 (5%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSG---D  438
            MGH++L       R W++LDL+ AAFFAAV  FFLLVFTPLGDSLAASGRQAL      D
Sbjct  1    MGHITLTPKKLQPRGWRVLDLISAAFFAAVLAFFLLVFTPLGDSLAASGRQALAQASVLD  60

Query  439  SQQRSLLVTLVESGREIAPIQFCPADYVD--HMPCEDPRINSQLSREMNYYRERHCPLPH  612
             +QR+ +  L E GR++  + FC  + VD  +MPCEDPR NSQLSRE N+YRERHCP P 
Sbjct  61   LKQRAEVAGLAEMGRKV--LDFCSLEAVDADYMPCEDPRRNSQLSRERNFYRERHCPKPE  118

Query  613  ETPICLIPPP  642
            ++P+CLIPPP
Sbjct  119  DSPLCLIPPP  128



>ref|XP_007134962.1| hypothetical protein PHAVU_010G090400g [Phaseolus vulgaris]
 gb|ESW06956.1| hypothetical protein PHAVU_010G090400g [Phaseolus vulgaris]
Length=596

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 95/129 (74%), Gaps = 5/129 (4%)
 Frame = +1

Query  268  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SG  435
            MGH++L +S R    R+W++LD+V AAFF  VF+FF+LVFT +GDSLAASGRQ LL  + 
Sbjct  1    MGHVNLPASKRLGGPRQWRVLDVVTAAFFGLVFLFFVLVFTSMGDSLAASGRQTLLLSTT  60

Query  436  DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  615
            D  QR  +   VE+G+    I  CPAD  DHMPCEDPR+NSQLSR MNYYRERHCP    
Sbjct  61   DPLQRLRVSAAVEAGQPRV-IDACPADTADHMPCEDPRLNSQLSRVMNYYRERHCPPLEN  119

Query  616  TPICLIPPP  642
            TP+CL+PPP
Sbjct  120  TPLCLVPPP  128



>ref|XP_010091551.1| putative methyltransferase PMT13 [Morus notabilis]
 gb|EXB44736.1| putative methyltransferase PMT13 [Morus notabilis]
Length=545

 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  430  SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLP  609
            + D +QR  LVT+VE GR   PI  C AD VDHMPCEDPR NSQLSREMN+YRERHCPLP
Sbjct  4    TADPKQRHRLVTVVELGRHHHPIDACQADAVDHMPCEDPRRNSQLSREMNFYRERHCPLP  63

Query  610  HETPICLIPPP  642
             ETP+CLIPPP
Sbjct  64   EETPLCLIPPP  74



>ref|XP_009382296.1| PREDICTED: probable methyltransferase PMT13 [Musa acuminata subsp. 
malaccensis]
Length=600

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 3/90 (3%)
 Frame = +1

Query  382  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRI  552
            T LGDSLAASGR+AL   +  S+QR  +V L++S       I  CPA+ VD+MPCEDPR 
Sbjct  41   TSLGDSLAASGRRALARSAAGSRQRERIVALLDSPTASPFAIDSCPAEEVDNMPCEDPRR  100

Query  553  NSQLSREMNYYRERHCPLPHETPICLIPPP  642
            NSQLSREMN+YRERHCPLP ETP+CL+PPP
Sbjct  101  NSQLSREMNFYRERHCPLPGETPLCLVPPP  130



>ref|XP_003521295.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=597

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 95/131 (73%), Gaps = 8/131 (6%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL----SG  435
            MGH++L +S R  R+W++LDLV AAFF  VF+FFLLVFTP GDSLAASGRQ LL    S 
Sbjct  1    MGHVNLPASKR-VRQWRVLDLVSAAFFGLVFLFFLLVFTPAGDSLAASGRQTLLLSASSA  59

Query  436  DSQQRSLLVTLVESGREIAP--IQFCPADYV-DHMPCEDPRINSQLSREMNYYRERHCPL  606
            D + R  +   +E   +  P  I+ CPAD   DHMPCEDPR+NSQLSREMNYYRERHCP 
Sbjct  60   DPRLRLRVSAAIEEAGQRQPRVIEACPADTAADHMPCEDPRLNSQLSREMNYYRERHCPP  119

Query  607  PHETPICLIPP  639
               TP+CL+PP
Sbjct  120  LETTPLCLVPP  130



>ref|XP_010919248.1| PREDICTED: probable methyltransferase PMT13 isoform X3 [Elaeis 
guineensis]
Length=501

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 96/135 (71%), Gaps = 10/135 (7%)
 Frame = +1

Query  268  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  429
            MGH++L  S R    R+W LLDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTLLDLVSASFFAAVLVFFVLVFTSLGDSLAASGRRALARSSS  60

Query  430  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  597
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLIALLDGPPAPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  598  CPLPHETPICLIPPP  642
            CP P E+ +CLIPPP
Sbjct  121  CPPPGESLLCLIPPP  135



>ref|XP_010919247.1| PREDICTED: probable methyltransferase PMT13 isoform X2 [Elaeis 
guineensis]
Length=503

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 96/135 (71%), Gaps = 10/135 (7%)
 Frame = +1

Query  268  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  429
            MGH++L  S R    R+W LLDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTLLDLVSASFFAAVLVFFVLVFTSLGDSLAASGRRALARSSS  60

Query  430  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  597
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLIALLDGPPAPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  598  CPLPHETPICLIPPP  642
            CP P E+ +CLIPPP
Sbjct  121  CPPPGESLLCLIPPP  135



>ref|XP_010919246.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Elaeis 
guineensis]
Length=605

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 96/135 (71%), Gaps = 10/135 (7%)
 Frame = +1

Query  268  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  429
            MGH++L  S R    R+W LLDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTLLDLVSASFFAAVLVFFVLVFTSLGDSLAASGRRALARSSS  60

Query  430  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  597
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLIALLDGPPAPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  598  CPLPHETPICLIPPP  642
            CP P E+ +CLIPPP
Sbjct  121  CPPPGESLLCLIPPP  135



>ref|XP_009401770.1| PREDICTED: probable methyltransferase PMT13 [Musa acuminata subsp. 
malaccensis]
Length=603

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 9/95 (9%)
 Frame = +1

Query  382  TPLGDSLAASGRQALL---SGDSQQRSLLVTLVE-----SGREIAPIQFCPADYVDHMPC  537
            T LGDSLAASGR+AL    + D +QR  ++ L++     +GR +  I  C A+ VD+MPC
Sbjct  41   TSLGDSLAASGRRALARSSTDDPRQRQRILALLDPPSSAAGRTVV-IDACSAEEVDNMPC  99

Query  538  EDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            EDPR NSQLSREMN+YRERHCP P E P+CL+PPP
Sbjct  100  EDPRRNSQLSREMNFYRERHCPPPEEMPLCLVPPP  134



>gb|ABK25383.1| unknown [Picea sitchensis]
Length=601

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 10/132 (8%)
 Frame = +1

Query  268  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL------  429
            MGH+S+  S R  R+W+LLDLV    F AVF+F L VFTPLGDSLAASGRQ+L+      
Sbjct  1    MGHISV-PSKRLVRQWKLLDLVSGLLFLAVFIFLLCVFTPLGDSLAASGRQSLVLSGGRD  59

Query  430  -SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  606
             +GD Q R   + +VESG   A ++ CP + VD+ PCEDPR +S  SRE N YRERHCP 
Sbjct  60   RNGDPQHRERFLRVVESGE--AAVEACPLESVDYSPCEDPRRSSHFSRERNVYRERHCPP  117

Query  607  PHETPICLIPPP  642
            P +  +CLIPPP
Sbjct  118  PDQNLLCLIPPP  129



>ref|XP_008799525.1| PREDICTED: probable methyltransferase PMT13 [Phoenix dactylifera]
Length=605

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 94/135 (70%), Gaps = 10/135 (7%)
 Frame = +1

Query  268  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  429
            MGH++L  S R    R+W  LDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTFLDLVSASFFAAVLVFFILVFTSLGDSLAASGRRALARSSS  60

Query  430  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  597
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLLALLDGPPVPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  598  CPLPHETPICLIPPP  642
            CP P E+ +CL PPP
Sbjct  121  CPPPGESLLCLTPPP  135



>ref|XP_003623833.1| hypothetical protein MTR_7g076150 [Medicago truncatula]
 gb|ABN08824.1| Protein of unknown function DUF248, methyltransferase putative 
[Medicago truncatula]
 gb|AES80051.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=589

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 53/70 (76%), Gaps = 1/70 (1%)
 Frame = +1

Query  436  DSQQRSLLVTLVESGR-EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  612
            D QQR+ LV  +E G      I+ CPA  VDHMPCEDPR NSQLSREMNYYRERHCPLP 
Sbjct  54   DPQQRNRLVVAIEEGMLNGKSIEACPASEVDHMPCEDPRRNSQLSREMNYYRERHCPLPE  113

