BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035G24

Length=713
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09103.1|  unnamed protein product                                265   2e-79   Coffea canephora [robusta coffee]
ref|XP_010326175.1|  PREDICTED: serine/arginine repetitive matrix...    258   4e-78   
ref|XP_009612859.1|  PREDICTED: serine/arginine repetitive matrix...    261   2e-77   Nicotiana tomentosiformis
gb|KJB83752.1|  hypothetical protein B456_013G262700                    255   5e-77   Gossypium raimondii
ref|XP_006362050.1|  PREDICTED: serine/arginine repetitive matrix...    260   6e-77   Solanum tuberosum [potatoes]
gb|KJB83751.1|  hypothetical protein B456_013G262700                    255   1e-76   Gossypium raimondii
ref|XP_010262597.1|  PREDICTED: serine/arginine repetitive matrix...    252   7e-76   
gb|AAP06864.1|  SR-rich pre-mRNA splicing activator                     239   1e-75   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74941.1|  hypothetical protein OsI_10913                          239   2e-75   Oryza sativa Indica Group [Indian rice]
ref|NP_001049684.1|  Os03g0270200                                       238   2e-75   
ref|XP_009789294.1|  PREDICTED: serine/arginine repetitive matrix...    255   3e-75   Nicotiana sylvestris
ref|XP_010937572.1|  PREDICTED: serine/arginine repetitive matrix...    254   6e-75   
ref|XP_010262596.1|  PREDICTED: serine/arginine repetitive matrix...    254   7e-75   
ref|XP_010262593.1|  PREDICTED: serine/arginine repetitive matrix...    254   7e-75   
ref|XP_010937571.1|  PREDICTED: serine/arginine repetitive matrix...    254   7e-75   Elaeis guineensis
ref|XP_010326174.1|  PREDICTED: serine/arginine repetitive matrix...    254   7e-75   
ref|XP_004246955.1|  PREDICTED: serine/arginine repetitive matrix...    254   9e-75   Solanum lycopersicum
gb|EPS58613.1|  hypothetical protein M569_16199                         244   1e-74   Genlisea aurea
gb|KJB83748.1|  hypothetical protein B456_013G262700                    253   3e-74   Gossypium raimondii
gb|KJB83755.1|  hypothetical protein B456_013G262700                    252   3e-74   Gossypium raimondii
ref|XP_008803113.1|  PREDICTED: serine/arginine repetitive matrix...    253   3e-74   Phoenix dactylifera
ref|XP_008801619.1|  PREDICTED: serine/arginine repetitive matrix...    253   3e-74   Phoenix dactylifera
ref|XP_008801616.1|  PREDICTED: serine/arginine repetitive matrix...    253   3e-74   Phoenix dactylifera
gb|KJB83749.1|  hypothetical protein B456_013G262700                    253   3e-74   Gossypium raimondii
ref|XP_008803112.1|  PREDICTED: serine/arginine repetitive matrix...    253   3e-74   Phoenix dactylifera
gb|KDP42210.1|  hypothetical protein JCGZ_02940                         252   3e-74   Jatropha curcas
ref|XP_007016333.1|  Splicing factor PWI domain-containing protei...    253   4e-74   
gb|KHF99787.1|  Serine/arginine repetitive matrix 1                     252   4e-74   Gossypium arboreum [tree cotton]
ref|XP_010920517.1|  PREDICTED: serine/arginine repetitive matrix...    250   6e-74   
ref|XP_007016332.1|  Splicing factor PWI domain-containing protei...    252   8e-74   
ref|XP_010920514.1|  PREDICTED: serine/arginine repetitive matrix...    251   1e-73   Elaeis guineensis
ref|XP_002314154.2|  hypothetical protein POPTR_0009s04160g             249   4e-73   Populus trichocarpa [western balsam poplar]
ref|XP_004507160.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    249   7e-73   
tpg|DAA44607.1|  TPA: hypothetical protein ZEAMMB73_474732              231   1e-72   
ref|XP_006651246.1|  PREDICTED: serine/arginine repetitive matrix...    237   1e-72   
gb|AES88912.2|  SR-rich pre-mRNA splicing activator                     249   1e-72   Medicago truncatula
ref|XP_011032244.1|  PREDICTED: serine/arginine repetitive matrix...    248   1e-72   Populus euphratica
ref|XP_011032245.1|  PREDICTED: serine/arginine repetitive matrix...    248   2e-72   Populus euphratica
ref|XP_009416220.1|  PREDICTED: serine/arginine repetitive matrix...    246   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416221.1|  PREDICTED: serine/arginine repetitive matrix...    246   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011032246.1|  PREDICTED: serine/arginine repetitive matrix...    247   2e-72   Populus euphratica
gb|KEH30183.1|  SR-rich pre-mRNA splicing activator                     247   3e-72   Medicago truncatula
ref|XP_003606715.1|  Serine/arginine repetitive matrix protein          247   3e-72   
ref|XP_007132039.1|  hypothetical protein PHAVU_011G061700g             247   3e-72   Phaseolus vulgaris [French bean]
gb|EEE58772.1|  hypothetical protein OsJ_10288                          242   4e-72   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010043495.1|  PREDICTED: serine/arginine repetitive matrix...    247   4e-72   
ref|XP_010043494.1|  PREDICTED: serine/arginine repetitive matrix...    246   5e-72   
gb|KEH30184.1|  SR-rich pre-mRNA splicing activator                     246   7e-72   Medicago truncatula
ref|XP_010521878.1|  PREDICTED: serine/arginine repetitive matrix...    246   7e-72   Tarenaya hassleriana [spider flower]
ref|XP_006592181.1|  PREDICTED: serine/arginine repetitive matrix...    246   8e-72   Glycine max [soybeans]
gb|KDO66634.1|  hypothetical protein CISIN_1g003124mg                   245   1e-71   Citrus sinensis [apfelsine]
ref|XP_008222060.1|  PREDICTED: serine/arginine repetitive matrix...    245   1e-71   
ref|XP_010685690.1|  PREDICTED: serine/arginine repetitive matrix...    245   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006488383.1|  PREDICTED: serine/arginine repetitive matrix...    245   1e-71   Citrus sinensis [apfelsine]
gb|KDO66636.1|  hypothetical protein CISIN_1g003124mg                   244   2e-71   Citrus sinensis [apfelsine]
gb|KDO66630.1|  hypothetical protein CISIN_1g003124mg                   244   2e-71   Citrus sinensis [apfelsine]
ref|XP_006488382.1|  PREDICTED: serine/arginine repetitive matrix...    244   2e-71   
ref|XP_010685692.1|  PREDICTED: serine/arginine repetitive matrix...    245   2e-71   
ref|XP_004984929.1|  PREDICTED: serine/arginine repetitive matrix...    244   2e-71   Setaria italica
gb|KDO66635.1|  hypothetical protein CISIN_1g003124mg                   244   3e-71   Citrus sinensis [apfelsine]
ref|XP_006424900.1|  hypothetical protein CICLE_v10030390mg             244   4e-71   
ref|XP_009419742.1|  PREDICTED: serine/arginine repetitive matrix...    243   6e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011080706.1|  PREDICTED: serine/arginine repetitive matrix...    243   7e-71   Sesamum indicum [beniseed]
ref|XP_010106541.1|  Serine/arginine repetitive matrix protein 1        242   7e-71   
ref|XP_011080705.1|  PREDICTED: serine/arginine repetitive matrix...    243   7e-71   Sesamum indicum [beniseed]
ref|XP_011080704.1|  PREDICTED: serine/arginine repetitive matrix...    243   7e-71   Sesamum indicum [beniseed]
ref|XP_011080697.1|  PREDICTED: serine/arginine repetitive matrix...    243   7e-71   Sesamum indicum [beniseed]
ref|XP_010256831.1|  PREDICTED: serine/arginine repetitive matrix...    244   8e-71   Nelumbo nucifera [Indian lotus]
gb|KDO66637.1|  hypothetical protein CISIN_1g003124mg                   241   1e-70   Citrus sinensis [apfelsine]
ref|XP_010256833.1|  PREDICTED: serine/arginine repetitive matrix...    243   1e-70   
gb|ABF95203.1|  retrotransposon protein, putative, unclassified, ...    242   1e-70   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007208179.1|  hypothetical protein PRUPE_ppa001408mg             241   2e-70   
ref|XP_004153149.1|  PREDICTED: uncharacterized protein LOC101206654    240   1e-69   
ref|XP_008385098.1|  PREDICTED: serine/arginine repetitive matrix...    240   1e-69   
gb|KHN21923.1|  Serine/arginine repetitive matrix protein 1             240   1e-69   Glycine soja [wild soybean]
ref|XP_010228813.1|  PREDICTED: serine/arginine repetitive matrix...    235   1e-69   
ref|XP_004145330.1|  PREDICTED: uncharacterized protein LOC101207842    240   1e-69   Cucumis sativus [cucumbers]
ref|XP_006846337.1|  hypothetical protein AMTR_s00012p00256890          240   1e-69   Amborella trichopoda
ref|XP_003539073.1|  PREDICTED: serine/arginine repetitive matrix...    240   2e-69   Glycine max [soybeans]
ref|XP_008457448.1|  PREDICTED: serine/arginine repetitive matrix...    239   2e-69   Cucumis melo [Oriental melon]
tpg|DAA44610.1|  TPA: hypothetical protein ZEAMMB73_474732              234   2e-69   
ref|XP_009364350.1|  PREDICTED: serine/arginine repetitive matrix...    238   3e-69   
ref|XP_008356772.1|  PREDICTED: serine/arginine repetitive matrix...    238   5e-69   Malus domestica [apple tree]
ref|XP_008356765.1|  PREDICTED: serine/arginine repetitive matrix...    238   5e-69   Malus domestica [apple tree]
ref|XP_008681498.1|  PREDICTED: uncharacterized protein LOC100304...    238   7e-69   Zea mays [maize]
ref|XP_008681486.1|  PREDICTED: uncharacterized protein LOC100304...    238   7e-69   Zea mays [maize]
ref|XP_009375943.1|  PREDICTED: serine/arginine repetitive matrix...    237   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_009375945.1|  PREDICTED: serine/arginine repetitive matrix...    237   1e-68   Pyrus x bretschneideri [bai li]
ref|XP_009375946.1|  PREDICTED: serine/arginine repetitive matrix...    237   1e-68   
ref|XP_011461331.1|  PREDICTED: serine/arginine repetitive matrix...    236   3e-68   Fragaria vesca subsp. vesca
ref|XP_011461330.1|  PREDICTED: serine/arginine repetitive matrix...    236   3e-68   Fragaria vesca subsp. vesca
ref|XP_008681507.1|  PREDICTED: uncharacterized protein LOC100304...    236   4e-68   
ref|XP_008681504.1|  PREDICTED: uncharacterized protein LOC100304...    236   4e-68   
ref|XP_010228812.1|  PREDICTED: serine/arginine repetitive matrix...    235   4e-68   Brachypodium distachyon [annual false brome]
ref|NP_180484.2|  splicing factor PWI domain-containing protein         235   7e-68   Arabidopsis thaliana [mouse-ear cress]
emb|CAC03679.1|  SRM102                                                 235   8e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879206.1|  hypothetical protein ARALYDRAFT_901882             234   8e-68   Arabidopsis lyrata subsp. lyrata
gb|ABW81062.1|  proline-rich-protein                                    234   1e-67   Arabidopsis lyrata subsp. lyrata
emb|CBI16084.3|  unnamed protein product                                234   2e-67   Vitis vinifera
ref|XP_011035262.1|  PREDICTED: serine/arginine repetitive matrix...    233   2e-67   Populus euphratica
ref|XP_002280607.2|  PREDICTED: serine/arginine repetitive matrix...    234   2e-67   Vitis vinifera
ref|XP_011035261.1|  PREDICTED: serine/arginine repetitive matrix...    233   2e-67   Populus euphratica
ref|XP_011035260.1|  PREDICTED: serine/arginine repetitive matrix...    233   2e-67   Populus euphratica
ref|XP_011035259.1|  PREDICTED: serine/arginine repetitive matrix...    233   3e-67   Populus euphratica
gb|ABW81077.1|  Prp9                                                    233   3e-67   Tarenaya spinosa
ref|XP_006409968.1|  hypothetical protein EUTSA_v10016250mg             232   8e-67   Eutrema salsugineum [saltwater cress]
ref|XP_001762564.1|  predicted protein                                  215   1e-66   
ref|XP_002299851.2|  hypothetical protein POPTR_0001s25140g             231   2e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010510519.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    230   3e-66   
gb|ABW81113.1|  proline-rich protein                                    230   3e-66   Boechera divaricarpa
ref|XP_010469978.1|  PREDICTED: serine/arginine repetitive matrix...    229   7e-66   Camelina sativa [gold-of-pleasure]
gb|KHN32153.1|  Serine/arginine repetitive matrix protein 1             229   1e-65   Glycine soja [wild soybean]
ref|XP_006293680.1|  hypothetical protein CARUB_v10022637mg             227   3e-65   Capsella rubella
ref|XP_002520517.1|  copper ion binding protein, putative               227   4e-65   
ref|XP_001774764.1|  predicted protein                                  212   4e-65   
gb|AAC95214.1|  putative proline-rich protein                           219   5e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EMS59731.1|  Serine/arginine repetitive matrix protein 1             218   8e-62   Triticum urartu
ref|XP_009144394.1|  PREDICTED: serine/arginine repetitive matrix...    218   9e-62   Brassica rapa
emb|CDY65665.1|  BnaC04g54780D                                          217   2e-61   Brassica napus [oilseed rape]
ref|XP_002973816.1|  hypothetical protein SELMODRAFT_100233             197   6e-59   
gb|KJB83750.1|  hypothetical protein B456_013G262700                    174   3e-46   Gossypium raimondii
gb|EPB85601.1|  hypothetical protein HMPREF1544_07594                   161   2e-45   Mucor circinelloides f. circinelloides 1006PhL
gb|KDO66638.1|  hypothetical protein CISIN_1g003124mg                   170   5e-45   Citrus sinensis [apfelsine]
emb|CDS13551.1|  hypothetical protein LRAMOSA05727                      164   1e-44   Lichtheimia ramosa
emb|CDH50351.1|  pwi domain-containing protein                          163   2e-44   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEG73501.1|  Putative PWI domain-containing protein                 158   1e-43   Rhizopus microsporus
dbj|GAN09279.1|  PWI domain-containing protein                          159   1e-43   Mucor ambiguus
ref|XP_006409967.1|  hypothetical protein EUTSA_v10016250mg             162   5e-42   Eutrema salsugineum [saltwater cress]
gb|KDQ07409.1|  hypothetical protein BOTBODRAFT_120067                  149   6e-41   Botryobasidium botryosum FD-172 SS1
emb|CEP13732.1|  hypothetical protein                                   151   8e-41   Parasitella parasitica
emb|CDH50352.1|  pwi domain-containing protein                          152   3e-40   Lichtheimia corymbifera JMRC:FSU:9682
gb|KDD75666.1|  hypothetical protein H632_c561p1                        145   6e-40   Helicosporidium sp. ATCC 50920
ref|XP_005988814.1|  PREDICTED: serine/arginine repetitive matrix...    155   2e-39   Latimeria chalumnae
ref|XP_005988815.1|  PREDICTED: serine/arginine repetitive matrix...    155   2e-39   
gb|KDQ31993.1|  hypothetical protein PLEOSDRAFT_1025753                 141   3e-38   Pleurotus ostreatus PC15
gb|KIJ61599.1|  hypothetical protein HYDPIDRAFT_137559                  145   5e-38   Hydnomerulius pinastri MD-312
gb|KII87767.1|  hypothetical protein PLICRDRAFT_112049                  145   9e-38   Plicaturopsis crispa FD-325 SS-3
ref|XP_009549905.1|  hypothetical protein HETIRDRAFT_243565             139   1e-37   Heterobasidion irregulare TC 32-1
emb|CCO26855.1|  PWI domain-containing protein C825,05c                 143   2e-37   Rhizoctonia solani AG-1 IB
gb|KIM46751.1|  hypothetical protein M413DRAFT_40460                    139   3e-37   Hebeloma cylindrosporum h7
gb|KIO25371.1|  hypothetical protein M407DRAFT_25274                    145   3e-37   Tulasnella calospora MUT 4182
ref|XP_007366678.1|  PWI domain-containing protein                      140   3e-37   Dichomitus squalens LYAD-421 SS1
gb|KIM70671.1|  hypothetical protein SCLCIDRAFT_76017                   137   8e-37   Scleroderma citrinum Foug A
gb|AHH81768.1|  serine/arginine repetitive matrix protein 1-like ...    142   1e-36   Biomphalaria glabrata [bloodfluke planorb]
ref|XP_008041955.1|  PWI domain-containing protein                      140   2e-36   Trametes versicolor FP-101664 SS1
gb|KIK68799.1|  hypothetical protein GYMLUDRAFT_68631                   143   3e-36   Gymnopus luxurians FD-317 M1
ref|XP_004341588.1|  PWI domain containing protein                      143   4e-36   Acanthamoeba castellanii str. Neff
ref|XP_002124610.1|  PREDICTED: serine/arginine repetitive matrix...    137   4e-36   
gb|KIK98909.1|  hypothetical protein PAXRUDRAFT_618522                  138   4e-36   Paxillus rubicundulus Ve08.2h10
ref|XP_002124674.1|  PREDICTED: serine/arginine repetitive matrix...    138   5e-36   
ref|XP_005988816.1|  PREDICTED: serine/arginine repetitive matrix...    145   6e-36   Latimeria chalumnae
ref|XP_005988813.1|  PREDICTED: serine/arginine repetitive matrix...    145   7e-36   Latimeria chalumnae
ref|NP_998607.1|  serine/arginine repetitive matrix protein 1           145   7e-36   
ref|XP_005158559.1|  PREDICTED: serine/arginine repetitive matrix...    145   7e-36   
ref|XP_004592301.1|  PREDICTED: serine/arginine repetitive matrix...    145   1e-35   Ochotona princeps [southern American pika]
emb|CAJ83937.1|  serine/arginine repetitive matrix 1                    144   1e-35   Xenopus tropicalis [western clawed frog]
ref|XP_004592300.1|  PREDICTED: serine/arginine repetitive matrix...    145   1e-35   Ochotona princeps [southern American pika]
ref|XP_004592299.1|  PREDICTED: serine/arginine repetitive matrix...    145   1e-35   Ochotona princeps [southern American pika]
ref|XP_004592298.1|  PREDICTED: serine/arginine repetitive matrix...    145   1e-35   Ochotona princeps [southern American pika]
ref|XP_007852080.1|  hypothetical protein Moror_3102                    142   1e-35   
ref|NP_001005645.1|  serine/arginine repetitive matrix 1                144   1e-35   Xenopus tropicalis [western clawed frog]
gb|ELU41649.1|  SR-rich pre-mRNA splicing activator                     141   1e-35   Rhizoctonia solani AG-1 IA
ref|XP_008531009.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Equus przewalskii [Przewalski horse]
gb|KIK21297.1|  hypothetical protein PISMIDRAFT_66449                   134   2e-35   Pisolithus microcarpus 441
emb|CDO71127.1|  hypothetical protein BN946_scf184844.g131              139   2e-35   Trametes cinnabarina
ref|XP_004394850.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
emb|CEL57689.1|  protein phosphatase 2 (formerly 2A), regulatory ...    144   2e-35   Rhizoctonia solani AG-1 IB
ref|XP_007257645.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
gb|AAH77771.1|  LOC445881 protein                                       143   2e-35   Xenopus laevis [clawed frog]
ref|XP_010593393.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_009200134.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Papio anubis [baboon]
ref|XP_005544476.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Macaca fascicularis [crab eating macaque]
ref|XP_004425801.1|  PREDICTED: uncharacterized protein LOC101387...    144   2e-35   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005875245.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_011282836.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_003482044.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_010828370.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Bison bison bison
ref|XP_006777594.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Myotis davidii
ref|XP_006159462.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Tupaia chinensis
ref|XP_008961405.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Pan paniscus [bonobo]
ref|XP_008060364.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Carlito syrichta
ref|XP_005245779.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_007257644.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_008263885.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008998899.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Callithrix jacchus [common marmoset]
ref|XP_011355920.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Pteropus vampyrus
ref|XP_005617847.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
ref|XP_008820511.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   Nannospalax galili
ref|XP_006539093.1|  PREDICTED: serine/arginine repetitive matrix...    144   2e-35   
gb|AAH36187.1|  Serine/arginine repetitive matrix 1                     144   2e-35   Homo sapiens [man]
gb|EMS22473.1|  SR-rich pre-mRNA splicing activator                     140   2e-35   Rhodotorula toruloides NP11
ref|XP_006631428.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-35   Lepisosteus oculatus
gb|EXX63474.1|  hypothetical protein RirG_151940                        139   3e-35   Rhizophagus irregularis DAOM 197198w
ref|XP_004465432.1|  PREDICTED: serine/arginine repetitive matrix...    144   3e-35   Dasypus novemcinctus
gb|EUC66839.1|  serine/arginine repetitive matrix-like protein, p...    140   3e-35   Rhizoctonia solani AG-3 Rhs1AP
gb|KIO14306.1|  hypothetical protein M404DRAFT_992582                   140   4e-35   Pisolithus tinctorius Marx 270
ref|NP_001086440.1|  serine/arginine repetitive matrix 1                143   4e-35   Xenopus laevis [clawed frog]
gb|KIP02407.1|  hypothetical protein PHLGIDRAFT_112065                  135   4e-35   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_010877536.1|  PREDICTED: serine/arginine repetitive matrix...    142   6e-35   
ref|XP_010824971.1|  PREDICTED: serine/arginine repetitive matrix...    142   6e-35   
ref|XP_010877535.1|  PREDICTED: serine/arginine repetitive matrix...    142   6e-35   Esox lucius
ref|XP_007491381.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   
ref|XP_007491380.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_001362878.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_007491379.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_007491378.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_007491377.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_007491376.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_007491375.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
ref|XP_001362791.1|  PREDICTED: serine/arginine repetitive matrix...    143   6e-35   Monodelphis domestica
dbj|BAB25575.1|  unnamed protein product                                136   7e-35   Mus musculus [mouse]
