BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035G01

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004134868.1|  PREDICTED: uncharacterized protein LOC101203537    105   3e-23   Cucumis sativus [cucumbers]
ref|XP_008440810.1|  PREDICTED: E3 SUMO-protein ligase RanBP2           105   3e-23   Cucumis melo [Oriental melon]
ref|XP_006383117.1|  zinc finger family protein                         103   1e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011043207.1|  PREDICTED: uncharacterized protein LOC105138...    103   1e-22   Populus euphratica
ref|XP_006833574.1|  hypothetical protein AMTR_s00610p00009670        97.1    9e-22   
gb|KEH20382.1|  zinc finger (Ran-binding) family protein              99.8    1e-21   Medicago truncatula
gb|KCW53141.1|  hypothetical protein EUGRSUZ_J02427                   99.8    2e-21   Eucalyptus grandis [rose gum]
ref|XP_011099831.1|  PREDICTED: calpain-15                              100   2e-21   Sesamum indicum [beniseed]
gb|KDO71161.1|  hypothetical protein CISIN_1g0203502mg                94.0    2e-21   Citrus sinensis [apfelsine]
gb|KEH20383.1|  zinc finger (Ran-binding) family protein              99.8    3e-21   Medicago truncatula
ref|XP_003629331.1|  RNA-binding protein, putative                    99.8    3e-21   Medicago truncatula
ref|XP_010033482.1|  PREDICTED: uncharacterized protein LOC104422...  99.4    3e-21   Eucalyptus grandis [rose gum]
ref|XP_002530738.1|  conserved hypothetical protein                   99.8    3e-21   
ref|XP_010033481.1|  PREDICTED: uncharacterized protein LOC104422...  99.4    3e-21   Eucalyptus grandis [rose gum]
ref|XP_008372785.1|  PREDICTED: uncharacterized protein LOC103436...  99.0    4e-21   Malus domestica [apple tree]
ref|XP_009764394.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.4    4e-21   Nicotiana sylvestris
ref|XP_004509353.1|  PREDICTED: uncharacterized protein LOC101491...  99.0    4e-21   Cicer arietinum [garbanzo]
gb|KHG03837.1|  hypothetical protein F383_01243                       99.0    4e-21   Gossypium arboreum [tree cotton]
ref|XP_009378178.1|  PREDICTED: uncharacterized RNA-binding prote...  99.0    5e-21   Pyrus x bretschneideri [bai li]
ref|XP_008241814.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  99.0    5e-21   Prunus mume [ume]
ref|XP_010649045.1|  PREDICTED: uncharacterized protein LOC100245...  99.0    5e-21   Vitis vinifera
ref|XP_002268619.2|  PREDICTED: uncharacterized protein LOC100245...  98.6    6e-21   Vitis vinifera
ref|XP_010244096.1|  PREDICTED: uncharacterized protein LOC104588...  99.0    6e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009378177.1|  PREDICTED: uncharacterized RNA-binding prote...  98.6    6e-21   Pyrus x bretschneideri [bai li]
emb|CDP01911.1|  unnamed protein product                              98.6    7e-21   Coffea canephora [robusta coffee]
ref|XP_007046712.1|  Zinc finger family protein, putative isoform 1   98.6    8e-21   
ref|XP_009586614.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  98.6    9e-21   
gb|KHF97982.1|  hypothetical protein F383_13760                       97.4    9e-21   Gossypium arboreum [tree cotton]
ref|XP_009392887.1|  PREDICTED: nuclear pore complex protein Nup1...  97.8    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43350.1|  hypothetical protein B456_007G195500                  97.8    1e-20   Gossypium raimondii
ref|XP_009392886.1|  PREDICTED: nuclear pore complex protein Nup1...  97.8    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004287821.1|  PREDICTED: ranBP2-type zinc finger protein A...  97.8    1e-20   Fragaria vesca subsp. vesca
ref|XP_003547942.1|  PREDICTED: uncharacterized protein LOC100801066  97.4    1e-20   Glycine max [soybeans]
gb|KHN34289.1|  Putative RNA-binding protein C17H9.04c                97.4    2e-20   Glycine soja [wild soybean]
gb|ACU19093.1|  unknown                                               97.4    2e-20   Glycine max [soybeans]
ref|XP_007156146.1|  hypothetical protein PHAVU_003G262300g           97.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_007156147.1|  hypothetical protein PHAVU_003G262300g           97.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_006425506.1|  hypothetical protein CICLE_v10025906mg           97.4    2e-20   Citrus clementina [clementine]
ref|XP_003520259.1|  PREDICTED: uncharacterized protein LOC100784...  97.1    2e-20   Glycine max [soybeans]
ref|XP_006574680.1|  PREDICTED: uncharacterized protein LOC100784...  97.1    2e-20   Glycine max [soybeans]
ref|XP_006425507.1|  hypothetical protein CICLE_v10025906mg           97.1    2e-20   
ref|NP_001052030.1|  Os04g0110600                                     92.0    2e-20   
ref|XP_010935042.1|  PREDICTED: E3 SUMO-protein ligase RanBP2-lik...  96.7    3e-20   Elaeis guineensis
ref|XP_008788645.1|  PREDICTED: uncharacterized protein LOC103706...  97.1    3e-20   Phoenix dactylifera
ref|XP_010935041.1|  PREDICTED: E3 SUMO-protein ligase RanBP2-lik...  96.7    3e-20   Elaeis guineensis
gb|KJB70990.1|  hypothetical protein B456_011G098800                  96.3    3e-20   Gossypium raimondii
gb|AFX67024.1|  hypothetical protein                                  96.3    4e-20   Solanum tuberosum [potatoes]