Query  613  ETPICLIPPP  642
            ET +CLIPPP
Sbjct  114  ETAVCLIPPP  123



>ref|XP_010053663.1| PREDICTED: probable methyltransferase PMT13 [Eucalyptus grandis]
 gb|KCW78015.1| hypothetical protein EUGRSUZ_D02247 [Eucalyptus grandis]
Length=579

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 54/72 (75%), Gaps = 4/72 (6%)
 Frame = +1

Query  430  SGDSQQRSLLVTLVESG-REIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  606
            S  ++  S L   VESG R + P   CPA YVDHMPCEDPR +SQLSREMNYYRERHCP 
Sbjct  40   SAAARDHSRLAAAVESGARRVEP---CPAGYVDHMPCEDPRRSSQLSREMNYYRERHCPP  96

Query  607  PHETPICLIPPP  642
            P ETP+CL+PPP
Sbjct  97   PEETPLCLVPPP  108



>gb|AIU48613.1| quasimodo 3, partial [Erythranthe guttata]
Length=505

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD V HMPCEDPRINSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPADMVAHMPCEDPRINSQLSREMNFYRERHCPLPTETPLCLIPPP  46



>gb|AIU48602.1| quasimodo 3, partial [Buxus sinica]
Length=505

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSREMNYYRERHCPLP ETP+CLIPPP
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSREMNYYRERHCPLPEETPLCLIPPP  46



>gb|AIU48595.1| quasimodo 3, partial [Citrus clementina]
 gb|AIU48599.1| quasimodo 3, partial [Citrus sinensis]
Length=505

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP+CLIPPP
Sbjct  1    CPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPP  46



>gb|AIU48617.1| quasimodo 3, partial [Prunus persica]
Length=505

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP D VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPVDAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48615.1| quasimodo 3, partial [Solanum tuberosum]
Length=505

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +TP+CLIPP
Sbjct  1    CSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDTPLCLIPP  45



>gb|AIU48627.1| quasimodo 3, partial [Schrenkiella parvula]
Length=505

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48625.1| quasimodo 3, partial [Solanum lycopersicum]
Length=505

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +TP+CLIPP
Sbjct  1    CSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDTPLCLIPP  45



>gb|AIU48632.1| quasimodo 3, partial [Platanus x acerifolia]
Length=505

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPAEAVDHMPCEDPRKNSQLSREMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48612.1| quasimodo 3, partial [Manihot esculenta]
Length=505

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C AD VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CSADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDETPLCLIPPP  46



>gb|AIU48610.1| quasimodo 3, partial [Medicago truncatula]
Length=505

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA  VDHMPCEDPR NSQLSREMNYYRERHCPLP ET +CLIPPP
Sbjct  1    CPASEVDHMPCEDPRRNSQLSREMNYYRERHCPLPEETAVCLIPPP  46



>gb|AIU48594.1| quasimodo 3, partial [Sarcandra glabra]
Length=504

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP+D VDHMPCEDPR NSQLSREMN+YRERHCP+P +TP+CLIPPP
Sbjct  1    CPSDAVDHMPCEDPRRNSQLSREMNFYRERHCPVPEDTPLCLIPPP  46



>gb|AIU48600.1| quasimodo 3, partial [Eucalyptus grandis]
Length=505

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA YVDHMPCEDPR +SQLSREMNYYRERHCP P ETP+CL+PPP
Sbjct  1    CPAGYVDHMPCEDPRRSSQLSREMNYYRERHCPPPEETPLCLVPPP  46



>gb|AIU48598.1| quasimodo 3, partial [Capsella rubella]
Length=505

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48585.1| quasimodo 3, partial [Arabidopsis lyrata]
Length=505

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48586.1| quasimodo 3, partial [Arabidopsis thaliana]
Length=505

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48584.1| quasimodo 3, partial [Aquilegia coerulea]
Length=505

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C  D VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CSIDEVDHMPCEDPRKNSQLSREMNFYRERHCPLPQETPLCLIPPP  46



>gb|AIU48597.1| quasimodo 3, partial [Carica papaya]
Length=505

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP  TP+CLIP P
Sbjct  1    CPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPEHTPLCLIPSP  46



>gb|AIU48628.1| quasimodo 3, partial [Vitis vinifera]
Length=505

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSREMN+YRER CPLP ETP+CLIPPP
Sbjct  1    CPAEEVDHMPCEDPRRNSQLSREMNFYRERQCPLPAETPLCLIPPP  46



>gb|AIU48592.1| quasimodo 3, partial [Theobroma cacao]
Length=505

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VDHMPCEDPR NSQLSREMN+YRER CPLP E P+CLIPPP
Sbjct  1    CPADSVDHMPCEDPRRNSQLSREMNFYRERQCPLPDEMPLCLIPPP  46



>gb|AIU48619.1| quasimodo 3, partial [Phaseolus vulgaris]
Length=504

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD  D+MPCEDPR+NSQLSREMNYYRERHCP P ++P+CLIPPP
Sbjct  1    CPADMADYMPCEDPRLNSQLSREMNYYRERHCPRPEDSPLCLIPPP  46



>gb|AIU48609.1| quasimodo 3, partial [Aristolochia tagala]
Length=505

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSR+MN+YRERHCPLP ETP+CLI PP
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSRDMNFYRERHCPLPEETPLCLISPP  46



>gb|AIU48589.1| quasimodo 3, partial [Musa acuminata]
Length=505

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VD+MPCEDPR NSQLSREMN+YRERHCPLP ETP+CL+PPP
Sbjct  1    CPAEEVDNMPCEDPRRNSQLSREMNFYRERHCPLPGETPLCLVPPP  46



>gb|AIU48634.1| quasimodo 3, partial [Houttuynia cordata]
Length=504

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VDHMPCEDPR +SQLSREMN+YRERHCP P E P+CLIPPP
Sbjct  1    CPADAVDHMPCEDPRRSSQLSREMNFYRERHCPAPEEAPLCLIPPP  46



>gb|AIU48593.1| quasimodo 3, partial [Acorus calamus]
Length=505

 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSR+MN+YRERHCP P ETP+CLIPPP
Sbjct  1    CPAEEVDHMPCEDPRRNSQLSRDMNFYRERHCPPPEETPLCLIPPP  46



>gb|AIU48601.1| quasimodo 3, partial [Illicium henryi]
Length=505

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C ++ VDHMPCEDPR NSQLSREMN+YRERHCP P ETP+CLIPPP
Sbjct  1    CSSEAVDHMPCEDPRRNSQLSREMNFYRERHCPKPEETPLCLIPPP  46



>gb|AIU48638.1| quasimodo 3, partial [Cabomba caroliniana]
Length=503

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            CPAD VDHMPCEDPR NSQLSRE N+YRERHCP P E+P+CLIPP
Sbjct  1    CPADVVDHMPCEDPRRNSQLSRERNFYRERHCPAPEESPLCLIPP  45



>gb|AIU48606.1| quasimodo 3, partial [Chimonanthus praecox]
Length=505

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP+D +DHMPCEDPR NSQLSREMN+YRERHCP P E+ ICLIPPP
Sbjct  1    CPSDAIDHMPCEDPRRNSQLSREMNFYRERHCPDPTESQICLIPPP  46



>gb|AIU48596.1| quasimodo 3, partial [Gossypium raimondii]
Length=503

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP D VDHMPCEDP+ NSQLSR MN+YRERHCPLP E P+CLIPPP
Sbjct  1    CPPDSVDHMPCEDPKRNSQLSRYMNFYRERHCPLPDEMPLCLIPPP  46



>gb|AIU48607.1| quasimodo 3, partial [Pandanus utilis]
Length=505

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VD MPCEDPR NSQLSR+MNYYRERHCP P E P+CL+PPP
Sbjct  1    CPAEEVDQMPCEDPRRNSQLSRDMNYYRERHCPAPGEAPLCLVPPP  46



>gb|AIU48636.1| quasimodo 3, partial [Alisma plantago-aquatica]
Length=505

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+  DHMPCEDPR NSQLSR MN+YRERHCP P E P+CLIPPP
Sbjct  1    CPAEETDHMPCEDPRRNSQLSRHMNFYRERHCPSPEEVPLCLIPPP  46



>gb|AIU48630.1| quasimodo 3, partial [Ceratophyllum platyacanthum subsp. oryzetorum]
Length=505

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP + VD+MPCEDP+ NS+LSR MN+YRERHCPLP ETP+CLIPPP
Sbjct  1    CPIETVDYMPCEDPKRNSRLSRVMNFYRERHCPLPEETPLCLIPPP  46



>gb|AIU48616.1| quasimodo 3, partial [Populus trichocarpa]
Length=505

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VDHMPCEDPR NSQLSREMN+YRERHCP   +T +CLIPPP
Sbjct  1    CPADEVDHMPCEDPRRNSQLSREMNFYRERHCPPVEDTHLCLIPPP  46