gb|EPT02135.1|  hypothetical protein FOMPIDRAFT_1048148                 138   7e-35   Fomitopsis pinicola FP-58527 SS1
ref|NP_001131046.1|  serine/arginine repetitive matrix 1                142   7e-35   Xenopus laevis [clawed frog]
gb|AAI08753.1|  LOC494754 protein                                       142   8e-35   Xenopus laevis [clawed frog]
gb|AAI30177.1|  LOC494754 protein                                       142   8e-35   Xenopus laevis [clawed frog]
ref|XP_007771072.1|  PWI domain-containing protein                      132   8e-35   Coniophora puteana RWD-64-598 SS2
gb|AAH97656.1|  LOC494754 protein                                       142   8e-35   Xenopus laevis [clawed frog]
gb|EDL29987.1|  serine/arginine repetitive matrix 1, isoform CRA_c      142   8e-35   Mus musculus [mouse]
gb|EDL29988.1|  serine/arginine repetitive matrix 1, isoform CRA_d      142   8e-35   Mus musculus [mouse]
ref|XP_008313300.1|  PREDICTED: serine/arginine repetitive matrix...    142   8e-35   Cynoglossus semilaevis [half-smooth tongue sole]
gb|AAP97290.1|AF419855_1  Ser/Arg-related nuclear matrix protein        142   8e-35   Homo sapiens [man]
ref|XP_007424155.1|  PREDICTED: serine/arginine repetitive matrix...    142   8e-35   
emb|CDQ74671.1|  unnamed protein product                                142   8e-35   Oncorhynchus mykiss
ref|XP_008313453.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-35   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010343877.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-35   Saimiri boliviensis boliviensis
ref|XP_005101380.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-35   Aplysia californica
ref|XP_006539094.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-35   
gb|ACN11002.1|  Serine/arginine repetitive matrix protein 1             142   9e-35   Salmo salar
ref|XP_007869448.1|  PWI domain-containing protein                      136   9e-35   Gloeophyllum trabeum ATCC 11539
emb|CDQ64409.1|  unnamed protein product                                142   9e-35   Oncorhynchus mykiss
ref|XP_007121183.1|  PREDICTED: serine/arginine repetitive matrix...    142   9e-35   
ref|XP_005665165.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007121182.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Physeter catodon
ref|XP_005353112.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
gb|AAC17422.1|  plenty-of-prolines-101                                  142   1e-34   Mus musculus [mouse]
gb|EDL29985.1|  serine/arginine repetitive matrix 1, isoform CRA_a      142   1e-34   Mus musculus [mouse]
ref|XP_005544475.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Macaca fascicularis [crab eating macaque]
ref|XP_009200129.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Papio anubis [baboon]
ref|XP_007978194.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Chlorocebus sabaeus
ref|XP_005245778.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665163.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010354028.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Rhinopithecus roxellana
ref|XP_006539092.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Mus musculus [mouse]
ref|XP_004850657.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Heterocephalus glaber [naked mole rat]
ref|XP_004465431.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010354027.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Rhinopithecus roxellana
ref|XP_003891388.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Papio anubis [baboon]
ref|XP_006975730.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Peromyscus maniculatus bairdii
ref|XP_006539091.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005079657.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005665162.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006539090.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004465430.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006777593.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005875244.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004465429.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Dasypus novemcinctus
ref|XP_008820510.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Nannospalax galili
ref|XP_005977453.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006777592.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Myotis davidii
ref|XP_006104159.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    142   1e-34   
ref|XP_005875243.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Myotis brandtii
ref|XP_005394872.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Chinchilla lanigera
ref|XP_004657568.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006196850.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Vicugna pacos
ref|XP_008961404.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Pan paniscus [bonobo]
ref|XP_003415444.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Loxodonta africana [African bush elephant]
ref|XP_007522639.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Erinaceus europaeus [common hedgehog]
ref|XP_008531008.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Equus przewalskii [Przewalski horse]
ref|XP_006078051.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004377162.1|  PREDICTED: uncharacterized protein LOC101351...    142   1e-34   
ref|XP_009449174.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005544474.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Macaca fascicularis [crab eating macaque]
ref|XP_004657567.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Jaculus jaculus
ref|XP_006239247.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Rattus norvegicus [brown rat]
ref|XP_005353111.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Microtus ochrogaster [prairie voles]
ref|XP_004465428.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Dasypus novemcinctus
ref|XP_005544473.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Macaca fascicularis [crab eating macaque]
ref|NP_005830.2|  serine/arginine repetitive matrix protein 1 iso...    142   1e-34   Homo sapiens [man]
ref|XP_003810827.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   Pan paniscus [bonobo]
ref|XP_001106234.2|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|NP_001101456.2|  serine/arginine repetitive matrix protein 1        142   1e-34   
ref|XP_005353110.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010828369.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008531007.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008146299.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006078050.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_002716019.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005079656.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008998898.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007121181.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|NP_001123949.1|  serine/arginine repetitive matrix protein 1 ...    142   1e-34   
ref|XP_010593392.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006862350.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005353109.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010593391.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010354026.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008961403.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005544472.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005245777.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011282835.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_002750477.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007121180.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010593390.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010354025.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007978191.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
dbj|BAH13726.1|  unnamed protein product                                142   1e-34   
ref|NP_001290377.1|  serine/arginine repetitive matrix protein 1 ...    142   1e-34   
ref|XP_004603508.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004465426.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_003891389.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_003810828.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_001106172.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004850656.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010632010.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_001252332.2|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008820509.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005353108.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010354024.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005544471.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004465425.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008146298.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004850655.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006862351.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011248603.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008820508.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006975729.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006539089.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005079655.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004783474.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004741210.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010354022.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_009200124.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004603507.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005394871.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007933924.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006239246.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004850654.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|NP_058079.2|  serine/arginine repetitive matrix protein 1 iso...    142   1e-34   
ref|XP_004377161.1|  PREDICTED: uncharacterized protein LOC101351...    142   1e-34   
ref|XP_008998897.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008146297.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011355919.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_852745.1|  PREDICTED: serine/arginine repetitive matrix pr...    142   1e-34   
ref|XP_005317676.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004603509.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_003799816.1|  PREDICTED: uncharacterized protein LOC100961...    142   1e-34   
ref|XP_007121179.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004465427.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004657566.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006196849.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010828368.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010632001.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006078049.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006777591.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005394870.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005197655.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
gb|EHH49656.1|  hypothetical protein EGM_00354                          142   1e-34   
ref|XP_011282834.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665161.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011226923.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    142   1e-34   
ref|XP_007522638.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007121178.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010631995.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010631984.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006078048.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006777590.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005197654.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011282833.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665160.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004425800.1|  PREDICTED: uncharacterized protein LOC101387...    142   1e-34   
ref|XP_006196848.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010828366.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_010631979.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006078047.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006777589.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006159461.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005875242.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005394869.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004657565.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005197653.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011282832.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665159.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_003127751.3|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011355917.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008060363.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006862349.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006159460.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_003799817.1|  PREDICTED: uncharacterized protein LOC100961...    142   1e-34   
ref|XP_006239245.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008961402.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008263884.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006159459.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005245775.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004657564.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|NP_001126712.1|  serine/arginine repetitive matrix protein 1        142   1e-34   
ref|XP_008531006.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_006239244.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008961401.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008263883.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008060362.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005544470.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005245774.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008531005.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008531004.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008263882.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008531003.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008998896.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008998895.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004741209.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005317675.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008998894.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004741208.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004741207.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005617846.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005317674.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
sp|Q52KI8.2|SRRM1_MOUSE  RecName: Full=Serine/arginine repetitive...    142   1e-34   
gb|EAW95140.1|  serine/arginine repetitive matrix 1, isoform CRA_c      142   1e-34   
ref|XP_011355916.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005617845.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_011355915.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005617844.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005317673.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665158.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004425799.1|  PREDICTED: uncharacterized protein LOC101387...    142   1e-34   
ref|XP_005665157.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665156.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005665155.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
gb|AAH94322.1|  Srrm1 protein                                           142   1e-34   
gb|EPQ13299.1|  Serine/arginine repetitive matrix protein 1             142   1e-34   
gb|KFO37728.1|  Serine/arginine repetitive matrix protein 1             142   1e-34   
ref|XP_004678682.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|NP_001026665.1|  serine/arginine repetitive matrix protein 1        142   1e-34   
ref|XP_004678681.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004678680.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005529770.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_004678679.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005922372.1|  PREDICTED: serine/arginine repetitive matrix...    141   1e-34   
ref|XP_007424152.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_007270525.1|  hypothetical protein FOMMEDRAFT_136573             139   1e-34   
ref|XP_008169224.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_008573198.1|  PREDICTED: serine/arginine repetitive matrix...    142   1e-34   
ref|XP_005761923.1|  hypothetical protein EMIHUDRAFT_58282              132   2e-34   
ref|XP_007424150.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-34   
ref|XP_003227241.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-34   
ref|XP_007424151.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-34   
ref|XP_003446232.2|  PREDICTED: serine/arginine repetitive matrix...    142   2e-34   
ref|XP_006800709.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_005922371.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_005739009.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_004566623.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_008573197.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-34   
ref|XP_008118563.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_008573196.1|  PREDICTED: serine/arginine repetitive matrix...    142   2e-34   
ref|XP_008282434.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_008282436.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_010729605.1|  PREDICTED: serine/arginine repetitive matrix...    141   2e-34   
ref|XP_011060800.1|  PREDICTED: serine/arginine repetitive matrix...    131   2e-34   
gb|EIE88227.1|  hypothetical protein RO3G_12938                         141   2e-34   
ref|XP_007301834.1|  hypothetical protein STEHIDRAFT_154602             138   2e-34   
gb|ERZ98846.1|  hypothetical protein GLOINDRAFT_70246                   131   3e-34   
gb|KJA25476.1|  hypothetical protein HYPSUDRAFT_64668                   138   3e-34   
gb|KDR80213.1|  hypothetical protein GALMADRAFT_242506                  138   3e-34   
gb|KIK37574.1|  hypothetical protein CY34DRAFT_451867                   134   3e-34   
ref|XP_006752139.1|  PREDICTED: serine/arginine repetitive matrix...    136   4e-34   
ref|XP_011488896.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_007574465.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_007574450.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_007574456.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_005799191.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_007574441.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_005799192.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_008397816.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_008397817.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
ref|XP_008397815.1|  PREDICTED: serine/arginine repetitive matrix...    140   5e-34   
gb|KIM86657.1|  hypothetical protein PILCRDRAFT_311079                  137   6e-34   
gb|KIY47475.1|  PWI domain-containing protein                           130   6e-34   
gb|ADX97057.1|  serine/arginine repetitive matrix protein 1             129   6e-34   
gb|KIJ11168.1|  hypothetical protein PAXINDRAFT_15897                   137   8e-34   
ref|XP_006463501.1|  hypothetical protein AGABI2DRAFT_194307            137   8e-34   
gb|AAL89660.1|AF411956_1  SRm160/300 splicing coactivator               130   1e-33   
gb|EMD35594.1|  hypothetical protein CERSUDRAFT_85538                   135   1e-33   
ref|XP_009046201.1|  hypothetical protein LOTGIDRAFT_137917             129   1e-33   
gb|ETS63133.1|  hypothetical protein PaG_02911                          134   1e-33   
ref|XP_007334057.1|  hypothetical protein AGABI1DRAFT_116472            136   1e-33   
dbj|GAA99222.1|  hypothetical protein E5Q_05915                         136   1e-33   
gb|KIJ98811.1|  hypothetical protein K443DRAFT_195324                   135   2e-33   
ref|XP_007392708.1|  hypothetical protein PHACADRAFT_26227              135   3e-33   
dbj|BAK63562.1|  serine/arginine repetitive matrix protein 1            135   3e-33   
ref|XP_006800707.1|  PREDICTED: serine/arginine repetitive matrix...    138   3e-33   
gb|EDL80753.1|  serine/arginine repetitive matrix 1 (predicted), ...    135   3e-33   
dbj|GAC76886.1|  splicing coactivator SRm160/300, subunit SRm160        132   4e-33   
ref|XP_005028215.1|  PREDICTED: serine/arginine repetitive matrix...    137   4e-33   
ref|XP_003962592.1|  PREDICTED: uncharacterized protein LOC101066556    137   4e-33   
ref|XP_007346622.1|  PWI domain-containing protein                      130   5e-33   
ref|XP_004893857.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    137   8e-33   
dbj|GAK63772.1|  PWI domain-containing protein                          131   1e-32   
ref|XP_793342.2|  PREDICTED: uncharacterized protein LOC588572 is...    136   1e-32   
emb|CCM00237.1|  predicted protein                                      133   1e-32   
ref|XP_005008554.1|  PREDICTED: LOW QUALITY PROTEIN: serine/argin...    136   1e-32   
gb|KDE06621.1|  hypothetical protein MVLG_03117                         132   2e-32   