ref|XP_010679870.1|  PREDICTED: uncharacterized protein LOC104895140  95.9    4e-20   Beta vulgaris subsp. vulgaris [field beet]
emb|CAH67784.1|  H0201G08.11                                          96.3    5e-20   Oryza sativa [red rice]
gb|EEE60388.1|  hypothetical protein OsJ_13542                        96.3    5e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008788646.1|  PREDICTED: uncharacterized protein LOC103706...  96.3    5e-20   Phoenix dactylifera
ref|XP_010526796.1|  PREDICTED: calpain-15                            95.5    5e-20   Tarenaya hassleriana [spider flower]
ref|XP_008788643.1|  PREDICTED: uncharacterized protein LOC103706...  96.7    6e-20   Phoenix dactylifera
ref|XP_008788647.1|  PREDICTED: uncharacterized protein LOC103706...  95.9    6e-20   Phoenix dactylifera
gb|KJB70991.1|  hypothetical protein B456_011G098800                  95.5    6e-20   Gossypium raimondii
ref|XP_010941265.1|  PREDICTED: uncharacterized protein LOC105059604  95.9    7e-20   Elaeis guineensis
ref|XP_010467593.1|  PREDICTED: E3 SUMO-protein ligase RanBP2-like    94.7    9e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008799409.1|  PREDICTED: uncharacterized protein LOC103714055  95.1    1e-19   Phoenix dactylifera
ref|XP_010113362.1|  E3 SUMO-protein ligase RanBP2                    94.7    1e-19   Morus notabilis
gb|EPS67234.1|  hypothetical protein M569_07541                       94.4    2e-19   Genlisea aurea
gb|AFK38574.1|  unknown                                               94.4    2e-19   Lotus japonicus
ref|NP_179388.1|  zinc finger (Ran-binding) domain-containing pro...  93.6    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002978149.1|  hypothetical protein SELMODRAFT_417828           94.0    2e-19   
ref|XP_002966415.1|  hypothetical protein SELMODRAFT_270595           93.6    3e-19   
gb|KFK40174.1|  hypothetical protein AALP_AA3G339800                  93.2    3e-19   Arabis alpina [alpine rockcress]
ref|XP_006409215.1|  hypothetical protein EUTSA_v10022807mg           92.8    4e-19   Eutrema salsugineum [saltwater cress]
ref|XP_009418704.1|  PREDICTED: uncharacterized protein LOC103998...  93.2    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006298389.1|  hypothetical protein CARUB_v10014460mg           92.8    4e-19   Capsella rubella
ref|XP_009418703.1|  PREDICTED: uncharacterized protein LOC103998...  93.2    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010413257.1|  PREDICTED: uncharacterized protein LOC104699615  92.8    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010489438.1|  PREDICTED: uncharacterized protein LOC104767103  92.0    7e-19   Camelina sativa [gold-of-pleasure]
gb|EYU20512.1|  hypothetical protein MIMGU_mgv1a009717mg              92.8    7e-19   Erythranthe guttata [common monkey flower]
ref|XP_004975002.1|  PREDICTED: uncharacterized protein LOC101785033  92.4    8e-19   Setaria italica
gb|EYU20511.1|  hypothetical protein MIMGU_mgv1a009717mg              92.0    1e-18   Erythranthe guttata [common monkey flower]
gb|AFW57701.1|  hypothetical protein ZEAMMB73_045757                  87.0    2e-18   
ref|XP_009102295.1|  PREDICTED: uncharacterized protein LOC103828444  90.5    3e-18   Brassica rapa
ref|XP_002886140.1|  zinc finger (Ran-binding) family protein         90.5    3e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_003580622.1|  PREDICTED: asparagine-rich protein               90.9    3e-18   
ref|NP_001151762.1|  LOC100285397                                     89.0    3e-18   
emb|CDY56585.1|  BnaC07g48110D                                        90.1    3e-18   Brassica napus [oilseed rape]
ref|XP_008662051.1|  PREDICTED: LOC100285397 isoform X2               90.5    4e-18   Zea mays [maize]
gb|ACR36944.1|  unknown                                               90.1    5e-18   Zea mays [maize]
ref|NP_001159007.1|  Zn-finger, RanBP-type, containing protein        90.1    5e-18   
tpg|DAA38753.1|  TPA: hypothetical protein ZEAMMB73_060091            87.0    7e-18   
ref|XP_008662050.1|  PREDICTED: LOC100285397 isoform X1               89.7    7e-18   
ref|XP_002447426.1|  hypothetical protein SORBIDRAFT_06g000870        89.7    7e-18   Sorghum bicolor [broomcorn]
ref|XP_008667522.1|  PREDICTED: hypothetical protein isoform X1       90.5    1e-17   
dbj|BAJ93151.1|  predicted protein                                    89.4    1e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW56696.1|  hypothetical protein ZEAMMB73_305364                  84.7    1e-17   
ref|NP_001131807.1|  hypothetical protein                             88.2    2e-17   
ref|XP_008661402.1|  PREDICTED: hypothetical protein isoform X5       88.2    2e-17   
ref|XP_008661400.1|  PREDICTED: hypothetical protein isoform X3       89.7    3e-17   
ref|XP_008661399.1|  PREDICTED: hypothetical protein isoform X2       89.4    5e-17   Zea mays [maize]
ref|XP_008661398.1|  PREDICTED: hypothetical protein isoform X1       89.4    5e-17   Zea mays [maize]
ref|XP_006653104.1|  PREDICTED: uncharacterized protein LOC102718733  83.2    1e-15   
emb|CAN80816.1|  hypothetical protein VITISV_020467                   53.9    3e-06   Vitis vinifera
ref|XP_008372786.1|  PREDICTED: uncharacterized protein LOC103436...  49.3    8e-04   