>gb|AIU48611.1| quasimodo 3, partial [Canna indica]
Length=505

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VD+MPCEDPR +SQLSREMN+YRERHCP+P + P+CL+PPP
Sbjct  1    CPAEEVDNMPCEDPRRSSQLSREMNFYRERHCPMPEDMPLCLVPPP  46



>gb|AIU48631.1| quasimodo 3, partial [Cinnamomum camphora]
Length=505

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VDHMPCEDPR NSQLSREMN+YRERHCP   E+ +CLIPPP
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPSLEESMVCLIPPP  46



>gb|AIU48623.1| quasimodo 3, partial [Yucca filamentosa]
Length=505

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C AD VD MPCEDP+ NSQLSREMN+YRERHCP P E P+CL+PPP
Sbjct  1    CSADEVDQMPCEDPKRNSQLSREMNFYRERHCPSPGEGPLCLVPPP  46



>gb|AIU48588.1| quasimodo 3, partial [Magnolia denudata]
Length=505

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C  D VDHMPCEDPR NSQLSREMN+YRERHCP    TPICL+PPP
Sbjct  1    CSPDAVDHMPCEDPRRNSQLSREMNFYRERHCPALEATPICLVPPP  46



>gb|AIU48629.1| quasimodo 3, partial [Lactuca sativa]
Length=505

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VD+MPCEDP  NSQLSREMN+YRERHCP P ET +CLIP P
Sbjct  1    CPADTVDYMPCEDPTRNSQLSREMNFYRERHCPSPDETSLCLIPAP  46



>gb|AIU48590.1| quasimodo 3, partial [Pinellia ternata]
Length=504

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A+ VDHMPCEDPR NSQLSR MN+YRERHCP P ET +CLIPPP
Sbjct  1    CSAEEVDHMPCEDPRRNSQLSRHMNFYRERHCPPPEETALCLIPPP  46



>gb|AIU48605.1| quasimodo 3, partial [Ceratophyllum demersum]
Length=505

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP + VD+MPCEDP+ NS+LSR MN+YRERHCPL  ETP+CLIPPP
Sbjct  1    CPIETVDYMPCEDPKRNSRLSRVMNFYRERHCPLLEETPLCLIPPP  46



>gb|AIU48608.1| quasimodo 3, partial [Asparagus officinalis]
Length=505

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C +D VD MPCEDPR NSQLSREMN+YRERHCP P + P+CL+P P
Sbjct  1    CSSDKVDDMPCEDPRRNSQLSREMNFYRERHCPAPEDGPLCLVPAP  46



>ref|XP_002961169.1| hypothetical protein SELMODRAFT_74065 [Selaginella moellendorffii]
 gb|EFJ38708.1| hypothetical protein SELMODRAFT_74065 [Selaginella moellendorffii]
Length=591

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 8/92 (9%)
 Frame = +1

Query  382  TPLGDSLAASGRQALLSGDSQQ-----RSLLVTLVESGREIAPIQFCPADYVDHMPCEDP  546
            TPLGDS+AASG ++L S  + +     R  LV L+E G+ +   + C     D+MPC+DP
Sbjct  40   TPLGDSMAASGLKSLDSPLAMEIRPSGRQRLVKLIEKGQRV---ELCAPGLADYMPCQDP  96

Query  547  RINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            + +SQ+SRE N YRERHCP  +E  +C IP P
Sbjct  97   KRSSQISRERNRYRERHCPPENERLLCRIPSP  128



>ref|XP_002966837.1| hypothetical protein SELMODRAFT_168608 [Selaginella moellendorffii]
 gb|EFJ31436.1| hypothetical protein SELMODRAFT_168608 [Selaginella moellendorffii]
Length=591

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 8/92 (9%)
 Frame = +1

Query  382  TPLGDSLAASGRQALLSGDSQQ-----RSLLVTLVESGREIAPIQFCPADYVDHMPCEDP  546
            TPLGDS+AASG ++L S  + +     R  LV L+E G+ +   + C     D+MPC+DP
Sbjct  40   TPLGDSMAASGLKSLDSPLAMEIRPSGRQRLVKLIEKGQRV---ELCAPGLADYMPCQDP  96

Query  547  RINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            + +SQ+SRE N YRERHCP  +E  +C IP P
Sbjct  97   KRSSQISRERNRYRERHCPPENERLLCRIPSP  128



>gb|AIU48587.1| quasimodo 3, partial [Lilium brownii]
Length=312

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A+ VD +PCEDPR  SQLSREMN+YRERHCP P + P+CLIPPP
Sbjct  1    CAAEEVDQLPCEDPRRFSQLSREMNFYRERHCPEPEDVPLCLIPPP  46



>gb|AIU48622.1| quasimodo 3, partial [Dioscorea oppositifolia]
Length=505

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPAD VD MPCEDPR +SQLSR MN YRERHCP   E P+CLIPPP
Sbjct  1    CPADDVDQMPCEDPRRSSQLSRFMNSYRERHCPAAGEAPLCLIPPP  46



>gb|AIU48621.1| quasimodo 3, partial [Ricinus communis]
Length=496

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  529  MPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            MPCEDPR NSQLSR+MN+YRERHCP+P ETP+CLIPPP
Sbjct  1    MPCEDPRRNSQLSRDMNFYRERHCPIPDETPLCLIPPP  38



>ref|XP_002511800.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50469.1| conserved hypothetical protein [Ricinus communis]
Length=507

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +1

Query  529  MPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            MPCEDPR NSQLSR+MN+YRERHCP+P ETP+CLIPPP
Sbjct  1    MPCEDPRRNSQLSRDMNFYRERHCPIPDETPLCLIPPP  38



>gb|AIU48637.1| quasimodo 3, partial [Trachycarpus fortunei]
Length=505

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+ VD+MPCEDPR NSQL+R MN YRERHCP P E+ +CL+PPP
Sbjct  1    CPAEEVDYMPCEDPRRNSQLTRHMNLYRERHCPPPGESLLCLVPPP  46



>gb|AIU48603.1| quasimodo 3, partial [Iris japonica]
Length=505

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            C A+ VD+MPCEDPR +SQLSR+MN+YRER CPLP E P+CL+PP
Sbjct  1    CSAEEVDNMPCEDPRRSSQLSRKMNFYRERQCPLPGEAPLCLVPP  45



>gb|AIU48633.1| quasimodo 3, partial [Ginkgo biloba]
Length=505

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP + VDH+PCEDPR +SQ SRE NYYRERHCP P E  +CLIPPP
Sbjct  1    CPLESVDHIPCEDPRRSSQFSRERNYYRERHCPPPSENLLCLIPPP  46



>gb|EEE61526.1| hypothetical protein OsJ_15828 [Oryza sativa Japonica Group]
Length=463

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P+CL+PPP
Sbjct  73   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPVCLVPPP  118



>emb|CAE02253.2| OSJNBb0032E06.12 [Oryza sativa Japonica Group]
Length=586

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P+CL+PPP
Sbjct  73   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPVCLVPPP  118



>emb|CAH67036.1| OSIGBa0139P06.9 [Oryza sativa Indica Group]
 gb|EEC77823.1| hypothetical protein OsI_17029 [Oryza sativa Indica Group]
Length=584

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P+CL+PPP
Sbjct  71   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPVCLVPPP  116



>gb|AIU48618.1| quasimodo 3, partial [Panicum virgatum]
Length=505

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P CL+PPP
Sbjct  1    CAASEVDFLPCEDPRRSSRLSREMNYYRERHCPARGEAPACLVPPP  46



>gb|AIU48624.1| quasimodo 3, partial [Setaria italica]
Length=505

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P CL+PPP
Sbjct  1    CAAAEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPACLVPPP  46



>dbj|BAJ98075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  65   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEASACLVPPP  110



>dbj|BAJ96685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  65   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEASACLVPPP  110



>dbj|BAJ96404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  65   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEASACLVPPP  110



>gb|AIU48635.1| quasimodo 3, partial [Zea mays]
Length=505

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  1    CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPTRGEALACLVPPP  46



>ref|XP_008669009.1| PREDICTED: probable methyltransferase PMT13 [Zea mays]
 gb|AFW59274.1| hypothetical protein ZEAMMB73_145295 [Zea mays]
Length=583

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  68   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPTRGEALACLVPPP  113



>ref|XP_002448358.1| hypothetical protein SORBIDRAFT_06g025780 [Sorghum bicolor]
 gb|EES12686.1| hypothetical protein SORBIDRAFT_06g025780 [Sorghum bicolor]
Length=606

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  71   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPP  116



>gb|AIU48591.1| quasimodo 3, partial [Brachypodium distachyon]
Length=505

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  1    CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPP  46



>ref|XP_003580350.1| PREDICTED: probable methyltransferase PMT13 [Brachypodium distachyon]
Length=583

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  68   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPP  113



>gb|AIU48626.1| quasimodo 3, partial [Sorghum bicolor]
Length=505

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  1    CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPP  46



>ref|XP_004976531.1| PREDICTED: probable methyltransferase PMT13-like [Setaria italica]
Length=577