>emb|CDP09103.1| unnamed protein product [Coffea canephora]
Length=767

 Score =   265 bits (676),  Expect = 2e-79, Method: Composition-based stats.
 Identities = 143/161 (89%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMRPWIATRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFMERNTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMERNTGKFMKELWSLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEETRKKKAE+DRI NEI+R+KE+E QEL QE  K
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIRRKKEKESQELGQEGTK  161



>ref|XP_010326175.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Solanum lycopersicum]
Length=621

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFL+AKEEE R  KAE DRI NEIQ++KER+ +EL QEK+K
Sbjct  121  QFLEAKEEEMRNNKAEMDRIANEIQKKKERDNRELNQEKRK  161



>ref|XP_009612859.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
tomentosiformis]
Length=873

 Score =   261 bits (668),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 142/161 (88%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K VNGKEVQI LTGFMERNTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLERKVVNGKEVQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFL+AKEEE RKKKAETDRI NEIQ++KERE +EL+QEK+K
Sbjct  121  QFLEAKEEEMRKKKAETDRIANEIQKKKERESRELDQEKRK  161



>gb|KJB83752.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
 gb|KJB83753.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=604

 Score =   255 bits (651),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ +
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESRENEQNR  159



>ref|XP_006362050.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Solanum tuberosum]
Length=882

 Score =   260 bits (664),  Expect = 6e-77, Method: Composition-based stats.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFL+AKEEE R KKAE DRI NEIQ++KERE +EL+QEK+K
Sbjct  121  QFLEAKEEEMRNKKAEMDRIANEIQKKKERENRELDQEKRK  161



>gb|KJB83751.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=660

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ +
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESRENEQNR  159



>ref|XP_010262597.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Nelumbo nucifera]
Length=616

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLIN IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKK E DRI  EIQ++KE+E +EL+QEK
Sbjct  121  QFLDAKEEETRKKKVEADRIKLEIQKKKEKEGRELDQEK  159



>gb|AAP06864.1| SR-rich pre-mRNA splicing activator [Oryza sativa Japonica Group]
 gb|AAP06930.1| SR-rich pre-mRNA splicing activator [Oryza sativa Japonica Group]
Length=199

 Score =   239 bits (610),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKE E ++KKAE  RI  EIQ+++E++ +E E EK+K
Sbjct  121  QFLDAKEAEIQQKKAEESRIAQEIQKKREKDGREQELEKQK  161



>gb|EEC74941.1| hypothetical protein OsI_10913 [Oryza sativa Indica Group]
Length=201

 Score =   239 bits (609),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKE E ++KKAE  RI  EIQ+++E++ +E E EK+K
Sbjct  121  QFLDAKEAEIQQKKAEESRIAQEIQKKREKDGREQELEKQK  161



>ref|NP_001049684.1| Os03g0270200 [Oryza sativa Japonica Group]
 dbj|BAF11598.1| Os03g0270200 [Oryza sativa Japonica Group]
Length=186

 Score =   238 bits (608),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/177 (74%), Positives = 152/177 (86%), Gaps = 2/177 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVL  639
            QFLDAKE E ++KKAE  RI  EIQ+++E++ +E E EK+K +    S   ++H+VL
Sbjct  121  QFLDAKEAEIQQKKAEESRIAQEIQKKREKDGREQELEKQKLMIA--SPIIWVHIVL  175



>ref|XP_009789294.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Nicotiana 
sylvestris]
Length=873

 Score =   255 bits (652),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 139/161 (86%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVMKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K VNGKEVQI LTGFMERNTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLERKVVNGKEVQISLTGFMERNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
             FL+AKEEE RKKK ETDRI NEI ++KERE +EL+QEK+K
Sbjct  121  LFLEAKEEEMRKKKVETDRIANEIHKKKERESRELDQEKRK  161



>ref|XP_010937572.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Elaeis guineensis]
Length=876

 Score =   254 bits (650),  Expect = 6e-75, Method: Composition-based stats.
 Identities = 130/161 (81%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEV+INF+Y LL+ K+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVIINFVYGLLDVKEVDGKQIQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EET ++KAETDRI  EIQ+RKE+E +ELEQEK++
Sbjct  121  QFLDAKKEETDRRKAETDRIAQEIQKRKEKERRELEQEKQR  161



>ref|XP_010262596.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=850

 Score =   254 bits (649),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLIN IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEETRKKK E DRI  EIQ++KE+E +EL+QEK K
Sbjct  121  QFLDAKEEETRKKKVEADRIKLEIQKKKEKEGRELDQEKLK  161



>ref|XP_010262593.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262594.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262595.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=852

 Score =   254 bits (649),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA RVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIANRVTKLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLIN IY LL+GKDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINLIYGLLDGKDVNGKEVQIHLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEETRKKK E DRI  EIQ++KE+E +EL+QEK K
Sbjct  121  QFLDAKEEETRKKKVEADRIKLEIQKKKEKEGRELDQEKLK  161



>ref|XP_010937571.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Elaeis guineensis]
Length=911

 Score =   254 bits (650),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 130/161 (81%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVKMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEV+INF+Y LL+ K+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVIINFVYGLLDVKEVDGKQIQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EET ++KAETDRI  EIQ+RKE+E +ELEQEK++
Sbjct  121  QFLDAKKEETDRRKAETDRIAQEIQKRKEKERRELEQEKQR  161



>ref|XP_010326174.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Solanum lycopersicum]
Length=897

 Score =   254 bits (650),  Expect = 7e-75, Method: Composition-based stats.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFL+AKEEE R  KAE DRI NEIQ++KER+ +EL QEK+K
Sbjct  121  QFLEAKEEEMRNNKAEMDRIANEIQKKKERDNRELNQEKRK  161



>ref|XP_004246955.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Solanum lycopersicum]
Length=921

 Score =   254 bits (650),  Expect = 9e-75, Method: Composition-based stats.
 Identities = 135/161 (84%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV++PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIKPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLE K  NGKE+QI LTGFMERNT KFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYSLLERKVANGKELQISLTGFMERNTAKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFL+AKEEE R  KAE DRI NEIQ++KER+ +EL QEK+K
Sbjct  121  QFLEAKEEEMRNNKAEMDRIANEIQKKKERDNRELNQEKRK  161



>gb|EPS58613.1| hypothetical protein M569_16199, partial [Genlisea aurea]
Length=445

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY+LLEGK+VNGKE+QI LTGFMERNTGKFMKELW +LLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYTLLEGKEVNGKEIQISLTGFMERNTGKFMKELWVMLLSAQKNVSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQR  546
            QFLDAKEEETR K+AETDRI NEIQR
Sbjct  121  QFLDAKEEETRNKRAETDRIANEIQR  146



>gb|KJB83748.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=860

 Score =   253 bits (645),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ +
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESRENEQNR  159



>gb|KJB83755.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=815

 Score =   252 bits (643),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ +
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESRENEQNR  159



>ref|XP_008803113.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Phoenix dactylifera]
Length=875

 Score =   253 bits (645),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 129/163 (79%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KV+MDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVEMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            Q LDAK+EET ++KAETDRI  EIQ+RKE+  +ELEQEK++ +
Sbjct  121  QLLDAKKEETDRRKAETDRIAQEIQKRKEKVGRELEQEKQRGM  163



>ref|XP_008801619.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Phoenix dactylifera]
Length=868

 Score =   253 bits (645),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 132/161 (82%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD RFSNKQAKLLKSQKFAPEL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDARFSNKQAKLLKSQKFAPELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EET K+KAETDRI  EIQ+RKE+E +ELEQEK++
Sbjct  121  QFLDAKKEETDKRKAETDRIAQEIQQRKEKEGRELEQEKQR  161



>ref|XP_008801616.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801617.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008801618.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Phoenix dactylifera]
Length=874

 Score =   253 bits (645),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 132/161 (82%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD RFSNKQAKLLKSQKFAPEL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDARFSNKQAKLLKSQKFAPELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EET K+KAETDRI  EIQ+RKE+E +ELEQEK++
Sbjct  121  QFLDAKKEETDKRKAETDRIAQEIQQRKEKEGRELEQEKQR  161



>gb|KJB83749.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=862

 Score =   253 bits (645),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 136/159 (86%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ +
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESRENEQNR  159



>ref|XP_008803112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Phoenix dactylifera]
Length=896

 Score =   253 bits (645),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 129/163 (79%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KV+MDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMTKVEMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW+LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            Q LDAK+EET ++KAETDRI  EIQ+RKE+  +ELEQEK++ +
Sbjct  121  QLLDAKKEETDRRKAETDRIAQEIQKRKEKVGRELEQEKQRGM  163



>gb|KDP42210.1| hypothetical protein JCGZ_02940 [Jatropha curcas]
Length=870

 Score =   252 bits (644),  Expect = 3e-74, Method: Composition-based stats.
 Identities = 137/161 (85%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMRKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+VNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDAKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAQKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEETRKK+AE DRITNEIQ++KERE +EL++E+ K
Sbjct  121  QFLDAKEEETRKKQAEMDRITNEIQKKKEREGKELDRERLK  161



>ref|XP_007016333.1| Splicing factor PWI domain-containing protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY33952.1| Splicing factor PWI domain-containing protein, putative isoform 
2 [Theobroma cacao]
Length=896

 Score =   253 bits (645),  Expect = 4e-74, Method: Composition-based stats.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDMTKVEMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E  ELEQE+
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESGELEQER  159



>gb|KHF99787.1| Serine/arginine repetitive matrix 1 [Gossypium arboreum]
Length=863

 Score =   252 bits (644),  Expect = 4e-74, Method: Composition-based stats.
 Identities = 136/159 (86%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWSLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ++
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKEIRENEQDR  159



>ref|XP_010920517.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Elaeis guineensis]
Length=774

 Score =   250 bits (639),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 130/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD+RFSNKQAKLLK+QKFA EL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDSRFSNKQAKLLKTQKFASELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EET K+KAETDRI  EIQ+RKE+E +ELEQEK++
Sbjct  121  QFLDAKKEETDKRKAETDRIAQEIQKRKEKEGRELEQEKQR  161



>ref|XP_007016332.1| Splicing factor PWI domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY33951.1| Splicing factor PWI domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=943

 Score =   252 bits (644),  Expect = 8e-74, Method: Composition-based stats.
 Identities = 135/159 (85%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDMTKVEMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQRNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            QFLDAKEEETRKKKAE+DRI NEIQ++K++E  ELEQE+
Sbjct  121  QFLDAKEEETRKKKAESDRIANEIQKKKDKESGELEQER  159



>ref|XP_010920514.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010920515.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Elaeis guineensis]
Length=876

 Score =   251 bits (641),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 130/161 (81%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQD+RFSNKQAKLLK+QKFA EL+H+VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDSRFSNKQAKLLKTQKFASELDHVVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGFME+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQMQIQLTGFMEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EET K+KAETDRI  EIQ+RKE+E +ELEQEK++
Sbjct  121  QFLDAKKEETDKRKAETDRIAQEIQKRKEKEGRELEQEKQR  161



>ref|XP_002314154.2| hypothetical protein POPTR_0009s04160g [Populus trichocarpa]
 gb|EEE88109.2| hypothetical protein POPTR_0009s04160g [Populus trichocarpa]
Length=882

 Score =   249 bits (637),  Expect = 4e-73, Method: Composition-based stats.
 Identities = 135/168 (80%), Positives = 152/168 (90%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAQKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK--EREYQELEQEKKKAVSLQ  606
            QFLDAKEEETRKK+AE DRI NEIQ++K  E+E +ELE+EK K + ++
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKKEIEKEMRELEREKLKKMDIE  168



>ref|XP_004507160.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1-like [Cicer arietinum]
Length=870

 Score =   249 bits (635),  Expect = 7e-73, Method: Composition-based stats.
 Identities = 131/163 (80%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV M++MRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMEIMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+SLL+ K VNGKEVQIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHSLLDAKIVNGKEVQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLDAKEEE  KKKAE+DRIT+EIQR+KE+E +E+ +E+ K +
Sbjct  121  QFLDAKEEELLKKKAESDRITSEIQRKKEKESKEIMEERLKKL  163



>tpg|DAA44607.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=173

 Score =   231 bits (588),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKA-VSLQFSM  615
            QFLD KE E ++KKAE DRI  EIQ+++E E  + E  K K  VS  F +
Sbjct  121  QFLDEKEAEIQQKKAEDDRIAQEIQKKREMEENDSELVKNKVMVSYSFQL  170



>ref|XP_006651246.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Oryza 
brachyantha]
Length=364

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 143/161 (89%), Gaps = 2/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKERE--YQELEQEK  585
            QFLDAKE E ++KKAE  RI  EIQ+++E++   QELE +K
Sbjct  121  QFLDAKEAEIQQKKAEESRIAQEIQKKREKDGRDQELENQK  161



>gb|AES88912.2| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=911

 Score =   249 bits (635),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 130/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLDAKEEE  KKKAE+DRIT+EIQR+K++E +++ +E+ K +
Sbjct  121  QFLDAKEEELLKKKAESDRITSEIQRKKDKESKDIMEERLKKL  163



>ref|XP_011032244.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Populus euphratica]
Length=874

 Score =   248 bits (633),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK--EREYQELEQEKKKAVSLQ  606
            QFLDAKEEETRKK+AE DRI NEIQ++K  E+E +ELE+EK K + ++
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKKEIEKEMRELEREKLKKMDIE  168



>ref|XP_011032245.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Populus euphratica]
Length=856

 Score =   248 bits (632),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK--EREYQELEQEKKKAVSLQ  606
            QFLDAKEEETRKK+AE DRI NEIQ++K  E+E +ELE+EK K + ++
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKKEIEKEMRELEREKLKKMDIE  168



>ref|XP_009416220.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=785

 Score =   246 bits (629),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 126/179 (70%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFA EL+H VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAAELDHPVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVLGF  645
            QFL+AKEEE +K+K E+DRIT EIQ+RKE+E ++ EQ  K+ + ++   +   + + G+
Sbjct  121  QFLNAKEEEMKKRKVESDRITEEIQKRKEKEGRDFEQGNKRRMDVEADNSRLANAISGW  179



>ref|XP_009416221.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=780

 Score =   246 bits (628),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 126/179 (70%), Positives = 155/179 (87%), Gaps = 0/179 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLKSQKFA EL+H VDM KV+MDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKSQKFAAELDHPVDMTKVQMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVLGF  645
            QFL+AKEEE +K+K E+DRIT EIQ+RKE+E ++ EQ  K+ + ++   +   + + G+
Sbjct  121  QFLNAKEEEMKKRKVESDRITEEIQKRKEKEGRDFEQGNKRRMDVEADNSRLANAISGW  179