>ref|XP_004134868.1| PREDICTED: uncharacterized protein LOC101203537 [Cucumis sativus]
 ref|XP_004169948.1| PREDICTED: uncharacterized protein LOC101224503 [Cucumis sativus]
 gb|KGN48905.1| hypothetical protein Csa_6G505830 [Cucumis sativus]
Length=340

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT
Sbjct  25   DWECSGCKNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  72



>ref|XP_008440810.1| PREDICTED: E3 SUMO-protein ligase RanBP2 [Cucumis melo]
Length=340

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT
Sbjct  25   DWECSGCKNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  72



>ref|XP_006383117.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP60914.1| zinc finger family protein [Populus trichocarpa]
Length=329

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT
Sbjct  8    DWECSGCQNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  55



>ref|XP_011043207.1| PREDICTED: uncharacterized protein LOC105138731 isoform X1 [Populus 
euphratica]
Length=329

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT
Sbjct  8    DWECSGCQNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  55



>ref|XP_006833574.1| hypothetical protein AMTR_s00610p00009670 [Amborella trichopoda]
 gb|ERM98852.1| hypothetical protein AMTR_s00610p00009670 [Amborella trichopoda]
Length=115

 Score = 97.1 bits (240),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  8    DWECGGCQNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICS  55



>gb|KEH20382.1| zinc finger (Ran-binding) family protein [Medicago truncatula]
Length=278