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +1

Query  520  VDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            VD +PCEDPR +S+LSREMNYYRERHCP   E P CL+PPP
Sbjct  67   VDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPACLVPPP  107



>ref|XP_001769468.1| predicted protein [Physcomitrella patens]
 gb|EDQ65837.1| predicted protein [Physcomitrella patens]
Length=598

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 66/116 (57%), Gaps = 7/116 (6%)
 Frame = +1

Query  304  ARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL---LSGDSQQRSLLVTLVE  474
             RKWQLLD++     AA+ + FLL+FT LGDSLA +G++ L   L  DS         VE
Sbjct  14   GRKWQLLDIIIFTMMAALMILFLLIFTSLGDSLATAGQRELDAALRADSTSNGFW-DQVE  72

Query  475  SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
             G     ++ CP    D MPC DP+     S+E N+YRERHCP   E   CLIPPP
Sbjct  73   HG---LLVESCPVRLADIMPCHDPKRARSFSKERNHYRERHCPPFEEKLRCLIPPP  125



>ref|XP_001772854.1| predicted protein [Physcomitrella patens]
 gb|EDQ62256.1| predicted protein [Physcomitrella patens]
Length=608

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 50/92 (54%), Gaps = 11/92 (12%)
 Frame = +1

Query  382  TPLGDSLAASGRQALLSGDSQQR-----SLLVTLVESGREIAPIQFCPADYVDHMPCEDP  546
            T LGDSLAA G+Q L   D+  R     S     VE+G     ++ CP    D MPC DP
Sbjct  40   TSLGDSLAAGGQQYL---DAALRADPTSSGFWQQVETG---LLVESCPVRLADIMPCHDP  93

Query  547  RINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +     ++E N+YRERHCP   E   CLIPPP
Sbjct  94   KRARAFTKERNHYRERHCPPAEERLRCLIPPP  125



>ref|XP_010676941.1| PREDICTED: probable methyltransferase PMT17 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 33/55 (60%), Gaps = 2/55 (4%)
 Frame = +1

Query  484  EIAPIQFCPAD--YVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            EIA  +F P D  Y ++ PC+DPR   +  R M  YRERHCP   E   CLIPPP
Sbjct  120  EIAVKEFPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPSKEEMMQCLIPPP  174



>gb|KDP42862.1| hypothetical protein JCGZ_23804 [Jatropha curcas]
Length=610

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            E+ +E+    FCP ++ D++PC DP      + E  Y RERHCP P E P CL+P P
Sbjct  83   ETIKELPFFNFCPNNFTDYIPCHDPSREILFTAERFYSRERHCPEPSEKPRCLVPRP  139



>ref|XP_002310457.2| hypothetical protein POPTR_0007s02440g [Populus trichocarpa]
 gb|EEE90907.2| hypothetical protein POPTR_0007s02440g [Populus trichocarpa]
Length=600

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  481  REIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            R +    FCP ++ ++ PC DP   +  + E  + RERHCP P+E P+CL+P P
Sbjct  76   RNLQFFNFCPPNFTNYCPCHDPSRETDFTAERFFSRERHCPEPYEKPMCLVPRP  129



>ref|XP_011026358.1| PREDICTED: probable methyltransferase PMT19 [Populus euphratica]
Length=600

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  481  REIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            R +    FCP ++ ++ PC DP   +  + E  + RERHCP P+E P CL+P P
Sbjct  76   RNLQFFNFCPPNFTNYCPCHDPSRETDFTAERFFSRERHCPEPYEKPPCLVPRP  129



>ref|XP_004228376.1| PREDICTED: probable methyltransferase PMT2 [Solanum lycopersicum]
Length=612

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +1

Query  463  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            ++ +SG E+   + C   Y DH PC+D +    L RE   YRERHCP P +   CLIP P
Sbjct  73   SIDDSGTEVKKFKPCRPRYTDHTPCQDQKRAMHLPRENMIYRERHCPPPEKKLNCLIPAP  132



>gb|EMS63450.1| putative methyltransferase PMT21 [Triticum urartu]
Length=516

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 7/77 (9%)
 Frame = +1

Query  424  LLSGDSQQRSLL-VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNY---YRE  591
            ++S   Q+ S + + +  +G +      CPADY D+ PC DP+   +  R  NY   + E
Sbjct  60   IVSTTKQEGSAIALAIARNGDDDVEFSECPADYQDYTPCTDPK---RWRRYGNYRLSFME  116

Query  592  RHCPLPHETPICLIPPP  642
            RHCP P E  +CL+PPP
Sbjct  117  RHCPPPPERAVCLVPPP  133



>ref|NP_001065036.1| Os10g0510400 [Oryza sativa Japonica Group]
 gb|AAK84446.1|AC087192_7 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54570.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47874.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26950.1| Os10g0510400 [Oryza sativa Japonica Group]
 dbj|BAG93354.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51256.1| hypothetical protein OsJ_32126 [Oryza sativa Japonica Group]
Length=634

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 10/97 (10%)
 Frame = +1

Query  382  TPLGDSLAASGRQALL--SGDSQQRSL------LVTLVESGREIA--PIQFCPADYVDHM  531
            T +G   AA+G+ + +   G + Q SL       ++L ++G E A  P   CP ++ ++ 
Sbjct  56   TKVGCDPAAAGQSSAVPSFGSASQESLDFEAHHQLSLDDTGAEAAVQPFPACPLNFSEYT  115

Query  532  PCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            PCED +   +  R M  YRERHCP   E   CLIP P
Sbjct  116  PCEDRKRGRRFERAMLVYRERHCPGKDEEIRCLIPAP  152



>ref|XP_011016489.1| PREDICTED: probable methyltransferase PMT17, partial [Populus 
euphratica]
Length=345

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 4/84 (5%)
 Frame = +1

Query  391  GDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSR  570
            G S   S   A+L  +S  + +     +S  EI P   C   Y ++ PC+DPR   +  R
Sbjct  62   GVSSNPSSESAVLDFNSHHQ-IQFNNTDSVNEIPP---CDMSYSEYTPCQDPRRGRKFDR  117

Query  571  EMNYYRERHCPLPHETPICLIPPP  642
             M  YRERHCP   E  +CLIP P
Sbjct  118  NMLKYRERHCPTKDELLLCLIPAP  141



>ref|XP_009350354.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=628

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +1

Query  469  VESGREIAPIQFCPAD--YVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            V+  +  A  +F P D  Y ++ PC+DPR   +  R+M  YRERHCP   E  +CLIP P
Sbjct  89   VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  148



>gb|AES77233.2| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=572

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  484  EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +I+  QFC  +Y ++ PCEDP+   +  ++  + +ERHCP  +E   CLIP P
Sbjct  39   KISHFQFCSTNYTNYCPCEDPKRQKKFPKKNYFRKERHCPQNNERLTCLIPKP  91



>ref|XP_009373681.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373682.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373683.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=630

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%), Gaps = 2/60 (3%)
 Frame = +1

Query  469  VESGREIAPIQFCPAD--YVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            V+  +  A  +F P D  Y ++ PC+DPR   +  R+M  YRERHCP   E  +CLIP P
Sbjct  89   VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  148



>ref|XP_003621015.1| hypothetical protein MTR_7g006060 [Medicago truncatula]
Length=591

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  484  EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +I+  QFC  +Y ++ PCEDP+   +  ++  + +ERHCP  +E   CLIP P
Sbjct  39   KISHFQFCSTNYTNYCPCEDPKRQKKFPKKNYFRKERHCPQNNERLTCLIPKP  91



>ref|XP_002992272.1| hypothetical protein SELMODRAFT_186660 [Selaginella moellendorffii]
 gb|EFJ06653.1| hypothetical protein SELMODRAFT_186660 [Selaginella moellendorffii]
Length=539

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 4/53 (8%)
 Frame = +1

Query  496  IQFCPADYVDHMPCEDPRINSQLSREMNYYR----ERHCPLPHETPICLIPPP  642
            +  CP+++ +++PC DP   + +S ++N  R    ER CP PH+ P CL+PPP
Sbjct  26   VSLCPSNFTEYIPCHDPNYIASISSKLNLSRREHLERQCPPPHQRPFCLVPPP  78



>gb|EMT00863.1| hypothetical protein F775_08090 [Aegilops tauschii]
Length=608

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 42/76 (55%), Gaps = 8/76 (11%)
 Frame = +1

Query  430  SGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNY---YRER  594
            +   +  ++ + +  +G     ++F  CPADY D+ PC DP+   +  R  NY   + ER
Sbjct  63   TAKQEGSAIALAIARNGNGDDEVEFSECPADYQDYTPCTDPK---RWRRYGNYRLSFMER  119

Query  595  HCPLPHETPICLIPPP  642
            HCP P E  +CL+PPP
Sbjct  120  HCPPPPERAVCLVPPP  135



>ref|XP_011004387.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
 ref|XP_011004388.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
Length=625