>ref|XP_011032246.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Populus euphratica]
Length=840

 Score =   247 bits (630),  Expect = 2e-72, Method: Composition-based stats.
 Identities = 134/168 (80%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD  K+KMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDTRKMKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK--EREYQELEQEKKKAVSLQ  606
            QFLDAKEEETRKK+AE DRI NEIQ++K  E+E +ELE+EK K + ++
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKKEIEKEMRELEREKLKKMDIE  168



>gb|KEH30183.1| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=897

 Score =   247 bits (631),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 130/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLDAKEEE  KKKAE+DRIT+EIQR+K++E +++ +E+ K +
Sbjct  121  QFLDAKEEELLKKKAESDRITSEIQRKKDKESKDIMEERLKKL  163



>ref|XP_003606715.1| Serine/arginine repetitive matrix protein [Medicago truncatula]
Length=891

 Score =   247 bits (631),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 130/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLDAKEEE  KKKAE+DRIT+EIQR+K++E +++ +E+ K +
Sbjct  121  QFLDAKEEELLKKKAESDRITSEIQRKKDKESKDIMEERLKKL  163



>ref|XP_007132039.1| hypothetical protein PHAVU_011G061700g [Phaseolus vulgaris]
 gb|ESW04033.1| hypothetical protein PHAVU_011G061700g [Phaseolus vulgaris]
Length=924

 Score =   247 bits (631),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 129/167 (77%), Positives = 151/167 (90%), Gaps = 0/167 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PW+ +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWVTRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHSLLDVKEVNGKEVQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQF  609
            QFLDAKEEE  KKKAE DRIT+EIQR+K++E +E+ +E+ K +   F
Sbjct  121  QFLDAKEEELLKKKAENDRITSEIQRKKDKEGREIMEERFKKMDGGF  167



>gb|EEE58772.1| hypothetical protein OsJ_10288 [Oryza sativa Japonica Group]
Length=595

 Score =   242 bits (618),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKE E ++KKAE  RI  EIQ+++E++ +E E EK+K
Sbjct  121  QFLDAKEAEIQQKKAEESRIAQEIQKKREKDGREQELEKQK  161



>ref|XP_010043495.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Eucalyptus grandis]
Length=877

 Score =   247 bits (630),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELE LVDM KVKMDVM+PWIA RVT L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEFLVDMTKVKMDVMKPWIATRVTGLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NTGKFMKELW+LL+SAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTGKFMKELWTLLISAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEETRKKK E D + +EI++++++E +E EQEK +
Sbjct  121  QFLDAKEEETRKKKVEADLVADEIRKKRDKESREFEQEKSE  161



>ref|XP_010043494.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Eucalyptus grandis]
 gb|KCW85510.1| hypothetical protein EUGRSUZ_B02307 [Eucalyptus grandis]
Length=878

 Score =   246 bits (629),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 129/161 (80%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELE LVDM KVKMDVM+PWIA RVT L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEFLVDMTKVKMDVMKPWIATRVTGLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NTGKFMKELW+LL+SAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTGKFMKELWTLLISAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEETRKKK E D + +EI++++++E +E EQEK +
Sbjct  121  QFLDAKEEETRKKKVEADLVADEIRKKRDKESREFEQEKSE  161



>gb|KEH30184.1| SR-rich pre-mRNA splicing activator [Medicago truncatula]
Length=845

 Score =   246 bits (627),  Expect = 7e-72, Method: Composition-based stats.
 Identities = 130/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWI ++VTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVNMDVMRPWITRKVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LLE K VNGKE+QIQ+TGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLEAKKVNGKEIQIQITGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLDAKEEE  KKKAE+DRIT+EIQR+K++E +++ +E+ K +
Sbjct  121  QFLDAKEEELLKKKAESDRITSEIQRKKDKESKDIMEERLKKL  163



>ref|XP_010521878.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Tarenaya hassleriana]
Length=907

 Score =   246 bits (629),  Expect = 7e-72, Method: Composition-based stats.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAPELEHLVDMAKVKMDVMKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NT KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTTKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKE ETRKKK E D++  EI +R+ERE +ELE +  K
Sbjct  121  QFLDAKEAETRKKKEEADQLAIEIGKRRERENKELEHDVSK  161



>ref|XP_006592181.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Glycine max]
Length=890

 Score =   246 bits (628),  Expect = 8e-72, Method: Composition-based stats.
 Identities = 128/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHSLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQF  609
            QFLDAKEEE  KKKAE+D I +EIQR+K++E +E+ +E+ K +   F
Sbjct  121  QFLDAKEEELLKKKAESDLIASEIQRKKDKEGREIMEERLKKLDGGF  167



>gb|KDO66634.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=843

 Score =   245 bits (625),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>ref|XP_008222060.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222067.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222071.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222078.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
 ref|XP_008222085.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Prunus 
mume]
Length=859

 Score =   245 bits (625),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 130/161 (81%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVD  KV M+VMRPWIAKRVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDTSKVNMEVMRPWIAKRVTDLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKEVQI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEVQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EE R KK E DR  NEIQR+K++E  E ++  KK
Sbjct  121  QFLDAKQEEARTKKEEADRFANEIQRKKDKERMEQQEILKK  161



>ref|XP_010685690.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010685691.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=888

 Score =   245 bits (626),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 1/162 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTE-L  285
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFA ELEHLVD+ KVKMDV++PWIAKRVTE L
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAAELEHLVDITKVKMDVIKPWIAKRVTEFL  60

Query  286  VGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
             G EDE+LINFIY LLEGK+VNGK+VQIQLTGFME+NTGKFMKELW+LLLSAQNNASGVP
Sbjct  61   EGFEDELLINFIYGLLEGKEVNGKQVQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QQFLDAKEEETRKKK E DRI +EIQRRKE+E +E EQEK++
Sbjct  121  QQFLDAKEEETRKKKEENDRIFDEIQRRKEKEAKESEQEKER  162



>ref|XP_006488383.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Citrus sinensis]
Length=843

 Score =   245 bits (625),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>gb|KDO66636.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=803

 Score =   244 bits (623),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>gb|KDO66630.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66631.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66632.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
 gb|KDO66633.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=846

 Score =   244 bits (624),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>ref|XP_006488382.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Citrus sinensis]
Length=846

 Score =   244 bits (624),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>ref|XP_010685692.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=874

 Score =   245 bits (625),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 136/162 (84%), Positives = 151/162 (93%), Gaps = 1/162 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTE-L  285
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFA ELEHLVD+ KVKMDV++PWIAKRVTE L
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAAELEHLVDITKVKMDVIKPWIAKRVTEFL  60

Query  286  VGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
             G EDE+LINFIY LLEGK+VNGK+VQIQLTGFME+NTGKFMKELW+LLLSAQNNASGVP
Sbjct  61   EGFEDELLINFIYGLLEGKEVNGKQVQIQLTGFMEKNTGKFMKELWALLLSAQNNASGVP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QQFLDAKEEETRKKK E DRI +EIQRRKE+E +E EQEK++
Sbjct  121  QQFLDAKEEETRKKKEENDRIFDEIQRRKEKEAKESEQEKER  162



>ref|XP_004984929.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Setaria italica]
Length=842

 Score =   244 bits (623),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVDM KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDMSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWGLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLD KE E +++KAE DRI  EIQ+++E+E  +LE EK+K
Sbjct  121  QFLDEKEAEIQQRKAEDDRIAQEIQKKREKEGIDLELEKQK  161



>gb|KDO66635.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=832

 Score =   244 bits (623),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>ref|XP_006424900.1| hypothetical protein CICLE_v10030390mg [Citrus clementina]
 gb|ESR38140.1| hypothetical protein CICLE_v10030390mg [Citrus clementina]
Length=846

 Score =   244 bits (622),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>ref|XP_009419742.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=838

 Score =   243 bits (620),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 127/170 (75%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKLLK+QKFAP L+H VD+ KVKMDV+RPWIA R TEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLLKTQKFAPVLDHPVDVTKVKMDVIRPWIATRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK V+GK++QIQLTGF+E+NTGKFMKELW LLLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGK-VDGKQIQIQLTGFLEKNTGKFMKELWGLLLSAQNNASGVPQ  119

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMT  618
            QFLDAKEEE +K+ AE++RIT EIQ+RKE+E +E EQEK+K +  +  +T
Sbjct  120  QFLDAKEEELKKRMAESERITQEIQKRKEKEGREFEQEKQKRMDAEAGIT  169



>ref|XP_011080706.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Sesamum indicum]
Length=873

 Score =   243 bits (621),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQR  546
            QFLDAKEEET+KKKAETDRI NEI R
Sbjct  121  QFLDAKEEETKKKKAETDRIANEIHR  146



>ref|XP_010106541.1| Serine/arginine repetitive matrix protein 1 [Morus notabilis]
 gb|EXC10717.1| Serine/arginine repetitive matrix protein 1 [Morus notabilis]
Length=775

 Score =   242 bits (618),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 127/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV M+V+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMTKVSMNVVRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKE  555
            QFLDAK+EETRKKK E DRI NEIQ++K+
Sbjct  121  QFLDAKQEETRKKKEEADRIANEIQKKKD  149



>ref|XP_011080705.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Sesamum indicum]
Length=877

 Score =   243 bits (621),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQR  546
            QFLDAKEEET+KKKAETDRI NEI R
Sbjct  121  QFLDAKEEETKKKKAETDRIANEIHR  146



>ref|XP_011080704.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Sesamum indicum]
Length=878

 Score =   243 bits (621),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQR  546
            QFLDAKEEET+KKKAETDRI NEI R
Sbjct  121  QFLDAKEEETKKKKAETDRIANEIHR  146



>ref|XP_011080697.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080699.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080700.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080701.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080702.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
 ref|XP_011080703.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Sesamum indicum]
Length=879

 Score =   243 bits (621),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 132/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELE+LVDM KVKMDVMRPWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELENLVDMTKVKMDVMRPWIAKRVTELI  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIYSLLEGK+VNGK+V I LTGFMERNTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYSLLEGKEVNGKQVHISLTGFMERNTGKFMKELWALLLSAQQNVSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQR  546
            QFLDAKEEET+KKKAETDRI NEI R
Sbjct  121  QFLDAKEEETKKKKAETDRIANEIHR  146



>ref|XP_010256831.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Nelumbo nucifera]
Length=925

 Score =   244 bits (622),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF+PEL+HLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFSPELDHLVDMTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GKDVNGKEVQIQLTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVNGKEVQIQLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQ  543
            QFLDAKEEETRKKKAE DRIT+EIQ
Sbjct  121  QFLDAKEEETRKKKAEADRITHEIQ  145



>gb|KDO66637.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=774

 Score =   241 bits (616),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 131/161 (81%), Positives = 146/161 (91%), Gaps = 1/161 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFA EL+HLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFASELDHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T KFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+ +
Sbjct  121  QFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKERSR  160



>ref|XP_010256833.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Nelumbo nucifera]
Length=919

 Score =   243 bits (621),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 130/145 (90%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF+PEL+HLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFSPELDHLVDMTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GKDVNGKEVQIQLTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVNGKEVQIQLTGFMEKNTGKFMKELWTLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQ  543
            QFLDAKEEETRKKKAE DRIT+EIQ
Sbjct  121  QFLDAKEEETRKKKAEADRITHEIQ  145



>gb|ABF95203.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95204.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=840

 Score =   242 bits (618),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 127/161 (79%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELEHLVDMTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKE E ++KKAE  RI  EIQ+++E++ +E E EK+K
Sbjct  121  QFLDAKEAEIQQKKAEESRIAQEIQKKREKDGREQELEKQK  161



>ref|XP_007208179.1| hypothetical protein PRUPE_ppa001408mg [Prunus persica]
 gb|EMJ09378.1| hypothetical protein PRUPE_ppa001408mg [Prunus persica]
Length=836

 Score =   241 bits (616),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 128/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVD+ KV M+VM PWIAKRVT+L+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDISKVNMEVMHPWIAKRVTDLL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKEVQI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEVQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EE R KK E DR  NEIQR+K++E  + ++  KK
Sbjct  121  QFLDAKQEEARTKKEEADRFANEIQRKKDKERMDQQEILKK  161



>ref|XP_004153149.1| PREDICTED: uncharacterized protein LOC101206654 [Cucumis sativus]
 ref|XP_004163809.1| PREDICTED: uncharacterized protein LOC101225621 [Cucumis sativus]
Length=899

 Score =   240 bits (613),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKKAETD + NEIQ+++E+E +E+E+++ K
Sbjct  121  QFLDAKEEEIRKKKAETDFLANEIQKKREKENREIEEQRSK  161



>ref|XP_008385098.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Malus 
domestica]
Length=876

 Score =   240 bits (612),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 129/161 (80%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EE RKKK E DR  +EIQR+KE+E  + ++  KK
Sbjct  121  QFLDAKQEEARKKKEEADRFASEIQRKKEKERIDQQEILKK  161



>gb|KHN21923.1| Serine/arginine repetitive matrix protein 1 [Glycine soja]
Length=907

 Score =   240 bits (612),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQF  609
            QFLDAKEEE  KKKAE+D I +EIQR+ + E +E+ +E+ K +   F
Sbjct  121  QFLDAKEEELLKKKAESDLIASEIQRKTDNEDREIMEERLKKLDGGF  167



>ref|XP_010228813.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Brachypodium distachyon]
Length=586

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+V+GK +QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEVDGKHIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVLGFC  648
            QFLDAKE E +++KAE DRI  EIQ+++E++ +  E +K+K +    S   F    LG  
Sbjct  121  QFLDAKEAEIKQRKAEEDRIAQEIQKKREKDGRGTEVDKRKVMDGDTSNPRFYGDSLGSA  180

Query  649  FN  654
             N
Sbjct  181  LN  182



>ref|XP_004145330.1| PREDICTED: uncharacterized protein LOC101207842 [Cucumis sativus]
 gb|KGN65748.1| hypothetical protein Csa_1G524700 [Cucumis sativus]
Length=878

 Score =   240 bits (612),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKKAETD + NEIQ+++E+E +E+E+++ K
Sbjct  121  QFLDAKEEEIRKKKAETDFLANEIQKKREKENREIEEQRSK  161



>ref|XP_006846337.1| hypothetical protein AMTR_s00012p00256890 [Amborella trichopoda]
 gb|ERN08012.1| hypothetical protein AMTR_s00012p00256890 [Amborella trichopoda]
Length=885

 Score =   240 bits (612),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 128/163 (79%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLKSQKFA EL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKAAKLLKSQKFASELDHLVDISKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GKDV+GK++QIQLTGFME+NTGKFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKDVDGKQIQIQLTGFMEKNTGKFMKELWNLLLSAQKNISGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLDAKEEET++KKAE DRI++EI+++K+RE  E E+E+ K +
Sbjct  121  QFLDAKEEETKQKKAEADRISHEIKKKKDREEAESEKERWKKL  163



>ref|XP_003539073.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Glycine max]
Length=916

 Score =   240 bits (612),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 126/167 (75%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI+ LL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIHGLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQF  609
            QFLDAKEEE  KKKAE+D I +EIQR+ + E +E+ +E+ K +   F
Sbjct  121  QFLDAKEEELLKKKAESDLIASEIQRKTDNEDREIMEERLKKLDGGF  167



>ref|XP_008457448.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Cucumis 
melo]
Length=893

 Score =   239 bits (611),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 128/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKF  EL+ LVD  KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFPAELDQLVDTTKVKMDVIRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQIQLTGFME+NT KFMKELW LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQIQLTGFMEKNTVKFMKELWILLLSAQKNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAKEEE RKKKAETD + NEIQ+++E+E +E+E+++ K
Sbjct  121  QFLDAKEEEIRKKKAETDFLANEIQKKREKENREIEEQRSK  161



>tpg|DAA44610.1| TPA: hypothetical protein ZEAMMB73_474732, partial [Zea mays]
Length=581

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQE  582
            QFLD KE E ++KKAE DRI  EIQ  K+RE +E + E
Sbjct  121  QFLDEKEAEIQQKKAEDDRIAQEIQ--KKREMEENDSE  156



>ref|XP_009364350.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Pyrus 
x bretschneideri]
Length=838

 Score =   238 bits (608),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKERE  561
            QFLDAK+EE RKKK E DR  NEIQ++KE+E
Sbjct  120  QFLDAKQEEARKKKEEADRFANEIQKKKEKE  150



>ref|XP_008356772.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Malus domestica]
Length=829