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>gb|KCW53141.1| hypothetical protein EUGRSUZ_J02427 [Eucalyptus grandis]
Length=280

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECGGCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_011099831.1| PREDICTED: calpain-15 [Sesamum indicum]
Length=340

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  11   DWECSGCHNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  58



>gb|KDO71161.1| hypothetical protein CISIN_1g0203502mg, partial [Citrus sinensis]
Length=55

 Score = 94.0 bits (232),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC+GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  8    DWECNGCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICS  55



>gb|KEH20383.1| zinc finger (Ran-binding) family protein [Medicago truncatula]
Length=325

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_003629331.1| RNA-binding protein, putative [Medicago truncatula]
 gb|AET03807.1| zinc finger (Ran-binding) family protein [Medicago truncatula]
Length=316

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_010033482.1| PREDICTED: uncharacterized protein LOC104422753 isoform X2 [Eucalyptus 
grandis]
 gb|KCW53140.1| hypothetical protein EUGRSUZ_J02427 [Eucalyptus grandis]
Length=322

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECGGCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_002530738.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31644.1| conserved hypothetical protein [Ricinus communis]
Length=393

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCNNRNYAFRSFCNRCKQPRLLVDIKTPADSKWLPRIGDWICT  55



>ref|XP_010033481.1| PREDICTED: uncharacterized protein LOC104422753 isoform X1 [Eucalyptus 
grandis]
Length=323

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECGGCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_008372785.1| PREDICTED: uncharacterized protein LOC103436140 isoform X1 [Malus 
domestica]
Length=320

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_009764394.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104216117 
[Nicotiana sylvestris]
Length=353

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW CSGCGNRNYAFR FCNRCKQPRLLVDN TP DSKWLPRIGDWICT
Sbjct  6    DWACSGCGNRNYAFRCFCNRCKQPRLLVDNNTPSDSKWLPRIGDWICT  53



>ref|XP_004509353.1| PREDICTED: uncharacterized protein LOC101491400 isoform X1 [Cicer 
arietinum]
Length=321

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVDNKTP DSKWLPRIGDWICT
Sbjct  8    DWECSSCNNRNYAFRSFCNRCKQPRLLVDNKTPADSKWLPRIGDWICT  55



>gb|KHG03837.1| hypothetical protein F383_01243 [Gossypium arboreum]
Length=320

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_009378178.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c isoform 
X2 [Pyrus x bretschneideri]
Length=320

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_008241814.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103340201 
[Prunus mume]
Length=330

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_010649045.1| PREDICTED: uncharacterized protein LOC100245437 isoform X1 [Vitis 
vinifera]
Length=331

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_002268619.2| PREDICTED: uncharacterized protein LOC100245437 isoform X2 [Vitis 
vinifera]
 emb|CBI17384.3| unnamed protein product [Vitis vinifera]
Length=325

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_010244096.1| PREDICTED: uncharacterized protein LOC104588005 isoform X1 [Nelumbo 
nucifera]
Length=344

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC+GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECAGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_009378177.1| PREDICTED: uncharacterized RNA-binding protein C17H9.04c isoform 
X1 [Pyrus x bretschneideri]
Length=331

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>emb|CDP01911.1| unnamed protein product [Coffea canephora]
Length=339

 Score = 98.6 bits (244),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +3

Query  96   WECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            W+CSGCGNRNYAFR FCNRCKQPRLLVDNKTP DSKWLPRIGDWICT
Sbjct  16   WDCSGCGNRNYAFRCFCNRCKQPRLLVDNKTPADSKWLPRIGDWICT  62



>ref|XP_007046712.1| Zinc finger family protein, putative isoform 1 [Theobroma cacao]
 gb|EOX90869.1| Zinc finger family protein, putative isoform 1 [Theobroma cacao]
Length=364

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICTD  239
            DWECSGC NRNYAFR FCNRCKQPRLLVD KTP DSKWLPRIGDWICTD
Sbjct  7    DWECSGCRNRNYAFRCFCNRCKQPRLLVDTKTPADSKWLPRIGDWICTD  55



>ref|XP_009586614.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104084464 
[Nicotiana tomentosiformis]
Length=374

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW CSGCGNRNYAFR FCNRCKQPRLLVDN TP DSKWLPRIGDWICT
Sbjct  28   DWVCSGCGNRNYAFRCFCNRCKQPRLLVDNNTPSDSKWLPRIGDWICT  75