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +1

Query  409  SGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYR  588
            S   A+L  +S  + +     +S  EI P   C   Y ++ PC+DPR   +  R M  YR
Sbjct  68   SSESAVLDFNSHHQ-IQFNNTDSVNEIPP---CDMSYSEYTPCQDPRRGRKFDRNMLKYR  123

Query  589  ERHCPLPHETPICLIPPP  642
            ERHCP   E  +CLIP P
Sbjct  124  ERHCPTKDELLLCLIPAP  141



>ref|XP_006443118.1| hypothetical protein CICLE_v10019345mg [Citrus clementina]
 ref|XP_006478861.1| PREDICTED: probable methyltransferase PMT19-like [Citrus sinensis]
 gb|ESR56358.1| hypothetical protein CICLE_v10019345mg [Citrus clementina]
Length=612

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 1/47 (2%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI-CLIPPP  642
            CP ++ ++MPC DP + + LS E  +YRERHCP   E  + CL+P P
Sbjct  91   CPQNFTNYMPCHDPSLENNLSEERFFYRERHCPKADEERVKCLVPKP  137



>ref|XP_010940855.1| PREDICTED: probable methyltransferase PMT21 [Elaeis guineensis]
Length=1027

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 8/58 (14%)
 Frame = +1

Query  484  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNY---YRERHCPLPHETPICLIPPP  642
            E+ P+ F  C +DY D+ PC DP+   +  R  NY   +RERHCP  +E   CL+PPP
Sbjct  502  EVKPVAFPECDSDYQDYTPCTDPK---RWRRYGNYRLTHRERHCPPIYERKECLVPPP  556



>ref|XP_006366703.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366704.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006366705.1| PREDICTED: probable methyltransferase PMT2-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006366706.1| PREDICTED: probable methyltransferase PMT2-like isoform X4 [Solanum 
tuberosum]
Length=612

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = +1

Query  463  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            ++ +SG E+   + C   Y DH PC+D +      RE   YRERHCP P +   CLIP P
Sbjct  73   SIDDSGTEVKKFKPCRPRYTDHTPCQDQKRAMHFPRENMIYRERHCPPPEKKLHCLIPAP  132



>ref|XP_002317647.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE98259.1| dehydration-responsive family protein [Populus trichocarpa]
Length=625

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 43/84 (51%), Gaps = 4/84 (5%)
 Frame = +1

Query  391  GDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSR  570
            G S   S   A+L  +S  + + +   +S  EI P   C   Y ++ PC+DP+   +  R
Sbjct  62   GVSSNPSSESAVLDFNSHHQ-IQINNTDSVNEIPP---CDMSYSEYTPCQDPQRGRKFDR  117

Query  571  EMNYYRERHCPLPHETPICLIPPP  642
             M  YRERHCP   E  +CLIP P
Sbjct  118  NMLKYRERHCPTKDELLLCLIPAP  141



>gb|EEC73773.1| hypothetical protein OsI_08448 [Oryza sativa Indica Group]
Length=646

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  499  QFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            Q CPA Y ++ PCED + + +  RE   YRERHCP   E   CL+P P
Sbjct  119  QACPARYSEYTPCEDVKRSLRYPRERLVYRERHCPTGRERLRCLVPAP  166



>ref|XP_010527898.1| PREDICTED: probable methyltransferase PMT2 [Tarenaya hassleriana]
Length=615

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            ES  E    + C + Y D+ PC+DPR     +RE  +YRERHCP  ++   CLIP P
Sbjct  77   ESKLEEKAFEPCRSRYTDYTPCQDPRRAMTFTRENMFYRERHCPPENKKLHCLIPAP  133



>ref|XP_002530544.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF31835.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=603

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  496  IQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
              FCP ++ D+ PC DP      + E  + RERHCP P+E   CLIP P
Sbjct  85   FSFCPPNFTDYCPCHDPSREMHFTTERFFNRERHCPEPNEKSKCLIPKP  133



>ref|XP_006827213.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
 gb|ERM94450.1| hypothetical protein AMTR_s00010p00259630 [Amborella trichopoda]
Length=614

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A Y+D+ PC+D R      RE   YRERHCP   ET  CLIP P
Sbjct  87   CDARYIDYTPCQDQRRAMTFPRENMIYRERHCPTDEETLDCLIPAP  132



>ref|XP_002466953.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
 gb|EER93951.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
Length=637

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query  412  GRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRE  591
            G   +L  D+  R L +   +   E+     CP ++ ++ PCED +   +  R M  YRE
Sbjct  80   GSGEVLDFDAHHR-LTINNTDGDGELQQFPACPLNFSEYTPCEDRKRGRRFDRAMLVYRE  138

Query  592  RHCPLPHETPICLIPPP  642
            RHCP   E   CLIP P
Sbjct  139  RHCPGKDEQVRCLIPAP  155



>emb|CAH18000.1| Ankyrin protein kinase-like [Poa pratensis]
Length=613

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (58%), Gaps = 3/59 (5%)
 Frame = +1

Query  475  SGREIAPIQF---CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            SG  ++P++    CP  + D+ PC+D     +  RE   YRERHCPL  E   CL+PPP
Sbjct  72   SGDLVSPVKKFKPCPDRFTDYTPCQDQNRAMKFPRENMNYRERHCPLQKEKLHCLVPPP  130



>ref|XP_006439163.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
 gb|ESR52403.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
Length=629

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y D+ PC+DP  + +  REM  YRERHCP   E   CLIP P
Sbjct  104  CDMSYSDYTPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAP  149



>gb|EEC67295.1| hypothetical protein OsI_34283 [Oryza sativa Indica Group]
Length=634

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 2/82 (2%)
 Frame = +1

Query  397  SLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREM  576
            S  ++ +++L      Q SL  T  E+   + P   CP ++ ++ PCED +   +  R M
Sbjct  73   SFGSASQESLDFEAHHQLSLDDTDAEAA--VQPFPACPLNFSEYTPCEDRKRGRRFERAM  130

Query  577  NYYRERHCPLPHETPICLIPPP  642
              YRERHCP   E   CLIP P
Sbjct  131  LVYRERHCPGKDEEIRCLIPAP  152



>gb|AAT38756.2| Putative methyltransferase family protein [Solanum demissum]
Length=828

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +   E+  ++ C   Y D+ PC+D +      RE   YRERHCP   E   CLIP P
Sbjct  200  DESEEVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHCPPQEEKLHCLIPAP  256



>ref|XP_006655678.1| PREDICTED: probable methyltransferase PMT17-like isoform X1 [Oryza 
brachyantha]
Length=640

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 40/85 (47%), Gaps = 5/85 (6%)
 Frame = +1

Query  388  LGDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLS  567
            LG S  +SG +       Q     V+  ES   +  I  C   Y ++ PC+DPR   +  
Sbjct  78   LGASTNSSGTRLDFQAHHQ-----VSFNESSLVVEKIPPCQLKYSEYTPCQDPRRARKFP  132

Query  568  REMNYYRERHCPLPHETPICLIPPP  642
            + M  YRERHCP   E   CLIP P
Sbjct  133  KTMMQYRERHCPRKEELFRCLIPAP  157



>ref|XP_006655679.1| PREDICTED: probable methyltransferase PMT17-like isoform X2 [Oryza 
brachyantha]
Length=626

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 40/85 (47%), Gaps = 5/85 (6%)
 Frame = +1

Query  388  LGDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLS  567
            LG S  +SG +       Q     V+  ES   +  I  C   Y ++ PC+DPR   +  
Sbjct  64   LGASTNSSGTRLDFQAHHQ-----VSFNESSLVVEKIPPCQLKYSEYTPCQDPRRARKFP  118

Query  568  REMNYYRERHCPLPHETPICLIPPP  642
            + M  YRERHCP   E   CLIP P
Sbjct  119  KTMMQYRERHCPRKEELFRCLIPAP  143



>ref|NP_192782.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
 sp|Q9SZX8.1|PMTH_ARATH RecName: Full=Probable methyltransferase PMT17 [Arabidopsis thaliana]
 emb|CAB40037.1| putative protein [Arabidopsis thaliana]
 emb|CAB78167.1| putative protein [Arabidopsis thaliana]
 gb|AEE82883.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
Length=633

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP+  E   CLIPP
Sbjct  81   IELKETNQTIKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPVKDELLYCLIPP  140

Query  640  P  642
            P
Sbjct  141  P  141



>ref|XP_004511207.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004511208.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=610

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = +1

Query  427  LSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  606
            LS DS     +  + E+  +    + C A Y D+ PC+D R      RE   YRERHCP 
Sbjct  61   LSFDSHHAGKVSQINEADSKTKAFKPCKARYTDYTPCQDQRRAMTFPRENMNYRERHCPP  120

Query  607  PHETPICLIPPP  642
              E   C+IP P
Sbjct  121  EEEKLHCMIPAP  132



>ref|XP_004982637.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Setaria 
italica]
Length=642