 Score =   238 bits (606),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKERE  561
            QFLDAK+EE RKKK E DR  NEIQ++KE+E
Sbjct  120  QFLDAKQEEARKKKEEADRFANEIQKKKEKE  150



>ref|XP_008356765.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Malus domestica]
Length=830

 Score =   238 bits (606),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA R TEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMSKVSMDVMRPWIANRATELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGK-VNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  119

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKERE  561
            QFLDAK+EE RKKK E DR  NEIQ++KE+E
Sbjct  120  QFLDAKQEEARKKKEEADRFANEIQKKKEKE  150



>ref|XP_008681498.1| PREDICTED: uncharacterized protein LOC100304415 isoform X2 [Zea 
mays]
 tpg|DAA44608.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=901

 Score =   238 bits (607),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 123/163 (75%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLD KE E ++KKAE DRI  EIQ+++E E  + E  K K +
Sbjct  121  QFLDEKEAEIQQKKAEDDRIAQEIQKKREMEENDSELVKNKVM  163



>ref|XP_008681486.1| PREDICTED: uncharacterized protein LOC100304415 isoform X1 [Zea 
mays]
Length=906

 Score =   238 bits (607),  Expect = 7e-69, Method: Composition-based stats.
 Identities = 123/163 (75%), Positives = 141/163 (87%), Gaps = 0/163 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAV  597
            QFLD KE E ++KKAE DRI  EIQ+++E E  + E  K K +
Sbjct  121  QFLDEKEAEIQQKKAEDDRIAQEIQKKREMEENDSELVKNKVM  163



>ref|XP_009375943.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375944.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=851

 Score =   237 bits (605),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EE RKKK E D+  ++IQ +KE+E  + ++  KK
Sbjct  121  QFLDAKQEEARKKKEEADKFASDIQIKKEKERIDQQEILKK  161



>ref|XP_009375945.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=850

 Score =   237 bits (604),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EE RKKK E D+  ++IQ +KE+E  + ++  KK
Sbjct  121  QFLDAKQEEARKKKEEADKFASDIQIKKEKERIDQQEILKK  161



>ref|XP_009375946.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Pyrus x bretschneideri]
Length=849

 Score =   237 bits (604),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 126/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVD+ KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDITKVSMDVMRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLEGK VNGKE+QI LTGFME+NT KFMKELW+LL+SAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEGKVVNGKEIQISLTGFMEKNTVKFMKELWTLLISAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFLDAK+EE RKKK E D+  ++IQ +KE+E  + ++  KK
Sbjct  121  QFLDAKQEEARKKKEEADKFASDIQIKKEKERIDQQEILKK  161



>ref|XP_011461331.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=854

 Score =   236 bits (602),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMDVMRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+ NGKE+QI LTGFME+NT KFMKELW+ LLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEANGKEIQISLTGFMEKNTVKFMKELWTHLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKK  588
            QFLDAK+EE RKKK E D I  E QR+K++E  ELE+ KK
Sbjct  121  QFLDAKQEEARKKKEEADAI--ETQRKKDKEVLELERSKK  158



>ref|XP_011461330.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=855

 Score =   236 bits (602),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 128/160 (80%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMDVMRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+ NGKE+QI LTGFME+NT KFMKELW+ LLSAQNNASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEANGKEIQISLTGFMEKNTVKFMKELWTHLLSAQNNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKK  588
            QFLDAK+EE RKKK E D I  E QR+K++E  ELE+ KK
Sbjct  121  QFLDAKQEEARKKKEEADAI--ETQRKKDKEVLELERSKK  158



>ref|XP_008681507.1| PREDICTED: uncharacterized protein LOC100304415 isoform X4 [Zea 
mays]
 tpg|DAA44609.1| TPA: hypothetical protein ZEAMMB73_474732 [Zea mays]
Length=895

 Score =   236 bits (602),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELE  576
            QFLD KE E ++KKAE DRI  EIQ+++E E  + E
Sbjct  121  QFLDEKEAEIQQKKAEDDRIAQEIQKKREMEENDSE  156



>ref|XP_008681504.1| PREDICTED: uncharacterized protein LOC100304415 isoform X3 [Zea 
mays]
Length=900

 Score =   236 bits (602),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLK+QKFAPEL+HLVD  KVKMDVM+PWIAKRVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKTQKFAPELDHLVDTSKVKMDVMKPWIAKRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+ +GK++QIQLTGFME+NT KFM+ELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLEEKEADGKKIQIQLTGFMEKNTVKFMRELWTLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELE  576
            QFLD KE E ++KKAE DRI  EIQ+++E E  + E
Sbjct  121  QFLDEKEAEIQQKKAEDDRIAQEIQKKREMEENDSE  156



>ref|XP_010228812.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Brachypodium distachyon]
Length=844

 Score =   235 bits (600),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+V+GK +QIQLTGFME+NT KFMKELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDVKEVDGKHIQIQLTGFMEKNTVKFMKELWSLLLSAQQNASGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVLGFC  648
            QFLDAKE E +++KAE DRI  EIQ+++E++ +  E +K+K +    S   F    LG  
Sbjct  121  QFLDAKEAEIKQRKAEEDRIAQEIQKKREKDGRGTEVDKRKVMDGDTSNPRFYGDSLGSA  180

Query  649  FN  654
             N
Sbjct  181  LN  182



>ref|NP_180484.2| splicing factor PWI domain-containing protein [Arabidopsis thaliana]
 gb|AAM78093.1| At2g29210/F16P2.41 [Arabidopsis thaliana]
 gb|AAN18199.1| At2g29210/F16P2.41 [Arabidopsis thaliana]
 gb|AEC08223.1| serine/arginine repetitive matrix protein 1-like protein [Arabidopsis 
thaliana]
Length=878

 Score =   235 bits (599),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 119/158 (75%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            GIEDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN SGVPQ
Sbjct  61   GIEDEVLINFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQE  582
            QFLDA+  ET+KK+ E     NEI +++E + + +E +
Sbjct  121  QFLDARAAETKKKQEE----ANEIMKKREGDKKNIEHD  154



>emb|CAC03679.1| SRM102 [Arabidopsis thaliana]
Length=894

 Score =   235 bits (599),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 119/158 (75%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            GIEDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN SGVPQ
Sbjct  61   GIEDEVLINFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQE  582
            QFLDA+  ET+KK+ E     NEI +++E + + +E +
Sbjct  121  QFLDARAAETKKKQEE----ANEIMKKREGDKKNIEHD  154



>ref|XP_002879206.1| hypothetical protein ARALYDRAFT_901882 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55465.1| hypothetical protein ARALYDRAFT_901882 [Arabidopsis lyrata subsp. 
lyrata]
Length=861

 Score =   234 bits (598),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 4/162 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFL----dakeeetrkkkaetdrITNEIQRRKEREYQELEQE  582
            QFL       +++  +   + DR+ NEI+R++E E +  E +
Sbjct  121  QFLDAREAETKKKQEEAIQKADRLANEIERKREGEKKNPEHD  162



>gb|ABW81062.1| proline-rich-protein [Arabidopsis lyrata subsp. lyrata]
Length=861

 Score =   234 bits (598),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 115/162 (71%), Positives = 137/162 (85%), Gaps = 4/162 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFL----dakeeetrkkkaetdrITNEIQRRKEREYQELEQE  582
            QFL       +++  +   + DR+ NEI+R++E E +  E +
Sbjct  121  QFLDAREAETKKKQEEAIQKADRLANEIERKREGEKKNPEHD  162



>emb|CBI16084.3| unnamed protein product [Vitis vinifera]
Length=866

 Score =   234 bits (596),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDVTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ KDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDRKDVNGKEVQISLTGFMEKNTGKFMKELWALLLSAQKNASGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_011035262.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Populus euphratica]
Length=854

 Score =   233 bits (595),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 123/148 (83%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK  552
            QFLDAKEEETRKK+AE DRI NEIQ++K
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKK  148



>ref|XP_002280607.2| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Vitis vinifera]
Length=922

 Score =   234 bits (596),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 109/123 (89%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLVD+ KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVDVTKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ KDVNGKEVQI LTGFME+NTGKFMKELW+LLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDRKDVNGKEVQISLTGFMEKNTGKFMKELWALLLSAQKNASGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_011035261.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Populus euphratica]
Length=877

 Score =   233 bits (595),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 123/148 (83%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK  552
            QFLDAKEEETRKK+AE DRI NEIQ++K
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKK  148



>ref|XP_011035260.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Populus euphratica]
Length=879

 Score =   233 bits (595),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 123/148 (83%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK  552
            QFLDAKEEETRKK+AE DRI NEIQ++K
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKK  148



>ref|XP_011035259.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Populus euphratica]
Length=890

 Score =   233 bits (595),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 123/148 (83%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMD+++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTRKVKMDIIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINF+Y LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFVYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRK  552
            QFLDAKEEETRKK+AE DRI NEIQ++K
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQKKK  148



>gb|ABW81077.1| Prp9 [Cleome spinosa]
Length=919

 Score =   233 bits (595),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 123/156 (79%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +1

Query  124  FRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDE  303
            F+GTSA+QDTRFSNKQAKLLK+QKFAPELEHLVDM KVKMDVM+PWIA RVTEL+G EDE
Sbjct  31   FQGTSAEQDTRFSNKQAKLLKTQKFAPELEHLVDMAKVKMDVMKPWIANRVTELLGFEDE  90

Query  304  VLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLda  483
            VLINFIY LL+GK VNGKE+QI LTGFME+NT KFMKELW+LLLSAQ NASGVPQQFLDA
Sbjct  91   VLINFIYGLLDGKVVNGKEIQISLTGFMEKNTTKFMKELWTLLLSAQKNASGVPQQFLDA  150

Query  484  keeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            KE ETRKKK E D++  EI +R+ERE +ELE +  K
Sbjct  151  KEAETRKKKEEADQLAIEIGKRRERENKELEHDVSK  186



>ref|XP_006409968.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
 gb|ESQ51421.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
Length=831

 Score =   232 bits (591),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 120/166 (72%), Positives = 143/166 (86%), Gaps = 3/166 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LL+SAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLISAQNNSSGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQR---RKEREYQELEQEKKKAV  597
            QFLDAKE ET+KK+ E     +++     R+ERE++  EQ+  + +
Sbjct  121  QFLDAKEAETKKKQEEAYEKKDQLDETGGRREREHKSHEQDISRKI  166



>ref|XP_001762564.1| predicted protein [Physcomitrella patens]
 gb|EDQ72687.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK  KLLKSQKFAPEL+  +D  KV+MDV++PW+A RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKMKKLLKSQKFAPELDVTIDTSKVQMDVIKPWVATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY +LE K+V+GK VQIQLTGFME+NTGKFMKELWSLL+SAQ+N SG+PQ
Sbjct  61   GFEDEVLINFIYGMLEEKNVDGKHVQIQLTGFMEKNTGKFMKELWSLLMSAQSNVSGIPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVLGFC  648
            QFLD K EETR KKAE++RI  E+QR+++ +    ++ +++ VS           + G C
Sbjct  121  QFLDQKAEETRLKKAESERIAAELQRKRDLDKVAEDERQREKVSHFPRRILLTRAICGLC  180



>ref|XP_002299851.2| hypothetical protein POPTR_0001s25140g [Populus trichocarpa]
 gb|EEE84656.2| hypothetical protein POPTR_0001s25140g [Populus trichocarpa]
Length=826

 Score =   231 bits (588),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPEL+HLV+  KVKMDV++PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELDHLVNTKKVKMDVIKPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK+VNGKEVQI LTGFME+NTGKFMKELW+LLLSA  N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKEVNGKEVQISLTGFMEKNTGKFMKELWTLLLSAGKNESGVPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQ  543
            QFLDAKEEETRKK+AE DRI NEIQ
Sbjct  121  QFLDAKEEETRKKQAEVDRIANEIQ  145



>ref|XP_010510519.1| PREDICTED: LOW QUALITY PROTEIN: serine/arginine repetitive matrix 
protein 1-like [Camelina sativa]
Length=841

 Score =   230 bits (587),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 106/123 (86%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>gb|ABW81113.1| proline-rich protein [Boechera divaricarpa]
Length=883

 Score =   230 bits (587),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 106/123 (86%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_010469978.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Camelina 
sativa]
Length=842

 Score =   229 bits (584),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 105/123 (85%), Positives = 117/123 (95%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK +NGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVLNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQNNSSGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>gb|KHN32153.1| Serine/arginine repetitive matrix protein 1 [Glycine soja]
Length=952

 Score =   229 bits (584),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 121/160 (76%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +1

Query  130  GTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  309
            GTSADQDTRFSNKQAKL+KSQKFAPELEHLVDM KV M+V++PWI +RVTEL+G EDEVL
Sbjct  70   GTSADQDTRFSNKQAKLMKSQKFAPELEHLVDMTKVNMEVIKPWITRRVTELLGFEDEVL  129

Query  310  INFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLdake  489
            INFI+SLL+ K+VNGKEVQIQ+TGFME+NTGKFMKELW LLLSAQ NASGVPQQFLDAKE
Sbjct  130  INFIHSLLDAKEVNGKEVQIQITGFMEKNTGKFMKELWMLLLSAQKNASGVPQQFLDAKE  189

Query  490  eetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQF  609
            EE  KKKAE+D I +EIQR+K++E +E+ +E+ K +   F
Sbjct  190  EELLKKKAESDLIASEIQRKKDKEGREIMEERLKKLDGGF  229



>ref|XP_006293680.1| hypothetical protein CARUB_v10022637mg [Capsella rubella]
 gb|ABW81160.1| unknown [Capsella rubella]
 gb|EOA26578.1| hypothetical protein CARUB_v10022637mg [Capsella rubella]
Length=839

 Score =   227 bits (579),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 105/123 (85%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSAEQDTRFSNKQAKLMKSQKFAPELENLVDVTKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQ N+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNTGKFMKELWTLLLSAQGNSSGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_002520517.1| copper ion binding protein, putative [Ricinus communis]
 gb|EEF41930.1| copper ion binding protein, putative [Ricinus communis]
Length=860

 Score =   227 bits (579),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNKQA+LLKSQKFAPELEHLVDM KVKMDV+RPWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKQARLLKSQKFAPELEHLVDMRKVKMDVIRPWIANRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LLE K+VNGKEVQIQLTGFME+NT KFMKELW+LLLSAQ N SGVPQ
Sbjct  61   GFEDEVLINFIYGLLEAKEVNGKEVQIQLTGFMEKNTVKFMKELWALLLSAQKNESGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_001774764.1| predicted protein [Physcomitrella patens]
 gb|EDQ60435.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 146/182 (80%), Gaps = 5/182 (3%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK  KLLKSQKFAPEL+ ++D  KV+MDV++PW+A RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKMKKLLKSQKFAPELDVMIDTSKVQMDVIKPWVAIRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFI  +LE K+V+GK VQIQLTGFME+NTGKFMKELWSLL+SAQ+N SG+PQ
Sbjct  61   GFEDEVLINFINGMLEEKNVDGKHVQIQLTGFMEKNTGKFMKELWSLLISAQSNVSGIPQ  120

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQFSMTEFLHLVLGFC  648
            QFLD K EETR KK E++RI  E+QR+++ +    E+ +++ VS   S     H+++ + 
Sbjct  121  QFLDQKAEETRLKKVESERIAAELQRKRDLDKLVEEERQREKVSWFLS-----HILVTYA  175

Query  649  FN  654
             +
Sbjct  176  ID  177



>gb|AAC95214.1| putative proline-rich protein [Arabidopsis thaliana]
Length=891

 Score =   219 bits (557),  Expect = 5e-62, Method: Composition-based stats.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  130  GTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEVL  309
            GTSA+QDTRFSNKQAKL+KSQKFAPELE+LVD+ KVKMDVM+PWIA RVTEL+GIEDEVL
Sbjct  28   GTSAEQDTRFSNKQAKLMKSQKFAPELENLVDITKVKMDVMKPWIATRVTELLGIEDEVL  87

Query  310  INFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFLdake  489
            INFIY LL+GK VNGKE+QI LTGFME+NTGKFMKELW+LLLSAQNN SGVPQQFLDA+ 
Sbjct  88   INFIYGLLDGKVVNGKEIQITLTGFMEKNTGKFMKELWTLLLSAQNNPSGVPQQFLDARA  147

Query  490  eetrkkkaetdrITNEIQRRKEREYQELEQE  582
             ET+KK+ E     NEI +++E + + +E +
Sbjct  148  AETKKKQEE----ANEIMKKREGDKKNIEHD  174