>gb|KHF97982.1| hypothetical protein F383_13760 [Gossypium arboreum]
Length=260

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  8    DWECSGCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICS  55



>ref|XP_009392887.1| PREDICTED: nuclear pore complex protein Nup153-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=331

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPR+GDWIC 
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRVGDWICA  55



>gb|KJB43350.1| hypothetical protein B456_007G195500 [Gossypium raimondii]
Length=321

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  8    DWECSGCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICS  55



>ref|XP_009392886.1| PREDICTED: nuclear pore complex protein Nup153-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=337

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPR+GDWIC 
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRVGDWICA  55



>ref|XP_004287821.1| PREDICTED: ranBP2-type zinc finger protein At1g67325 [Fragaria 
vesca subsp. vesca]
Length=320

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRC+QPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCRQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_003547942.1| PREDICTED: uncharacterized protein LOC100801066 [Glycine max]
Length=334

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD+KTP DSKWLPRIGDWICT
Sbjct  18   DWECSSCNNRNYAFRSFCNRCKQPRLLVDSKTPADSKWLPRIGDWICT  65



>gb|KHN34289.1| Putative RNA-binding protein C17H9.04c [Glycine soja]
Length=326

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD+KTP DSKWLPRIGDWICT
Sbjct  10   DWECSSCNNRNYAFRSFCNRCKQPRLLVDSKTPADSKWLPRIGDWICT  57



>gb|ACU19093.1| unknown [Glycine max]
Length=334

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD+KTP DSKWLPRIGDWICT
Sbjct  18   DWECSSCNNRNYAFRSFCNRCKQPRLLVDSKTPADSKWLPRIGDWICT  65



>ref|XP_007156146.1| hypothetical protein PHAVU_003G262300g [Phaseolus vulgaris]
 gb|ESW28140.1| hypothetical protein PHAVU_003G262300g [Phaseolus vulgaris]
Length=331

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  16   DWECSSCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  63



>ref|XP_007156147.1| hypothetical protein PHAVU_003G262300g [Phaseolus vulgaris]
 gb|ESW28141.1| hypothetical protein PHAVU_003G262300g [Phaseolus vulgaris]
Length=328

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  16   DWECSSCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  63



>ref|XP_006425506.1| hypothetical protein CICLE_v10025906mg [Citrus clementina]
 ref|XP_006466938.1| PREDICTED: uncharacterized protein LOC102616338 isoform X1 [Citrus 
sinensis]
 ref|XP_006466939.1| PREDICTED: uncharacterized protein LOC102616338 isoform X2 [Citrus 
sinensis]
 gb|ESR38746.1| hypothetical protein CICLE_v10025906mg [Citrus clementina]
Length=327

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC+GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  8    DWECNGCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICS  55



>ref|XP_003520259.1| PREDICTED: uncharacterized protein LOC100784874 isoform X1 [Glycine 
max]
 gb|KHN00483.1| hypothetical protein glysoja_000151 [Glycine soja]
Length=336

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  20   DWECSSCNNRNYAFRSFCNRCKQPRLLVDTKTPSDSKWLPRIGDWICT  67



>ref|XP_006574680.1| PREDICTED: uncharacterized protein LOC100784874 isoform X2 [Glycine 
max]
Length=333

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  20   DWECSSCNNRNYAFRSFCNRCKQPRLLVDTKTPSDSKWLPRIGDWICT  67



>ref|XP_006425507.1| hypothetical protein CICLE_v10025906mg [Citrus clementina]
 gb|ESR38747.1| hypothetical protein CICLE_v10025906mg [Citrus clementina]
Length=367

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC+GC NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  8    DWECNGCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICS  55



>ref|NP_001052030.1| Os04g0110600 [Oryza sativa Japonica Group]
 dbj|BAF13944.1| Os04g0110600 [Oryza sativa Japonica Group]
Length=86

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C GCGNRNYAFRS CNRCKQPRLLVD  TPPDSKWLPR GDWICT
Sbjct  23   DWDCGGCGNRNYAFRSLCNRCKQPRLLVDPNTPPDSKWLPRAGDWICT  70



>ref|XP_010935042.1| PREDICTED: E3 SUMO-protein ligase RanBP2-like isoform X2 [Elaeis 
guineensis]
Length=343