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query  412  GRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRE  591
            G   +L  D+  R L +   ++G  +     CP ++ ++ PCED     +  R M  YRE
Sbjct  84   GSGEVLDFDAHHR-LAINDTDAGAGLQQFPACPLNFSEYTPCEDRTRGRRFDRTMLVYRE  142

Query  592  RHCPLPHETPICLIPPP  642
            RHCP   E   CLIP P
Sbjct  143  RHCPGKDEQVRCLIPAP  159



>ref|XP_004982638.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Setaria 
italica]
Length=638

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query  412  GRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRE  591
            G   +L  D+  R L +   ++G  +     CP ++ ++ PCED     +  R M  YRE
Sbjct  80   GSGEVLDFDAHHR-LAINDTDAGAGLQQFPACPLNFSEYTPCEDRTRGRRFDRTMLVYRE  138

Query  592  RHCPLPHETPICLIPPP  642
            RHCP   E   CLIP P
Sbjct  139  RHCPGKDEQVRCLIPAP  155



>ref|NP_001053603.1| Os04g0570800 [Oryza sativa Japonica Group]
 emb|CAD41579.3| OSJNBa0088I22.11 [Oryza sativa Japonica Group]
 dbj|BAF15517.1| Os04g0570800 [Oryza sativa Japonica Group]
 gb|EAY95218.1| hypothetical protein OsI_17036 [Oryza sativa Indica Group]
 dbj|BAG91550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  469  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            V SG+     + CPA Y ++ PCED   + +  R+   YRERHCP   E   CL+P P
Sbjct  104  VASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPSEGERLRCLVPAP  161



>dbj|BAK00591.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=611

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 6/59 (10%)
 Frame = +1

Query  475  SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNY---YRERHCPLPHETPICLIPPP  642
            +G E      CPA+Y D+ PC DP+   +  R  NY   + ERHCP P E  +CL+PPP
Sbjct  83   NGDEEVEFSECPAEYQDYTPCTDPK---RWRRYGNYRLSFMERHCPPPPERAVCLVPPP  138



>ref|XP_008784684.1| PREDICTED: probable methyltransferase PMT2 [Phoenix dactylifera]
Length=612

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            V+L  S   +   + C   Y+D+ PC+D     Q  RE   YRERHCPL +E   CLIP 
Sbjct  72   VSLEPSELNVKVFEPCGVHYIDYTPCQDQNRAMQFPRENMAYRERHCPLENEKLHCLIPA  131

Query  640  P  642
            P
Sbjct  132  P  132



>ref|XP_008378063.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378064.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378065.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y ++ PC+DPR   +  R+M  +RERHCP   E  +CLIP P
Sbjct  103  CDMSYSEYTPCQDPRRGRKFDRKMLKHRERHCPTKEEQLLCLIPAP  148



>ref|XP_006858634.1| hypothetical protein AMTR_s00066p00040550 [Amborella trichopoda]
 gb|ERN20101.1| hypothetical protein AMTR_s00066p00040550 [Amborella trichopoda]
Length=633

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = +1

Query  496  IQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
             QFC + Y D+ PC D R   +   +M ++RERHCP   E   CLIP P
Sbjct  99   FQFCDSKYRDYCPCHDTRREKKFDTDMLFFRERHCPERSEKLRCLIPVP  147



>dbj|BAJ94360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=578

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 6/59 (10%)
 Frame = +1

Query  475  SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNY---YRERHCPLPHETPICLIPPP  642
            +G E      CPA+Y D+ PC DP+   +  R  NY   + ERHCP P E  +CL+PPP
Sbjct  83   NGDEEVEFSECPAEYQDYTPCTDPK---RWRRYGNYRLSFMERHCPPPPERAVCLVPPP  138



>gb|AAT39937.2| Putative methyltransferase family protein [Solanum demissum]
Length=755

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +   E+  ++ C   Y D+ PC+D +      RE   YRERHCP   E   CLIP P
Sbjct  76   DESEEVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHCPPQEEKLHCLIPAP  132



>ref|XP_010055373.1| PREDICTED: probable methyltransferase PMT19 [Eucalyptus grandis]
 gb|KCW87841.1| hypothetical protein EUGRSUZ_A00238 [Eucalyptus grandis]
Length=627

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 3/57 (5%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            ++ R +AP   CP +Y ++ PC+DP    + + E  ++RERHCP  HE   CL+P P
Sbjct  96   QAARLLAP---CPKNYTNYCPCQDPSRQKRFAVERFFHRERHCPETHERLRCLVPRP  149



>gb|EYU22422.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=517

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y D+ PC+D R     SRE   YRERHCPL  +   CLIP P
Sbjct  90   CHKKYTDYTPCQDQRRAMTFSRESMIYRERHCPLQKDKLHCLIPAP  135



>gb|EYU22421.1| hypothetical protein MIMGU_mgv1a003056mg [Erythranthe guttata]
Length=611

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y D+ PC+D R     SRE   YRERHCPL  +   CLIP P
Sbjct  90   CHKKYTDYTPCQDQRRAMTFSRESMIYRERHCPLQKDKLHCLIPAP  135



>ref|XP_004490044.1| PREDICTED: probable methyltransferase PMT2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004490045.1| PREDICTED: probable methyltransferase PMT2-like isoform X2 [Cicer 
arietinum]
Length=608

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y D+ PC+D R     SRE   YRERHCPL  +   CLIP P
Sbjct  87   CNVRYTDYTPCQDQRHAMTFSRENMIYRERHCPLEEDKLHCLIPAP  132



>ref|XP_003613748.1| hypothetical protein MTR_5g040360 [Medicago truncatula]
 gb|AES96706.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=609

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A Y+D+ PC D R     SR+   YRERHCP   E   CLIP P
Sbjct  87   CKARYIDYTPCHDQRRAMTFSRQNMIYRERHCPREEEKLHCLIPAP  132



>dbj|BAJ98046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA+Y ++ PCED + + +  R+   YRERHCP   E   CL+P P
Sbjct  117  CPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAP  162



>ref|XP_008239284.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
 ref|XP_008239285.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
Length=637

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y ++ PC+DP+   +  R+M  YRERHCP   E  +CLIP P
Sbjct  110  CDMAYSEYTPCQDPQRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  155



>gb|ACJ85858.1| unknown [Medicago truncatula]
Length=610

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 34/72 (47%), Gaps = 0/72 (0%)
 Frame = +1

Query  427  LSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  606
            LS DS     +  + ES       + C A Y D+ PC+D R      RE   YRERHCP 
Sbjct  61   LSFDSHHAGEVSQIDESNSNTKVFKPCEARYTDYTPCQDQRRAMTFPRENMNYRERHCPP  120

Query  607  PHETPICLIPPP  642
              E   C+IP P
Sbjct  121  EEEKLHCMIPAP  132



>ref|XP_006397065.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
 gb|ESQ38518.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
Length=665

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 30/57 (53%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPPP
Sbjct  122  ETNQTIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPP  178



>ref|XP_003628357.1| hypothetical protein MTR_8g055840 [Medicago truncatula]
 gb|AET02833.1| methyltransferase PMT2-like protein [Medicago truncatula]
Length=610

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 34/72 (47%), Gaps = 0/72 (0%)
 Frame = +1

Query  427  LSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  606
            LS DS     +  + ES       + C A Y D+ PC+D R      RE   YRERHCP 
Sbjct  61   LSFDSHHAGEVSQIDESNSNTKVFKPCEARYTDYTPCQDQRRAMTFPRENMNYRERHCPP  120

Query  607  PHETPICLIPPP  642
              E   C+IP P
Sbjct  121  EEEKLHCMIPAP  132



>gb|KJB08229.1| hypothetical protein B456_001G071800 [Gossypium raimondii]
Length=655

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C A YVD+ PC+D     +  R+   YRERHCP   E   CLIP P
Sbjct  87   CHAKYVDYTPCQDQMRAMKFPRDNMIYRERHCPTEDEKLQCLIPAP  132



>emb|CDP05238.1| unnamed protein product [Coffea canephora]
Length=655

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y ++ PCEDP+ + + SR    YRERHCP  HE   C IP P
Sbjct  120  CDVKYSEYTPCEDPKRSLKFSRSRLIYRERHCPAKHELLKCRIPAP  165



>gb|KDP31241.1| hypothetical protein JCGZ_11617 [Jatropha curcas]
Length=613

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 46/89 (52%), Gaps = 5/89 (6%)
 Frame = +1

Query  391  GDSLAASGRQ----ALLSGDSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRIN  555
            GDS+A    +    ++L+  + Q S    +V+S G E+  I+ C   Y+D+ PC+D    
Sbjct  42   GDSIAWVITKQTHCSILNNLNYQTSGDAGIVDSSGEEVQEIKPCDDKYIDYTPCQDQMRA  101

Query  556  SQLSREMNYYRERHCPLPHETPICLIPPP  642
                RE   YRERHCP   E   CL+P P
Sbjct  102  MTFPRENMNYRERHCPPEEEKLHCLVPAP  130



>ref|XP_006661944.1| PREDICTED: probable methyltransferase PMT18-like [Oryza brachyantha]
Length=633