>gb|EMS59731.1| Serine/arginine repetitive matrix protein 1 [Triticum urartu]
Length=915

 Score =   218 bits (555),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 102/123 (83%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTSADQDTRFSNK AKLLK+QKFA EL+H VDM KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTSADQDTRFSNKHAKLLKTQKFASELDHQVDMSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K+V+GK +QIQLTGFME+NT KFM+ELWSLLLSAQ NASGVPQ
Sbjct  61   GFEDEVLINFIYGLLDAKEVDGKYIQIQLTGFMEKNTIKFMRELWSLLLSAQQNASGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_009144394.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Brassica 
rapa]
 ref|XP_009144395.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Brassica 
rapa]
 emb|CDY45430.1| BnaA05g12710D [Brassica napus]
Length=839

 Score =   218 bits (554),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 101/123 (82%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGT+ADQDTRFSNKQAKL+KSQKFA ELE LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTTADQDTRFSNKQAKLMKSQKFASELETLVDVSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K VNGKE+QI +TGFME+NT KFMKELW+LLLSAQ+N+SGVPQ
Sbjct  61   GFEDEVLINFIYGLLDNKVVNGKEIQIAITGFMEKNTVKFMKELWTLLLSAQSNSSGVPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>emb|CDY65665.1| BnaC04g54780D [Brassica napus]
Length=817

 Score =   217 bits (552),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 100/123 (81%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGT+ADQDTRFSNKQAKL+KSQKFA ELE LVD+ KVKMDVM+PWIA RVTEL+
Sbjct  1    MSGGFFRGTTADQDTRFSNKQAKLMKSQKFASELETLVDVSKVKMDVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K VNGKE+QI +TGFME+NT KFMKELW+LLLSAQ+N+SG+PQ
Sbjct  61   GFEDEVLINFIYGLLDKKVVNGKEIQIAITGFMEKNTVKFMKELWTLLLSAQSNSSGIPQ  120

Query  469  QFL  477
            QFL
Sbjct  121  QFL  123



>ref|XP_002973816.1| hypothetical protein SELMODRAFT_100233 [Selaginella moellendorffii]
 ref|XP_002983574.1| hypothetical protein SELMODRAFT_118260 [Selaginella moellendorffii]
 gb|EFJ15475.1| hypothetical protein SELMODRAFT_118260 [Selaginella moellendorffii]
 gb|EFJ24771.1| hypothetical protein SELMODRAFT_100233 [Selaginella moellendorffii]
Length=211

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSGGFFRGTS +QDTRFSNK AKLLK+QKFA EL+  +DM KV MDVMRPWIA RVTEL+
Sbjct  1    MSGGFFRGTSTEQDTRFSNKMAKLLKTQKFASELDQPIDMSKVNMDVMRPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            G EDEVLINFIY LL+ K  +GK +QIQLTGFME+NTG+FMKELW LL SAQ+NASG+PQ
Sbjct  61   GFEDEVLINFIYGLLDVKVGDGKHIQIQLTGFMEKNTGRFMKELWGLLASAQSNASGIPQ  120

Query  469  QFL  477
              L
Sbjct  121  ALL  123



>gb|KJB83750.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
 gb|KJB83754.1| hypothetical protein B456_013G262700 [Gossypium raimondii]
Length=823

 Score =   174 bits (441),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 97/120 (81%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = +1

Query  226  MGKVKMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGK  405
            M KVKMDV+RPWIA RVTEL+G EDEVLINFIY LL+GK+VNGK+VQI LTGFME+NTGK
Sbjct  1    MTKVKMDVIRPWIATRVTELLGFEDEVLINFIYGLLDGKEVNGKQVQISLTGFMEKNTGK  60

Query  406  FMKELWSLLLSAQNNASGVPQQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            FMKELWSLLLSAQ NASGVPQQFLDAKEEETRKKKAE+DRI NEIQ++K++E +E EQ +
Sbjct  61   FMKELWSLLLSAQRNASGVPQQFLDAKEEETRKKKAESDRIANEIQKKKDKESRENEQNR  120



>gb|EPB85601.1| hypothetical protein HMPREF1544_07594 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=175

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSADQD+RFSNK+ KLLKS  F PE +  VDM KV +DV++PWI+ R+TEL+G
Sbjct  3    DAGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVDMKKVNLDVIKPWISNRITELLG  62

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQ  471
             EDEV+I++  SLLE KD + K +QI LTGF+E  T  F+ ELW+LLLSAQN+  G+P +
Sbjct  63   FEDEVVIDYTCSLLEEKDQDPKRMQINLTGFLESKTQAFLSELWNLLLSAQNSVGGIPTE  122

Query  472  F-------LdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKA  594
            F       L  K+ +  +++ + D + + I+++K  E+  L++ KK++
Sbjct  123  FIEQKKQELRRKQTQEDERRNQRDSVMDTIRQKKTEEFDALQEAKKRS  170



>gb|KDO66638.1| hypothetical protein CISIN_1g003124mg [Citrus sinensis]
Length=807

 Score =   170 bits (431),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 95/122 (78%), Positives = 108/122 (89%), Gaps = 1/122 (1%)
 Frame = +1

Query  226  MGKVKMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGK  405
            M KVKMDVM+PWIA RVTEL+G EDEVLINFIY LLEGK+VNGKEVQI LTGFME++T K
Sbjct  1    MTKVKMDVMKPWIATRVTELLGFEDEVLINFIYGLLEGKEVNGKEVQISLTGFMEKHTAK  60

Query  406  FMKELWSLLLSAQNNASGVPQQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
            FMKELW+LLLSAQ NASGVPQQFLDAKEEE RKKK E DRI NEIQ +KE+E +EL++E+
Sbjct  61   FMKELWTLLLSAQKNASGVPQQFLDAKEEEARKKKLEADRIANEIQ-KKEKESRELDKER  119

Query  586  KK  591
             +
Sbjct  120  SR  121



>emb|CDS13551.1| hypothetical protein LRAMOSA05727 [Absidia idahoensis var. thermophila]
Length=337

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+TEL+G+
Sbjct  27   AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRITELLGV  86

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDE++I+F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++ SG+P+QF
Sbjct  87   EDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVSGIPKQF  146

Query  475  L  477
            L
Sbjct  147  L  147



>emb|CDH50351.1| pwi domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=324

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+TEL+G+
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRITELLGV  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDE++I+F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++ SG+P+QF
Sbjct  64   EDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVSGIPKQF  123

Query  475  L  477
            L
Sbjct  124  L  124



>emb|CEG73501.1| Putative PWI domain-containing protein [Rhizopus microsporus]
 emb|CEI87964.1| Putative PWI domain-containing protein [Rhizopus microsporus]
Length=228

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 115/166 (69%), Gaps = 7/166 (4%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSADQD+RFSNK+ KLLK+  F PE +  VDM KV +DV+RPWIA +VTEL+G
Sbjct  3    DAGFFKGTSADQDSRFSNKEKKLLKTMSFPPEFDKKVDMKKVNLDVIRPWIANKVTELLG  62

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQ  471
             EDEV+ ++  SLLE ++++ K +QI LTGF+E N   F+KELW+LLLSAQN+  G+P  
Sbjct  63   FEDEVVADYAASLLEEENIDPKMMQINLTGFLENNAKVFVKELWNLLLSAQNSVGGIPAI  122

Query  472  F-------LdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKK  588
            F       L  K E    K+AE D +   I+RR+  E  +L++E+K
Sbjct  123  FIEQKKEELRKKREREEAKRAERDSVMETIKRRRNEEMDDLKEERK  168



>dbj|GAN09279.1| PWI domain-containing protein [Mucor ambiguus]
Length=258

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 117/167 (70%), Gaps = 7/167 (4%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD+RFSNK+ KLLKS  F  E +  VDM KV +DV++PWI+ R+TEL+G 
Sbjct  4    AGFFKGTSADQDSRFSNKEKKLLKSMSFPSEFDQKVDMKKVNLDVIKPWISNRITELLGF  63

Query  295  EDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQF  474
            EDEV+I++  SLLE KD + K +QI LTGF+E  T  F+ ELW+LLLSAQN+  G+P +F
Sbjct  64   EDEVVIDYTCSLLEEKDQDPKRMQINLTGFLESKTQAFLSELWNLLLSAQNSVGGIPTEF  123

Query  475  -------LdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKA  594
                   L  K+ +  +++ + D + + I+++K  E+  L++ KK++
Sbjct  124  IEQKKQELRRKQTQEDERRNQRDSVMDTIRQKKTEEFDALQEAKKRS  170



>ref|XP_006409967.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
 gb|ESQ51420.1| hypothetical protein EUTSA_v10016250mg [Eutrema salsugineum]
Length=804

 Score =   162 bits (410),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 86/129 (67%), Positives = 106/129 (82%), Gaps = 3/129 (2%)
 Frame = +1

Query  220  VDMGKVKMDVMRPWIAKRVTELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNT  399
            VD+ KVKMDVM+PWIA RVTEL+G EDEVLINFIY LL+GK VNGKE+QI LTGFME+NT
Sbjct  11   VDVTKVKMDVMKPWIATRVTELLGFEDEVLINFIYGLLDGKVVNGKEIQISLTGFMEKNT  70

Query  400  GKFMKELWSLLLSAQNNASGVPQQFLdakeeetrkkkaetdrITNEIQR---RKEREYQE  570
            GKFMKELW+LL+SAQNN+SGVPQQFLDAKE ET+KK+ E     +++     R+ERE++ 
Sbjct  71   GKFMKELWTLLISAQNNSSGVPQQFLDAKEAETKKKQEEAYEKKDQLDETGGRREREHKS  130

Query  571  LEQEKKKAV  597
             EQ+  + +
Sbjct  131  HEQDISRKI  139



>gb|KDQ07409.1| hypothetical protein BOTBODRAFT_120067, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=159

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTS DQD RFS+K+++LLKS KF PE +  VDM KV + VMRPWIAKRV EL+G E
Sbjct  29   GFFKGTSTDQDRRFSDKESRLLKSMKFPPEFDQKVDMRKVNLQVMRPWIAKRVVELIGFE  88

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE K     + K +QI LTGF+E  T +FM  LW+LL+SAQ++  GVPQ
Sbjct  89   DEVVVEYAMGLLEDKSKPTPDPKLMQINLTGFLESKTPEFMSSLWTLLISAQSSIGGVPQ  148

Query  469  QFL  477
            QFL
Sbjct  149  QFL  151



>emb|CEP13732.1| hypothetical protein [Parasitella parasitica]
Length=251

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 92/122 (75%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSADQD+RFSNK+ KLLK+  F  E +  VDM KV +DV++PWI+ R+TEL+G
Sbjct  3    DAGFFKGTSADQDSRFSNKEKKLLKTMTFPSEFDQKVDMKKVNLDVIKPWISNRITELLG  62

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQ  471
             EDEV+I++  SLLE KD + K +QI LTGF+E  T  F+ ELW LLLSAQN+  G+P +
Sbjct  63   FEDEVVIDYTCSLLEEKDQDPKRMQINLTGFLEGKTQAFLGELWKLLLSAQNSVGGIPVE  122

Query  472  FL  477
            F+
Sbjct  123  FI  124



>emb|CDH50352.1| pwi domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=330

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 99/127 (78%), Gaps = 6/127 (5%)
 Frame = +1

Query  115  GGFFRGT------SADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRV  276
             GFF+ +      +ADQD+RFSNK+ KLLKS  F PE +  V+M KVK+DV++PW+ +R+
Sbjct  4    AGFFKSSVLAHFLAADQDSRFSNKEKKLLKSMSFPPEFDQKVNMKKVKLDVIKPWMTQRI  63

Query  277  TELVGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNAS  456
            TEL+G+EDE++I+F + LLE KD + K +QI LTGF+E+NT +F+ ELW LLLSAQ++ S
Sbjct  64   TELLGVEDELVIDFAFGLLEEKDPDPKLMQINLTGFLEKNTQQFILELWKLLLSAQDSVS  123

Query  457  GVPQQFL  477
            G+P+QFL
Sbjct  124  GIPKQFL  130



>gb|KDD75666.1| hypothetical protein H632_c561p1 [Helicosporidium sp. ATCC 50920]
Length=141

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            MSG  FRG SA+QD RF +K+ KL+ S +F  E +  V++  V   VM+PWIA RVTEL+
Sbjct  1    MSGNGFRGVSAEQDGRFKDKERKLMASMRFPREFDTKVNLVAVNWTVMKPWIATRVTELL  60

Query  289  GIEDEVLINFIYSLLEGKD-VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            GIED+VLI +IY+ LEGK  +N +++QI LTGF+E+N   F KELWSLL+SA++N +G+P
Sbjct  61   GIEDDVLIEYIYAQLEGKQTINPRQLQINLTGFLEQNAASFCKELWSLLMSAESNGTGIP  120

Query  466  QQFL  477
            Q+FL
Sbjct  121  QRFL  124



>ref|XP_005988814.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Latimeria chalumnae]
Length=923

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_005988815.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Latimeria chalumnae]
Length=927

 Score =   155 bits (393),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>gb|KDQ31993.1| hypothetical protein PLEOSDRAFT_1025753, partial [Pleurotus ostreatus 
PC15]
Length=136

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 90/125 (72%), Gaps = 5/125 (4%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSA+QD RFS+K+ KLLKS KF PE +  VDM KV ++V+RPW+AK+VTELVG E
Sbjct  1    GFFKGTSAEQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLEVIRPWVAKKVTELVGFE  60

Query  298  DEVLINFIYSLLEGKD-----VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGV  462
            DEV++ +   LLE +       + K++QI LTGF+ ++T  FM  LW LLL AQ   SGV
Sbjct  61   DEVVVEYAMGLLEDQKQSPQFPDPKKMQINLTGFLTKDTPAFMLALWKLLLEAQEEVSGV  120

Query  463  PQQFL  477
            P+ FL
Sbjct  121  PRTFL  125



>gb|KIJ61599.1| hypothetical protein HYDPIDRAFT_137559 [Hydnomerulius pinastri 
MD-312]
Length=279

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG+
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVGL  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE  +    + K++QI LTGF+  +T  FM  LW+LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDPNHTHPDPKKMQINLTGFLTSSTPTFMTALWTLLLEAQESPAGVP  123

Query  466  QQFL  477
            + F+
Sbjct  124  KTFV  127



>gb|KII87767.1| hypothetical protein PLICRDRAFT_112049 [Plicaturopsis crispa 
FD-325 SS-3]
Length=330

 Score =   145 bits (366),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 95/138 (69%), Gaps = 5/138 (4%)
 Frame = +1

Query  79   TIRILHKP*EMS--GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVM  252
            + R  H+P   S   GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V+
Sbjct  3    SFRPTHRPPFCSPIAGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLQVI  62

Query  253  RPWIAKRVTELVGIEDEVLINFIYSLLEGK---DVNGKEVQIQLTGFMERNTGKFMKELW  423
            RPWIAK++ ELVG EDEV++ +   LLE K     + K++QI LTGF+  +T  FM  LW
Sbjct  63   RPWIAKKIIELVGFEDEVVVEYAMGLLEDKQQPTPDPKKMQINLTGFLTNSTPSFMTSLW  122

Query  424  SLLLSAQNNASGVPQQFL  477
            +LLL AQ + +GVP+ FL
Sbjct  123  NLLLEAQESEAGVPRTFL  140



>ref|XP_009549905.1| hypothetical protein HETIRDRAFT_243565, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW77888.1| hypothetical protein HETIRDRAFT_243565, partial [Heterobasidion 
irregulare TC 32-1]
Length=134

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV ++V+RPW+AK+V ELVG E
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSIKFPPEFDKKVDMRKVNIEVIRPWVAKKVVELVGFE  60

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV++ +   LLE +     + K++QI LTGF+  +T  FM  LW+LLL AQ + +G+P+
Sbjct  61   DEVVVEYAMGLLEDESQPTPDPKKMQINLTGFLTASTPAFMSALWALLLEAQESPAGIPK  120

Query  469  QFL  477
             F+
Sbjct  121  TFV  123



>emb|CCO26855.1| PWI domain-containing protein C825,05c [Rhizoctonia solani AG-1 
IB]
Length=274

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 105/154 (68%), Gaps = 2/154 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG
Sbjct  3    DAGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVELSVMRPWITKKVVELVG  62

Query  292  IEDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
             EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++ +GVP
Sbjct  63   FEDEVVVEYVMGLLEDRSKPPDPKLMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVP  122