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD  TPPDSKWLPR+GDWICT
Sbjct  10   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTMTPPDSKWLPRVGDWICT  57



>ref|XP_008788645.1| PREDICTED: uncharacterized protein LOC103706355 isoform X2 [Phoenix 
dactylifera]
Length=377

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  44   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  91



>ref|XP_010935041.1| PREDICTED: E3 SUMO-protein ligase RanBP2-like isoform X1 [Elaeis 
guineensis]
Length=348

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD  TPPDSKWLPR+GDWICT
Sbjct  10   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTMTPPDSKWLPRVGDWICT  57



>gb|KJB70990.1| hypothetical protein B456_011G098800 [Gossypium raimondii]
Length=306

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICTD  239
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT+
Sbjct  8    DWECSVCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICTE  56



>gb|AFX67024.1| hypothetical protein [Solanum tuberosum]
Length=295

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS CGN+NYAFR FCNRCKQPRLLVDNKTP DSKW PRIGDWICT
Sbjct  6    DWECSSCGNKNYAFRCFCNRCKQPRLLVDNKTPHDSKWFPRIGDWICT  53



>ref|XP_010679870.1| PREDICTED: uncharacterized protein LOC104895140 [Beta vulgaris 
subsp. vulgaris]
Length=291

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC+GC N NYAFRSFCNRCKQPRLLVD KTPPDSKWLPR+GDWIC 
Sbjct  8    DWECNGCKNNNYAFRSFCNRCKQPRLLVDTKTPPDSKWLPRLGDWICV  55



>emb|CAH67784.1| H0201G08.11 [Oryza sativa Indica Group]
 gb|EEC76649.1| hypothetical protein OsI_14600 [Oryza sativa Indica Group]
Length=347

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C GCGNRNYAFRS CNRCKQPRLLVD  TPPDSKWLPR GDWICT
Sbjct  27   DWDCGGCGNRNYAFRSLCNRCKQPRLLVDPNTPPDSKWLPRAGDWICT  74



>gb|EEE60388.1| hypothetical protein OsJ_13542 [Oryza sativa Japonica Group]
Length=343

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C GCGNRNYAFRS CNRCKQPRLLVD  TPPDSKWLPR GDWICT
Sbjct  23   DWDCGGCGNRNYAFRSLCNRCKQPRLLVDPNTPPDSKWLPRAGDWICT  70



>ref|XP_008788646.1| PREDICTED: uncharacterized protein LOC103706355 isoform X3 [Phoenix 
dactylifera]
Length=374

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  44   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  91



>ref|XP_010526796.1| PREDICTED: calpain-15 [Tarenaya hassleriana]
Length=264

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRLL+D   PPDSKWLPRIGDWICT
Sbjct  8    DWECGGCRNRNYAFRSFCNRCKQPRLLMDTNMPPDSKWLPRIGDWICT  55



>ref|XP_008788643.1| PREDICTED: uncharacterized protein LOC103706355 isoform X1 [Phoenix 
dactylifera]
Length=417

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  44   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  91



>ref|XP_008788647.1| PREDICTED: uncharacterized protein LOC103706355 isoform X4 [Phoenix 
dactylifera]
Length=365

 Score = 95.9 bits (237),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  44   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  91



>gb|KJB70991.1| hypothetical protein B456_011G098800 [Gossypium raimondii]
Length=316

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWECSVCKNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|XP_010941265.1| PREDICTED: uncharacterized protein LOC105059604 [Elaeis guineensis]
Length=392

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  54   DWECGGCRNRNYAFRSLCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  101



>ref|XP_010467593.1| PREDICTED: E3 SUMO-protein ligase RanBP2-like [Camelina sativa]
Length=268

 Score = 94.7 bits (234),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECSGCRNRNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_008799409.1| PREDICTED: uncharacterized protein LOC103714055 [Phoenix dactylifera]
Length=348

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRS CNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  10   DWECGGCRNRNYAFRSLCNRCKQPRLLVDLKTPADSKWLPRIGDWICT  57



>ref|XP_010113362.1| E3 SUMO-protein ligase RanBP2 [Morus notabilis]
 gb|EXC35369.1| E3 SUMO-protein ligase RanBP2 [Morus notabilis]
Length=325