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 31/57 (54%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            ++G  + P   CP ++ ++ PCED     +  R M  YRERHCP   E   CL+P P
Sbjct  95   DAGAAVQPFPACPMNFSEYTPCEDRTRGRRFERAMLVYRERHCPGKDEEIRCLVPAP  151



>gb|AAT38682.2| Methyltransferase family protein, putative [Solanum demissum]
 gb|AAT38802.2| Methyltransferase family protein, putative [Solanum demissum]
Length=666

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +   E+  ++ C   Y D+ PC+D +      RE   YRERHCP   E   CLIP P
Sbjct  76   DESEEVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHCPPQEEKLHCLIPAP  132



>gb|AIU48604.1| quasimodo 3, partial [Chloranthus japonicus]
Length=495

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 27/46 (59%), Gaps = 10/46 (22%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP+D V HMPCED R N           ER CP P E P+CLIPPP
Sbjct  1    CPSDAVHHMPCEDLRRNG----------ERKCPAPEEMPLCLIPPP  36



>ref|NP_001146334.1| uncharacterized protein LOC100279910 [Zea mays]
 gb|ACL53711.1| unknown [Zea mays]
Length=357

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +1

Query  463  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +LV   ++  P   CP  Y D+ PC+D     +  RE   YRERHCP   E   CL+PPP
Sbjct  76   SLVSPSKKFKP---CPDLYTDYTPCQDQNRAMKFPRENMNYRERHCPAQKEKLHCLVPPP  132



>gb|KDP35427.1| hypothetical protein JCGZ_10810 [Jatropha curcas]
Length=580

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 32/59 (54%), Gaps = 7/59 (12%)
 Frame = +1

Query  487  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +AP+Q        C +DY D+ PC DPR   +   +     ERHCP P E  +CL+PPP
Sbjct  43   VAPLQIKSAVFPECSSDYQDYTPCTDPRRWKKYGYQRLTLMERHCPPPFERKVCLVPPP  101



>gb|AAU90305.2| Methyltransferase, putative [Solanum tuberosum]
Length=718

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/57 (39%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  472  ESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +   E+  ++ C   Y D+ PC+D +      RE   YRERHCP   E   CLIP P
Sbjct  76   DESEEVEELKPCDPQYTDYTPCQDQKRAMTFPRENMNYRERHCPPQEEKLHCLIPAP  132



>tpg|DAA36414.1| TPA: hypothetical protein ZEAMMB73_585119 [Zea mays]
Length=651

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPA Y ++ PCED   + +  R+   YRERHCP   E   CL+P P
Sbjct  110  CPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAAGERLRCLVPAP  155



>ref|XP_011013091.1| PREDICTED: probable methyltransferase PMT2 [Populus euphratica]
Length=610

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  421  ALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHC  600
            ++ +  + Q+S    +++ G ++   + C   Y+D+ PC+D        R+   YRERHC
Sbjct  57   SVFNNLNYQKSGDAGMIDDGAQVKEFKPCEDKYIDYTPCQDQMRAMTFPRDNMIYRERHC  116

Query  601  PLPHETPICLIPPP  642
            P  +E   CLIP P
Sbjct  117  PSDNEKLPCLIPAP  130



>ref|XP_006286418.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
 gb|EOA19316.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
Length=637

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            + L E+ + I  ++ C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  87   IDLKETNQTIKYLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  146

Query  640  P  642
            P
Sbjct  147  P  147



>ref|XP_009793104.1| PREDICTED: probable methyltransferase PMT2 [Nicotiana sylvestris]
Length=613

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 34/61 (56%), Gaps = 2/61 (3%)
 Frame = +1

Query  463  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI-CLIPP  639
            ++ +SG E+   + C   Y DH PC+D +      RE   YRERHCP P E  + CLIP 
Sbjct  74   SIDDSGTEVKKFKPCHPRYTDHTPCQDQKRAMHFPRENMIYRERHCP-PQEKKLHCLIPA  132

Query  640  P  642
            P
Sbjct  133  P  133



>ref|XP_008348991.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348992.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348993.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y ++ PC+DPR   +  R+M   RERHCP   E  +CLIP P
Sbjct  103  CDMSYSEYTPCQDPRRGRKFDRKMLKXRERHCPTKEEQLLCLIPAP  148



>ref|NP_001152470.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG47777.1| ankyrin protein kinase-like [Zea mays]
Length=615

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +1

Query  463  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +LV   ++  P   CP  Y D+ PC+D     +  RE   YRERHCP   E   CL+PPP
Sbjct  76   SLVSPSKKFKP---CPDLYTDYTPCQDQNRAMKFPRENMNYRERHCPAQKEKLHCLVPPP  132



>ref|XP_008651354.1| PREDICTED: uncharacterized protein LOC100279910 isoform X1 [Zea 
mays]
 tpg|DAA61440.1| TPA: ankyrin protein kinase-like protein [Zea mays]
Length=615

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 32/60 (53%), Gaps = 3/60 (5%)
 Frame = +1

Query  463  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +LV   ++  P   CP  Y D+ PC+D     +  RE   YRERHCP   E   CL+PPP
Sbjct  76   SLVSPSKKFKP---CPDLYTDYTPCQDQNRAMKFPRENMNYRERHCPAQKEKLHCLVPPP  132



>ref|XP_004510859.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=644

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 25/46 (54%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C     ++ PCED   +S+ SR    YRERHCP P E   C IP P
Sbjct  114  CDPSLYEYTPCEDSTRSSKFSRNRQVYRERHCPAPKEILRCRIPAP  159



>ref|NP_001047721.1| Os02g0675700 [Oryza sativa Japonica Group]
 dbj|BAD29526.1| dehydration-responsive family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF09635.1| Os02g0675700 [Oryza sativa Japonica Group]
 gb|EEE57564.1| hypothetical protein OsJ_07909 [Oryza sativa Japonica Group]
Length=646

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  499  QFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            Q CPA Y ++ PCED + + +  RE   YRERHCP   E   CL+P P
Sbjct  119  QACPARYSEYTPCEDVKRSLRYPRERLVYRERHCPTGRERLRCLVPAP  166



>ref|XP_002874627.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50886.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  84   IELKETNQTIKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  143

Query  640  P  642
            P
Sbjct  144  P  144



>ref|XP_010455441.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=633

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  86   IDLKETNQTIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  145

Query  640  P  642
            P
Sbjct  146  P  146



>ref|XP_010421961.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=637

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  86   IDLKETNQTIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  145

Query  640  P  642
            P
Sbjct  146  P  146



>gb|KJB60758.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=392

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            V  V    +I   Q CP  YVD+ PC+D +      R+   YRERHCP   E   CL+P 
Sbjct  72   VGNVGESEKIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCPREEEKLHCLVPA  131

Query  640  P  642
            P
Sbjct  132  P  132



>ref|NP_001063174.1| Os09g0415700 [Oryza sativa Japonica Group]
 dbj|BAD28913.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAD29253.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 dbj|BAF25088.1| Os09g0415700 [Oryza sativa Japonica Group]
 gb|EAZ44732.1| hypothetical protein OsJ_29364 [Oryza sativa Japonica Group]
Length=616

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 31/59 (53%), Gaps = 3/59 (5%)
 Frame = +1

Query  466  LVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            LV   ++  P   CP  Y D+ PC+D     +  RE   YRERHCP   E   CLIPPP
Sbjct  76   LVSPAKKFKP---CPDRYTDYTPCQDQNRAMKFPRENMNYRERHCPPQKEKLHCLIPPP  131



>ref|XP_009133584.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT19 
[Brassica rapa]
Length=602

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 31/48 (65%), Gaps = 2/48 (4%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCP-LPHETPI-CLIPPP  642
            CP ++ +++PC DP    Q S E +Y RERHCP L HE  + CL+P P
Sbjct  92   CPKNFTNYLPCHDPSTARQYSIERHYRRERHCPDLSHEKKLRCLVPKP  139



>gb|KJB60755.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=514

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            V  V    +I   Q CP  YVD+ PC+D +      R+   YRERHCP   E   CL+P 
Sbjct  72   VGNVGESEKIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCPREEEKLHCLVPA  131

Query  640  P  642
            P
Sbjct  132  P  132



>gb|KHG10506.1| hypothetical protein F383_11349 [Gossypium arboreum]
Length=616

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            V  V    +I   Q CP  YVD+ PC+D +      R+   YRERHCP   E   CL+P 
Sbjct  72   VGNVGESEKIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCPREEEKLHCLVPA  131

Query  640  P  642
            P
Sbjct  132  P  132



>gb|KJB60756.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=540

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            V  V    +I   Q CP  YVD+ PC+D +      R+   YRERHCP   E   CL+P 
Sbjct  72   VGNVGESEKIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCPREEEKLHCLVPA  131

Query  640  P  642
            P
Sbjct  132  P  132



>gb|KJB24074.1| hypothetical protein B456_004G127200 [Gossypium raimondii]
Length=620