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQ  567
              F+  K+EE R+K    +R   E +RR E + +
Sbjct  123  ASFVQEKKEELRQKHEADERAFAEARRRGEHDLR  156



>gb|KIM46751.1| hypothetical protein M413DRAFT_40460, partial [Hebeloma cylindrosporum 
h7]
Length=144

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = +1

Query  127  RGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIEDEV  306
            +GTSADQD RFS+K+ KLLKS KF PE E  VDM KV ++V+RPWIAK++TEL+G EDEV
Sbjct  1    KGTSADQDRRFSDKEVKLLKSMKFPPEFEKKVDMRKVNLNVIRPWIAKKITELIGFEDEV  60

Query  307  LINFIYSLLEGK---DVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQFL  477
            ++ +   LLE +   + + K++QI LTGF+ ++T  FM  LW LLL AQ + +GVP+ FL
Sbjct  61   VVEYAMGLLEDEQQPNPDPKKMQINLTGFLNKDTPVFMDALWKLLLEAQEDVTGVPRTFL  120



>gb|KIO25371.1| hypothetical protein M407DRAFT_25274 [Tulasnella calospora MUT 
4182]
Length=418

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 2/150 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSADQD+RFSNK  +L K  KF PE +  VDM KV++ V +PWI KRVTE++G
Sbjct  3    DAGFFKGTSADQDSRFSNKDQRLRKQIKFPPEFDQKVDMKKVELSVFKPWIYKRVTEIIG  62

Query  292  IEDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            +EDEV+I ++   LE  GK  + K++QI+LTGF+   TG+FM +LW LLLSAQ +  GVP
Sbjct  63   LEDEVVIEYVNEQLEQSGKSPDPKDIQIKLTGFLGSKTGEFMLQLWKLLLSAQVSPGGVP  122

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKE  555
             +F++AK+ E R K     R+ +E  RR++
Sbjct  123  AEFIEAKKLELRAKNEADKRVLDEASRRQQ  152



>ref|XP_007366678.1| PWI domain-containing protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60539.1| PWI domain-containing protein [Dichomitus squalens LYAD-421 SS1]
Length=215

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (70%), Gaps = 3/126 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV + V+RPWI K+V ELV
Sbjct  1    MCSGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLAVIRPWIVKKVVELV  60

Query  289  GIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASG  459
            G EDEV++ +   LLE       + + +QI LTGF+ +NT  FM  LW+LLL AQ + +G
Sbjct  61   GFEDEVVVEYAMGLLEDDSQPTPDPRRMQINLTGFLTKNTPAFMSALWNLLLEAQESPAG  120

Query  460  VPQQFL  477
            VP+ F+
Sbjct  121  VPRTFV  126



>gb|KIM70671.1| hypothetical protein SCLCIDRAFT_76017, partial [Scleroderma citrinum 
Foug A]
Length=134

 Score =   137 bits (345),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGIE  297
            GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV +++++PWIAK+VTELVG E
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLEIIKPWIAKKVTELVGFE  60

Query  298  DEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            DEV+I +   LLE       + K++QI LTGF+  +T  FM  LW LLL +Q++  GVP 
Sbjct  61   DEVVIEYAMGLLEDPHQTTPDPKKMQINLTGFLTSSTPAFMTALWDLLLESQDSPGGVPT  120

Query  469  QFL  477
              +
Sbjct  121  SMV  123



>gb|AHH81768.1| serine/arginine repetitive matrix protein 1-like protein, partial 
[Biomphalaria glabrata]
Length=307

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
            + GFFRGT+A QDTRFS+K+ KL+K+ KF   LE  VDM KV +D ++PWIA+R+TEL+G
Sbjct  2    NAGFFRGTTAQQDTRFSDKRKKLMKTMKFGEGLERKVDMTKVNVDSLKPWIAQRITELLG  61

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVPQ  468
            +ED+V++ F+Y+ LE +  + KE+QI +TGF+  +N   F+ ELW  L SAQ N +G+P 
Sbjct  62   MEDDVVVEFVYNQLEERHPDAKEMQINITGFLNGKNARIFLSELWDHLCSAQENVTGIPN  121

Query  469  QFL  477
            QFL
Sbjct  122  QFL  124



>ref|XP_008041955.1| PWI domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW54865.1| PWI domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=285

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE E  VDM KV + V+RPWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFEKKVDMRKVNLSVIRPWIVKKVIELVGF  63

Query  295  EDEVLINFIYSLLE---GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + + +QI LTGF+ ++T  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDDAAPTPDPRRMQINLTGFLTKSTPAFMSALWQLLLEAQESPAGVP  123

Query  466  QQFL  477
            + F+
Sbjct  124  RTFV  127



>gb|KIK68799.1| hypothetical protein GYMLUDRAFT_68631 [Gymnopus luxurians FD-317 
M1]
Length=408

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSADQD RFS+K+ KLLKS KF PE +  VDM KV + V+RPWIAK+V ELVG
Sbjct  3    DAGFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVDMRKVNLTVIRPWIAKKVVELVG  62

Query  292  IEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGV  462
             EDEV++ +   LLE K     + +++QI LTGF+ ++T  FM  LW LLL AQ++ +GV
Sbjct  63   FEDEVVVEYAMGLLEDKQELFPDPRKMQINLTGFLTKDTPAFMSALWKLLLEAQSDMTGV  122

Query  463  PQQFLdakeeetrkkkaetdrITNEIQRR  549
            P+ F++ K+EE RK +    R  +E  RR
Sbjct  123  PRTFVEEKKEELRKARERDTRAIDERDRR  151



>ref|XP_004341588.1| PWI domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19502.1| PWI domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=457

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
            +GGFFRGTS +QD RFS+K  K +  +KF PE +  VD+ KV MD ++PW+A R+T+L+G
Sbjct  4    AGGFFRGTSTEQDARFSDKYKKYVAGRKFPPEFDLKVDLRKVAMDAIKPWVASRITQLLG  63

Query  292  IEDEVLINFIYSLLEGKD-VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
             EDEVLI F + LL+ K+ +N KE+Q+ L GF+E ++ +F+ +LW LLLSAQ +  G+P 
Sbjct  64   FEDEVLIGFAFGLLDDKESLNPKELQLNLDGFLEADSPQFVADLWKLLLSAQASPGGIPA  123

Query  469  QFLdakeeetrkkkaetdrITNE----IQRRKEREYQELEQEK  585
            +FL+ K+ + R+K+ E  R+ ++    I R KER  QE+EQ +
Sbjct  124  EFLEQKKAQLRQKREEESRVKSDLSAVISRDKERLMQEIEQRR  166



>ref|XP_002124610.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Ciona intestinalis]
 ref|XP_009861959.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Ciona intestinalis]
Length=197

 Score =   137 bits (346),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTS DQD RF+NKQ KLLKS KFA  L   VDM K+++D ++PWI+KR+TE++
Sbjct  1    MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEML  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+Y+ LE +  + K +QI LTGF+  +N+  F+ ELW  L SAQ+N  G+P
Sbjct  61   GFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIP  120

Query  466  QQFL  477
            Q FL
Sbjct  121  QVFL  124



>gb|KIK98909.1| hypothetical protein PAXRUDRAFT_618522 [Paxillus rubicundulus 
Ve08.2h10]
Length=210

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTS DQD RFS+K+ KLLKS KF PE +  VDM KV + V++PWIAK+VTELVG
Sbjct  3    DAGFFKGTSTDQDRRFSDKELKLLKSMKFPPEFDKKVDMKKVNLQVIKPWIAKKVTELVG  62

Query  292  IEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGV  462
             EDEV++ +   LLE  +    + K++QI LTGF+  +T  FM  LW LLL AQ + +GV
Sbjct  63   FEDEVVVEYAMGLLEDPNYTTPDPKKMQINLTGFLTSSTPTFMTALWKLLLEAQESLAGV  122

Query  463  PQQFL  477
            PQ F+
Sbjct  123  PQTFV  127



>ref|XP_002124674.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Ciona intestinalis]
Length=233

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTS DQD RF+NKQ KLLKS KFA  L   VDM K+++D ++PWI+KR+TE++
Sbjct  37   MDAGFFRGTSTDQDNRFANKQKKLLKSMKFADGLGVKVDMRKIQLDTIKPWISKRITEML  96

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+Y+ LE +  + K +QI LTGF+  +N+  F+ ELW  L SAQ+N  G+P
Sbjct  97   GFEDDVVIAFVYNSLEEQFPDPKVLQINLTGFLNGKNSRIFLGELWEHLASAQDNDMGIP  156

Query  466  QQFL  477
            Q FL
Sbjct  157  QVFL  160



>ref|XP_005988816.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Latimeria chalumnae]
Length=901

 Score =   145 bits (367),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 74/160 (46%), Positives = 105/160 (66%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M G  + GTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MEGPRWPGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_005988813.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Latimeria chalumnae]
Length=923

 Score =   145 bits (367),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 74/160 (46%), Positives = 105/160 (66%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M G  + GTSA+QD RFSNKQ KLL+  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MEGPRWPGTSAEQDNRFSNKQKKLLRQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V++ FI++ LE K+ + K +QI LTGF+  +N  +F+ ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVIVEFIFNQLEEKNPDAKMMQINLTGFLNGKNAREFLGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|NP_998607.1| serine/arginine repetitive matrix protein 1 [Danio rerio]
 gb|AAH58068.1| Serine/arginine repetitive matrix 1 [Danio rerio]
Length=896

 Score =   145 bits (367),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNK  KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+++ LE K+ +GK +QI LTGF+  +N  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_005158559.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Danio rerio]
Length=929

 Score =   145 bits (367),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNK  KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+++ LE K+ +GK +QI LTGF+  +N  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKNPDGKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_004592301.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Ochotona princeps]
Length=902

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 83/164 (51%), Positives = 120/164 (73%), Gaps = 6/164 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQE  582
              FL+ K+EE ++++ E +++      +E + ++++E +E+ +E
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKEISRE  164



>emb|CAJ83937.1| serine/arginine repetitive matrix 1 [Xenopus (Silurana) tropicalis]
Length=816

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>ref|XP_004592300.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Ochotona princeps]
Length=911

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 83/164 (51%), Positives = 120/164 (73%), Gaps = 6/164 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQE  582
              FL+ K+EE ++++ E +++      +E + ++++E +E+ +E
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKEISRE  164



>ref|XP_004592299.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Ochotona princeps]
Length=914

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 83/164 (51%), Positives = 120/164 (73%), Gaps = 6/164 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQE  582
              FL+ K+EE ++++ E +++      +E + ++++E +E+ +E
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKEISRE  164



>ref|XP_004592298.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Ochotona princeps]
Length=916

 Score =   145 bits (365),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 83/164 (51%), Positives = 120/164 (73%), Gaps = 6/164 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQE  582
              FL+ K+EE ++++ E +++      +E + ++++E +E+ +E
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKEISRE  164



>ref|XP_007852080.1| hypothetical protein Moror_3102 [Moniliophthora roreri MCA 2997]
 gb|ESK88604.1| hypothetical protein Moror_3102 [Moniliophthora roreri MCA 2997]
Length=460

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV ++V++PWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLNVIKPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE K     + K++QI LTGF+ ++T  FM  LW+LLL AQN+ +GVP
Sbjct  64   EDEVVVEYAMGLLEDKSQPTPDPKKMQINLTGFLTKDTPAFMSALWNLLLEAQNDVTGVP  123

Query  466  QQFL  477
            + F+
Sbjct  124  RTFV  127



>ref|NP_001005645.1| serine/arginine repetitive matrix 1 [Xenopus (Silurana) tropicalis]
 gb|AAH74646.1| serine/arginine repetitive matrix 1 [Xenopus (Silurana) tropicalis]
Length=874

 Score =   144 bits (364),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDMGKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>gb|ELU41649.1| SR-rich pre-mRNA splicing activator [Rhizoctonia solani AG-1 
IA]
Length=430

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 2/123 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSIKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++ +GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKVMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  469  QFL  477
             F+
Sbjct  124  SFV  126



>ref|XP_008531009.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Equus przewalskii]
Length=885

 Score =   144 bits (364),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKETSREKRE  167



>gb|KIK21297.1| hypothetical protein PISMIDRAFT_66449, partial [Pisolithus microcarpus 
441]
Length=143

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 87/128 (68%), Gaps = 12/128 (9%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEH---------LVDMGKVKMDVMRPWIAK  270
            GFF+GTSADQD RFS+K+ KLLKS KF PE E           VDM KV M+++RPWIAK
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVPCRLLPVRVDMKKVNMEIIRPWIAK  60

Query  271  RVTELVGIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSA  441
            +VTELVG EDEV+I +   LLE  +    + K++QI L GF+  +T  FMK LW LLL +
Sbjct  61   KVTELVGFEDEVVIEYAMGLLEDPNYTTPDPKKMQINLMGFLTSSTPAFMKALWDLLLES  120

Query  442  QNNASGVP  465
            Q++  GVP
Sbjct  121  QDSPGGVP  128



>emb|CDO71127.1| hypothetical protein BN946_scf184844.g131 [Trametes cinnabarina]
Length=339

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE +  VDM KV + V+RPWI K+V ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFDKKVDMRKVNLSVIRPWIVKKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + + +QI LTGF+  NT  FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDDSQPTPDPRRMQINLTGFLTNNTPAFMSALWKLLLEAQESPAGVP  123

Query  466  QQFL  477
            + F+
Sbjct  124  RTFV  127



>ref|XP_004394850.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Odobenus 
rosmarus divergens]
Length=803

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>emb|CEL57689.1| protein phosphatase 2 (formerly 2A), regulatory subunit A [Rhizoctonia 
solani AG-1 IB]
Length=832

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 77/151 (51%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV++ VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVELSVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ ++  LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQ++ +GVP 
Sbjct  64   EDEVVVEYVMGLLEDRSKPPDPKLMQINLTGFLESKTPAFMSSLWALLLEAQDSPAGVPA  123

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKERE  561
             F+  K+EE R+K    +R   E +RR E +
Sbjct  124  SFVQEKKEELRQKHEADERAFAEARRRGEHD  154



>ref|XP_007257645.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Astyanax mexicanus]
Length=808

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNK  KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKNPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>gb|AAH77771.1| LOC445881 protein, partial [Xenopus laevis]
Length=734

 Score =   143 bits (361),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
             +FL+                     +++E + +++EQEK
Sbjct  121  SEFLEL--------------------KKEEIKQRQIEQEK  140



>ref|XP_010593393.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Loxodonta africana]
Length=886

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_009200134.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Papio anubis]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_005544476.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X7 [Macaca fascicularis]
 ref|XP_007978195.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Chlorocebus sabaeus]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_004425801.1| PREDICTED: uncharacterized protein LOC101387536 isoform 3 [Ceratotherium 
simum simum]
Length=873

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_005875245.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Myotis brandtii]
Length=884

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_011282836.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Felis catus]
Length=874

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_003482044.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoformX2 
[Sus scrofa]
Length=874

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_010828370.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Bison bison bison]
Length=885

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_006777594.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Myotis davidii]
Length=885

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_006159462.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Tupaia chinensis]
Length=887

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_008961405.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Pan paniscus]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_008060364.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Tarsius syrichta]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_005245779.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Homo sapiens]
 ref|XP_009449187.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X8 [Pan troglodytes]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_007257644.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Astyanax mexicanus]
Length=840

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNK  KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKNPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_008263885.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Oryctolagus cuniculus]
Length=889

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_008998899.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Callithrix jacchus]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_011355920.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Pteropus vampyrus]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_005617847.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Canis lupus familiaris]
Length=888

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_008820511.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Nannospalax galili]
Length=892

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASLKKQDEDKDKRDKEEKESSREKRE  167



>ref|XP_006539093.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Mus musculus]
Length=893

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASLKKQDEDKDKRDKEEKESSREKRE  167



>gb|AAH36187.1| Serine/arginine repetitive matrix 1 [Homo sapiens]
Length=904

 Score =   144 bits (363),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>gb|EMS22473.1| SR-rich pre-mRNA splicing activator [Rhodosporidium toruloides 
NP11]
 emb|CDR46859.1| RHTO0S13e02630g1_1 [Rhodosporidium toruloides]
Length=417

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 87/126 (69%), Gaps = 3/126 (2%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M   FFRGTS DQD RF +KQ+ LL+  +F P  +  VDM KV+M VM+PWI K+V EL+
Sbjct  1    MGSNFFRGTSLDQDPRFKDKQSALLRKTQFPPSFDTKVDMRKVEMGVMKPWITKKVIELL  60

Query  289  GIEDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASG  459
            G ED+VLI +IYSLLE  +   V+GK +QI LTGF+E  T  FM  LW LLLSAQ+N   
Sbjct  61   GFEDDVLIEYIYSLLEDPENPVVDGKNMQILLTGFLESKTAAFMNHLWDLLLSAQSNPLR  120

Query  460  VPQQFL  477
            VP + L
Sbjct  121  VPTELL  126



>ref|XP_006631428.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Lepisosteus 
oculatus]
Length=902

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKNPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>gb|EXX63474.1| hypothetical protein RirG_151940 [Rhizophagus irregularis DAOM 
197198w]
Length=369

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
             GGFF+GTS +QD+RFS+KQ KLLKS  F  E    VD+ KV + V+RPW+A+++ EL+G
Sbjct  3    DGGFFKGTSLEQDSRFSDKQKKLLKSMNFPSEFNQKVDLKKVNLTVIRPWVAQKIVELLG  62

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQQ  471
             EDEV++N+++ LLE  D++ + +QI LTGF+E+N   F+ ELW LLLSAQ   +G+P  
Sbjct  63   GEDEVVVNYVFGLLEEPDLDPRMMQINLTGFLEKNAPIFVTELWKLLLSAQEGENGIPAI  122

Query  472  FL  477
            FL
Sbjct  123  FL  124



>ref|XP_004465432.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
8 [Dasypus novemcinctus]
Length=887

 Score =   144 bits (362),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 83/167 (50%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEKKK  591
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK++
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREKRE  167



>gb|EUC66839.1| serine/arginine repetitive matrix-like protein, putative [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=466

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RF++K+ +LLKS KF PE +  VDM KV + VMRPWI K+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFADKEHRLLKSMKFPPEFDRKVDMRKVNLQVMRPWITKKVVELVGF  63

Query  295  EDEVLINFIYSLLE--GKDVNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVPQ  468
            EDEV++ +   LLE   K  + K +QI LTGF+E  T  FM  LW+LLL AQN+ +GVP 
Sbjct  64   EDEVVVEYAMGLLEDQSKPPDPKVMQINLTGFLESKTPAFMSALWTLLLEAQNSPAGVPA  123

Query  469  QFL  477
             F+
Sbjct  124  SFV  126



>gb|KIO14306.1| hypothetical protein M404DRAFT_992582 [Pisolithus tinctorius 
Marx 270]
Length=507

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 88/124 (71%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLKS KF PE E  VDM KV M+++RPWIAK+VTELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVDMKKVNMEIIRPWIAKKVTELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV+I +   LLE  +    + K++QI L GF+  +T  FMK LW LLL +Q++  GVP
Sbjct  64   EDEVVIEYAMGLLEDPNHTTPDPKKMQINLMGFLTSSTPAFMKALWDLLLESQDSPGGVP  123

Query  466  QQFL  477
               +
Sbjct  124  TSMV  127



>ref|NP_001086440.1| serine/arginine repetitive matrix 1 [Xenopus laevis]
 gb|AAH94091.1| LOC445881 protein [Xenopus laevis]
Length=872

 Score =   143 bits (361),  Expect = 4e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
             +FL+                     +++E + +++EQEK
Sbjct  121  SEFLEL--------------------KKEEIKQRQIEQEK  140



>gb|KIP02407.1| hypothetical protein PHLGIDRAFT_112065 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=211

 Score =   135 bits (340),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
              GFF+GTSADQD RFS+K+ KLLKS KF PE E  VDM KV + V+RPWI  +V ELVG
Sbjct  3    DAGFFKGTSADQDRRFSDKELKLLKSMKFPPEFEKKVDMRKVNLTVIRPWIVSKVVELVG  62

Query  292  IEDEVLINFIYSLLEGKDV----NGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASG  459
             EDEV++ +   LLE  DV    + +++QI LTGF+ ++T  FM  LW+LLL AQ + +G
Sbjct  63   FEDEVVVEYAMGLLE-DDVQPTPDPRKMQINLTGFLTKDTPTFMSALWTLLLEAQESPAG  121

Query  460  VPQQFL  477
            VP+  +
Sbjct  122  VPRSMV  127



>ref|XP_010877536.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X2 [Esox lucius]
Length=841

 Score =   142 bits (359),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+++ LE K  + K +QI LTGF+  +N  +FMK+LW LLLSAQ+N +G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKHPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQDNIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_010824971.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Bos taurus]
 ref|XP_010800937.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Bos taurus]
Length=746

 Score =   142 bits (358),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_010877535.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Esox lucius]
Length=874

 Score =   142 bits (359),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+++ LE K  + K +QI LTGF+  +N  +FMK+LW LLLSAQ+N +G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKHPDSKMMQINLTGFLNGKNAREFMKDLWPLLLSAQDNIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_007491381.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X10 [Monodelphis domestica]
Length=897

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_007491380.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X9 [Monodelphis domestica]
Length=899

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_001362878.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Monodelphis domestica]
Length=900

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_007491379.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X8 [Monodelphis domestica]
Length=906

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_007491378.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X7 [Monodelphis domestica]
Length=912

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_007491377.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Monodelphis domestica]
Length=913

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_007491376.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Monodelphis domestica]
Length=913

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_007491375.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X4 [Monodelphis domestica]
Length=913

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>ref|XP_001362791.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Monodelphis domestica]
 ref|XP_007491374.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Monodelphis domestica]
Length=914

 Score =   143 bits (360),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 83/165 (50%), Positives = 119/165 (72%), Gaps = 6/165 (4%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrIT-----NEIQRRKEREYQELEQEK  585
              FL+ K+EE ++++ E +++      +E + ++++E +E  +EK
Sbjct  121  SAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKESSREK  165



>dbj|BAB25575.1| unnamed protein product [Mus musculus]
Length=265

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFL  477
              FL
Sbjct  121  SAFL  124



>gb|EPT02135.1| hypothetical protein FOMPIDRAFT_1048148 [Fomitopsis pinicola 
FP-58527 SS1]
Length=352

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 3/124 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSADQD RFS+K+ KLLK+ KF PE E  VDM KV + V+RPW+ K++ ELVG 
Sbjct  4    AGFFKGTSADQDRRFSDKELKLLKTMKFPPEFEKKVDMRKVNLSVIRPWVVKKIVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + +++QI LTGF+ ++T +FM  LW LLL AQ + +GVP
Sbjct  64   EDEVVVEYAMGLLEDDSQPTPDPRKMQINLTGFLTKHTVEFMSSLWKLLLEAQESPAGVP  123

Query  466  QQFL  477
            Q F+
Sbjct  124  QTFV  127



>ref|NP_001131046.1| serine/arginine repetitive matrix 1 [Xenopus laevis]
 gb|AAI66052.1| LOC494754 protein [Xenopus laevis]
Length=774

 Score =   142 bits (358),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>gb|AAI08753.1| LOC494754 protein [Xenopus laevis]
Length=796

 Score =   142 bits (358),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>gb|AAI30177.1| LOC494754 protein [Xenopus laevis]
Length=796

 Score =   142 bits (358),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>ref|XP_007771072.1| PWI domain-containing protein, partial [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW78454.1| PWI domain-containing protein, partial [Coniophora puteana RWD-64-598 
SS2]
Length=145

 Score =   132 bits (333),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 86/134 (64%), Gaps = 14/134 (10%)
 Frame = +1

Query  118  GFFRGTSADQDTRFSNKQAKLLKSQKFAPELEH-----------LVDMGKVKMDVMRPWI  264
            GFF+GTSADQD RFS+K+ KLLKS KF PE +            +VDM KV + V+RPWI
Sbjct  1    GFFKGTSADQDRRFSDKELKLLKSMKFPPEFDKKVHPLPSSSCLIVDMRKVNIQVIRPWI  60

Query  265  AKRVTELVGIEDEVLINFIYSLLEGKDV---NGKEVQIQLTGFMERNTGKFMKELWSLLL  435
             K+V E VG EDEV++ +   LLE  D    + K++QI LTGF+   T  FM  LW LL+
Sbjct  61   VKKVIECVGFEDEVVVEYAMGLLEDPDTPTPDPKKMQINLTGFLTSQTTTFMTALWKLLI  120

Query  436  SAQNNASGVPQQFL  477
             AQ + +GVPQ F+
Sbjct  121  EAQESPAGVPQTFV  134



>gb|AAH97656.1| LOC494754 protein [Xenopus laevis]
Length=798

 Score =   142 bits (358),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VD GKV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDTGKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I+FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIDFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>gb|EDL29987.1| serine/arginine repetitive matrix 1, isoform CRA_c [Mus musculus]
Length=904

 Score =   142 bits (359),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 80/168 (48%), Positives = 110/168 (65%), Gaps = 21/168 (13%)
 Frame = +1

Query  106  EMSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTEL  285
            +M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE+
Sbjct  7    KMDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEI  66

Query  286  VGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGV  462
            +G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+
Sbjct  67   LGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGI  126

Query  463  PQQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
            P  FL+                     +++E + +++EQEK  ++  Q
Sbjct  127  PSAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  154



>gb|EDL29988.1| serine/arginine repetitive matrix 1, isoform CRA_d [Mus musculus]
Length=927

 Score =   142 bits (359),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 80/168 (48%), Positives = 110/168 (65%), Gaps = 21/168 (13%)
 Frame = +1

Query  106  EMSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTEL  285
            +M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE+
Sbjct  9    KMDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEI  68

Query  286  VGIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGV  462
            +G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+
Sbjct  69   LGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGI  128

Query  463  PQQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
            P  FL+                     +++E + +++EQEK  ++  Q
Sbjct  129  PSAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  156



>ref|XP_008313300.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X1 [Cynoglossus semilaevis]
Length=833

 Score =   142 bits (358),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 106/160 (66%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNK  KLLK  KFA  L+  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLDKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+++ LE K  + K +QI LTGF+  RN  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKHPDSKMMQINLTGFLNGRNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>gb|AAP97290.1|AF419855_1 Ser/Arg-related nuclear matrix protein [Homo sapiens]
 gb|AAC09321.1| Ser/Arg-related nuclear matrix protein [Homo sapiens]
Length=820

 Score =   142 bits (358),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_007424155.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Python bivittatus]
Length=746

 Score =   142 bits (357),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                     +++E + +++EQEK
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEK  140



>emb|CDQ74671.1| unnamed protein product [Oncorhynchus mykiss]
Length=876

 Score =   142 bits (358),  Expect = 8e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K  + K +QI LTGF+  +N  +FM++LW LLLSAQ+N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKHPDSKMMQINLTGFLNGKNAREFMRDLWPLLLSAQDNIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_008313453.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Cynoglossus semilaevis]
Length=867

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 106/160 (66%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNK  KLLK  KFA  L+  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKHKKLLKQLKFAECLDKKVDMTKVNLEVIKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I F+++ LE K  + K +QI LTGF+  RN  +FMK+LW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFVFNQLEEKHPDSKMMQINLTGFLNGRNAREFMKDLWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_010343877.1| PREDICTED: serine/arginine repetitive matrix protein 1 [Saimiri 
boliviensis boliviensis]
Length=863

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_005101380.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Aplysia californica]
Length=1049

 Score =   142 bits (359),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 74/161 (46%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +1

Query  112  SGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVG  291
            + GFFRGT+A QDTRFS+K+ KL+K+ KFA  L+  VDM KV +D ++PWIA+R+T+L+G
Sbjct  3    NAGFFRGTTAQQDTRFSDKKKKLMKTMKFAEGLDRKVDMLKVNIDSLKPWIAQRITDLLG  62

Query  292  IEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVPQ  468
            +ED+V++ F+Y+ LE +  N KE+QI LTGF+  +N   F+ ELW  L SAQ N +G+P 
Sbjct  63   MEDDVVVEFVYNYLEERHPNAKEMQINLTGFLNGKNARTFLSELWEHLCSAQENVTGIPN  122

Query  469  QFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKK  591
            QFL+ K+ E ++++ E +RI   ++ ++E+  ++L +E+++
Sbjct  123  QFLEQKKNEIKQRQEEQERIQEALKEKEEQIKEQLAKERRE  163



>ref|XP_006539094.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Mus musculus]
Length=879

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>gb|ACN11002.1| Serine/arginine repetitive matrix protein 1 [Salmo salar]
Length=873

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVVKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K  + K +QI LTGF+  +N  +FM++LW LLLSAQ+N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKHPDSKMMQINLTGFLNGKNAREFMRDLWPLLLSAQDNIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_007869448.1| PWI domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ52281.1| PWI domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=301

 Score =   136 bits (343),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 99/148 (67%), Gaps = 3/148 (2%)
 Frame = +1

Query  115  GGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELVGI  294
             GFF+GTSA+QD RFS+K+ KLLK+ KF    +  VDM KV +DV+RPWIAK+V ELVG 
Sbjct  4    AGFFKGTSAEQDRRFSDKEMKLLKTMKFPATFDKKVDMRKVNLDVIRPWIAKKVVELVGF  63

Query  295  EDEVLINFIYSLLEGKD---VNGKEVQIQLTGFMERNTGKFMKELWSLLLSAQNNASGVP  465
            EDEV++ +   LLE       + K++QI LTGF+  +T +FM  LW LLL AQ++  GVP
Sbjct  64   EDEVVVEYAMGLLEDPSQPTPDPKKMQINLTGFLTNHTAEFMSALWELLLEAQDSLGGVP  123

Query  466  QQFLdakeeetrkkkaetdrITNEIQRR  549
            ++FL+ K+EE RK         NE  RR
Sbjct  124  KRFLEEKKEEMRKAAERDSGALNERDRR  151



>emb|CDQ64409.1| unnamed protein product [Oncorhynchus mykiss]
Length=870

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 21/160 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI +RVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMTKVNLEVVKPWITQRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K  + K +QI LTGF+  +N  +FM++LW LLLSAQ+N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEEKHPDSKMMQINLTGFLNGKNAREFMRDLWPLLLSAQDNIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEK  585
              FL+                    Q+++E + +++EQEK
Sbjct  121  SAFLE--------------------QKKEEIKQRQIEQEK  140



>ref|XP_007121183.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Physeter catodon]
Length=881

 Score =   142 bits (358),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_005665165.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X13 [Sus scrofa]
Length=875

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_007121182.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Physeter catodon]
Length=888

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_005353112.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X5 [Microtus ochrogaster]
Length=900

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>gb|AAC17422.1| plenty-of-prolines-101 [Mus musculus]
Length=897

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>gb|EDL29985.1| serine/arginine repetitive matrix 1, isoform CRA_a [Mus musculus]
Length=897

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>ref|XP_005544475.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X6 [Macaca fascicularis]
Length=901

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_009200129.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Papio anubis]
Length=902

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_007978194.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Chlorocebus sabaeus]
Length=902

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_005245778.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Homo sapiens]
 ref|XP_009449178.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X7 [Pan troglodytes]
Length=902

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_005665163.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X11 [Sus scrofa]
Length=887

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_010354028.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Rhinopithecus roxellana]
Length=903

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_006539092.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Mus musculus]
Length=907

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>ref|XP_004850657.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Heterocephalus glaber]
Length=900

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_004465431.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
7 [Dasypus novemcinctus]
Length=900

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_010354027.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Rhinopithecus roxellana]
Length=904

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_003891388.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Papio anubis]
Length=904

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASMKKQ  147



>ref|XP_006975730.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Peromyscus maniculatus bairdii]
Length=908

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>ref|XP_006539091.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X4 [Mus musculus]
Length=908

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



>ref|XP_005079657.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X3 [Mesocricetus auratus]
Length=908

 Score =   142 bits (358),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 80/167 (48%), Positives = 109/167 (65%), Gaps = 21/167 (13%)
 Frame = +1

Query  109  MSGGFFRGTSADQDTRFSNKQAKLLKSQKFAPELEHLVDMGKVKMDVMRPWIAKRVTELV  288
            M  GFFRGTSA+QD RFSNKQ KLLK  KFA  LE  VDM KV ++V++PWI KRVTE++
Sbjct  1    MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEIL  60

Query  289  GIEDEVLINFIYSLLEGKDVNGKEVQIQLTGFME-RNTGKFMKELWSLLLSAQNNASGVP  465
            G ED+V+I FI++ LE K+ + K +QI LTGF+  +N  +FM ELW LLLSAQ N +G+P
Sbjct  61   GFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIP  120

Query  466  QQFLdakeeetrkkkaetdrITNEIQRRKEREYQELEQEKKKAVSLQ  606
              FL+                     +++E + +++EQEK  ++  Q
Sbjct  121  SAFLEL--------------------KKEEIKQRQIEQEKLASLKKQ  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380