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  469  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            ++S + I+    C   Y ++ PC+D     +  R+M  YRERHCP   E  +CLIP P
Sbjct  85   LDSSKTISQFPPCDMAYSEYTPCQDKVRGRKFDRDMMKYRERHCPTKQEMLLCLIPAP  142



>emb|CDX98606.1| BnaA03g43910D [Brassica napus]
Length=664

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 2/79 (3%)
 Frame = +1

Query  412  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  585
            G+  L   D  +    + +V++  ++  + F  C +DY D+ PC DPR   +       +
Sbjct  104  GKNKLQVNDVAKAGSSLDVVDNSPQVKSVSFPECSSDYQDYTPCTDPRKWKKYGTHRLTF  163

Query  586  RERHCPLPHETPICLIPPP  642
             ERHCP   +   CL+PPP
Sbjct  164  MERHCPPVFDRKQCLVPPP  182



>gb|KJB60757.1| hypothetical protein B456_009G324300 [Gossypium raimondii]
Length=616

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            V  V    +I   Q CP  YVD+ PC+D +      R+   YRERHCP   E   CL+P 
Sbjct  72   VGNVGESEKIKSFQPCPPRYVDYTPCQDQKRAMTFPRDNMIYRERHCPREEEKLHCLVPA  131

Query  640  P  642
            P
Sbjct  132  P  132



>gb|KJB25151.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
 gb|KJB25152.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
 gb|KJB25153.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
 gb|KJB25154.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
Length=604

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)
 Frame = +1

Query  469  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
             E+  +I P+ F  C  DY D+ PC DPR   +       + ERHCP  +E   CL+PPP
Sbjct  65   AENALQIKPVTFSECSIDYQDYTPCTDPRRWKKYGYRRLTFLERHCPPLYERKECLVPPP  124



>ref|XP_006662118.1| PREDICTED: probable methyltransferase PMT20-like [Oryza brachyantha]
Length=609

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CPADY D+ PC DP+   +       + ERHCP P E   CL+PPP
Sbjct  87   CPADYQDYTPCTDPKRWRKYGNYRLSFMERHCPPPVERKECLVPPP  132



>emb|CDP12267.1| unnamed protein product [Coffea canephora]
Length=643

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/58 (40%), Positives = 28/58 (48%), Gaps = 0/58 (0%)
 Frame = +1

Query  469  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            V S  E      C   Y ++ PC+DP    +  R+   YRERHCP   E   CLIP P
Sbjct  105  VNSSEESQAFPPCDKSYTEYTPCQDPSRGRKFDRKFLKYRERHCPDKEELLRCLIPAP  162



>emb|CDY01583.1| BnaC07g35730D [Brassica napus]
Length=657

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 2/79 (3%)
 Frame = +1

Query  412  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  585
            G+  L   D  +    + +V++  ++  + F  C +DY D+ PC DPR   +       +
Sbjct  97   GKNKLQVNDVAKAGSSLDVVDNSPQVKSVSFPECSSDYQDYTPCTDPRKWKKYGTHRLTF  156

Query  586  RERHCPLPHETPICLIPPP  642
             ERHCP   +   CL+PPP
Sbjct  157  MERHCPPVFDRKQCLVPPP  175



>ref|XP_008356816.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=644

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y ++ PC+DP   ++ +R M   RERHCP   E   CLIP P
Sbjct  103  CDMSYSEYTPCQDPTRGNKFNRNMWKNRERHCPTQEEQLFCLIPAP  148



>gb|KDO76804.1| hypothetical protein CISIN_1g006834mg [Citrus sinensis]
Length=629

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y D  PC+DP  + +  REM  YRERHCP   E   CLIP P
Sbjct  104  CDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAP  149



>ref|XP_006476235.1| PREDICTED: probable methyltransferase PMT18-like [Citrus sinensis]
Length=629

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C   Y D  PC+DP  + +  REM  YRERHCP   E   CLIP P
Sbjct  104  CDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAP  149



>ref|XP_002467784.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
 gb|EER94782.1| hypothetical protein SORBIDRAFT_01g034010 [Sorghum bicolor]
Length=610

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = +1

Query  484  EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +I P + C   Y D+ PCE+ +      R+   YRERHCPL  E   CLIP P
Sbjct  78   KIEPFKPCDEQYTDYTPCEEQKRAMSFPRDNMIYRERHCPLDKEKLHCLIPAP  130



>ref|XP_009136994.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
 ref|XP_009136995.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
Length=601

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 2/79 (3%)
 Frame = +1

Query  412  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  585
            G+  L   D  +    + +V++  ++  + F  C +DY D+ PC DPR   +       +
Sbjct  41   GKNKLQVNDVAKAGSSLDVVDNSPQVKSVSFPECSSDYQDYTPCTDPRKWKKYGTHRLTF  100

Query  586  RERHCPLPHETPICLIPPP  642
             ERHCP   +   CL+PPP
Sbjct  101  MERHCPPVFDRKQCLVPPP  119



>ref|XP_002317981.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
 gb|EEE96201.2| hypothetical protein POPTR_0012s07080g [Populus trichocarpa]
Length=610

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  421  ALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHC  600
            ++ +  + Q+S    +++ G ++   + C   Y+D+ PC+D        R+   YRERHC
Sbjct  57   SVFNNLNYQKSGDAGMIDDGAQVKEFKPCEDKYIDYTPCQDQMRAMTFPRDNMIYRERHC  116

Query  601  PLPHETPICLIPPP  642
            P  +E   CLIP P
Sbjct  117  PPDNEKLPCLIPAP  130



>ref|XP_010234899.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Brachypodium 
distachyon]
Length=662

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/46 (46%), Positives = 27/46 (59%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            C  ++ ++ PCED +   +  REM  YRERHCP   E   CLIP P
Sbjct  135  CSLNFSEYTPCEDRKRGRRFEREMLAYRERHCPGKDEEIQCLIPAP  180



>ref|XP_006653692.1| PREDICTED: probable methyltransferase PMT15-like, partial [Oryza 
brachyantha]
Length=592

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = +1

Query  469  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            V SG+     + CPA Y ++ PCED   + +  RE   YRERHCP   E   CL+P P
Sbjct  52   VASGQVHRTYEACPAKYSEYTPCEDVERSLRFPRERLVYRERHCPSEGERLRCLVPAP  109



>gb|KFK31838.1| hypothetical protein AALP_AA6G165000 [Arabis alpina]
Length=625

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 31/61 (51%), Gaps = 0/61 (0%)
 Frame = +1

Query  460  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  639
            +   E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  78   IDFKETNQTIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPTKDELLYCLIPP  137

Query  640  P  642
            P
Sbjct  138  P  138



>ref|XP_009390921.1| PREDICTED: probable methyltransferase PMT2 [Musa acuminata subsp. 
malaccensis]
Length=617

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (52%), Gaps = 0/52 (0%)
 Frame = +1

Query  487  IAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            +   + C   Y D+ PC+D +      RE   YRERHCPL  E   CLIP P
Sbjct  81   VKTFEACHDRYTDYTPCQDQKRAMTFPRENMIYRERHCPLDKEKLYCLIPAP  132



>ref|XP_007153607.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 ref|XP_007153608.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25601.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
 gb|ESW25602.1| hypothetical protein PHAVU_003G049900g [Phaseolus vulgaris]
Length=610

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (49%), Gaps = 0/72 (0%)
 Frame = +1

Query  427  LSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  606
            LS DS     +  + E+  +    + C A Y D+ PC+D +      RE   YRERHCP 
Sbjct  61   LSFDSHHGGEVGEIDEADSKAKAFKPCAARYTDYTPCQDQKRAMTFPRENMIYRERHCPP  120

Query  607  PHETPICLIPPP  642
              E   C+IP P
Sbjct  121  EEEKFQCMIPAP  132



>gb|EAZ09099.1| hypothetical protein OsI_31366 [Oryza sativa Indica Group]
Length=616

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  505  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            CP  Y D+ PC+D     +  RE   YRERHCP   E   CLIPPP
Sbjct  86   CPDRYTDYTPCQDQNRAMKFPRENMNYRERHCPPQKEKLHCLIPPP  131



>ref|XP_006648932.1| PREDICTED: probable methyltransferase PMT15-like [Oryza brachyantha]
Length=603

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = +1

Query  499  QFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            Q CPA Y ++ PCED + + +  R+   YRERHCP   E   CL+P P
Sbjct  76   QACPAKYSEYTPCEDVKRSLRYPRDRLVYRERHCPTERERLRCLVPAP  123



>ref|XP_008796868.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
 ref|XP_008796869.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=632

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 31/59 (53%), Gaps = 0/59 (0%)
 Frame = +1

Query  466  LVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  642
            L E+   +     CP ++ ++ PC+D     +  REM  YRERHCP   E   CLIP P
Sbjct  91   LDETAATVEKFHPCPLNFSEYTPCQDRTRGRRFEREMLIYRERHCPGKEELIRCLIPAP  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375