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPR+LVD  TP DSKWLPRIGDWICT
Sbjct  8    DWECGGCKNRNYAFRSFCNRCKQPRILVDVNTPADSKWLPRIGDWICT  55



>gb|EPS67234.1| hypothetical protein M569_07541, partial [Genlisea aurea]
Length=295

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C GC NRNYAFRSFCNRCKQPR+LVD +TP DSKWLPR+GDWICT
Sbjct  10   DWQCGGCNNRNYAFRSFCNRCKQPRILVDVRTPADSKWLPRVGDWICT  57



>gb|AFK38574.1| unknown [Lotus japonicus]
Length=327

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW CS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWICT
Sbjct  8    DWVCSSCNNRNYAFRSFCNRCKQPRLLVDTKTPADSKWLPRIGDWICT  55



>ref|NP_179388.1| zinc finger (Ran-binding) domain-containing protein [Arabidopsis 
thaliana]
 gb|AAM15145.1| predicted protein [Arabidopsis thaliana]
 gb|AAU05460.1| At2g17975 [Arabidopsis thaliana]
 gb|AAU94407.1| At2g17975 [Arabidopsis thaliana]
 gb|AEC06710.1| zinc finger (Ran-binding) domain-containing protein [Arabidopsis 
thaliana]
Length=268

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL++DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCRNRNYAFRSFCNRCKQPRLIMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_002978149.1| hypothetical protein SELMODRAFT_417828 [Selaginella moellendorffii]
 gb|EFJ20806.1| hypothetical protein SELMODRAFT_417828 [Selaginella moellendorffii]
Length=340

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+CSGC NRNYAFRS CNRCKQPR+LVD  TPPDSKWLPRIGDWIC 
Sbjct  11   DWKCSGCSNRNYAFRSLCNRCKQPRILVDTDTPPDSKWLPRIGDWICA  58



>ref|XP_002966415.1| hypothetical protein SELMODRAFT_270595 [Selaginella moellendorffii]
 gb|EFJ32442.1| hypothetical protein SELMODRAFT_270595 [Selaginella moellendorffii]
Length=314

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+CSGC NRNYAFRS CNRCKQPR+LVD  TPPDSKWLPRIGDWIC 
Sbjct  11   DWKCSGCSNRNYAFRSLCNRCKQPRILVDTDTPPDSKWLPRIGDWICA  58



>gb|KFK40174.1| hypothetical protein AALP_AA3G339800 [Arabis alpina]
Length=267

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCSNRNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_006409215.1| hypothetical protein EUTSA_v10022807mg [Eutrema salsugineum]
 gb|ESQ50668.1| hypothetical protein EUTSA_v10022807mg [Eutrema salsugineum]
Length=267

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCSNRNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_009418704.1| PREDICTED: uncharacterized protein LOC103998833 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=340

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFR FCNRCKQPRLLVD  +P D+KWLPR+GDWICT
Sbjct  8    DWECSGCRNRNYAFRCFCNRCKQPRLLVDTMSPADAKWLPRVGDWICT  55



>ref|XP_006298389.1| hypothetical protein CARUB_v10014460mg [Capsella rubella]
 gb|EOA31287.1| hypothetical protein CARUB_v10014460mg [Capsella rubella]
Length=253

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCRNRNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_009418703.1| PREDICTED: uncharacterized protein LOC103998833 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=344

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECSGC NRNYAFR FCNRCKQPRLLVD  +P D+KWLPR+GDWICT
Sbjct  8    DWECSGCRNRNYAFRCFCNRCKQPRLLVDTMSPADAKWLPRVGDWICT  55



>ref|XP_010413257.1| PREDICTED: uncharacterized protein LOC104699615 [Camelina sativa]
Length=265

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCKNRNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_010489438.1| PREDICTED: uncharacterized protein LOC104767103 [Camelina sativa]
Length=265

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCRNRNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>gb|EYU20512.1| hypothetical protein MIMGU_mgv1a009717mg [Erythranthe guttata]
Length=320

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  10   DWECSRCENRNYAFRSFCNRCKQPRLLVDCKTPADSKWLPRIGDWICS  57



>ref|XP_004975002.1| PREDICTED: uncharacterized protein LOC101785033 [Setaria italica]
Length=345

 Score = 92.4 bits (228),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C GCGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  28   DWDCGGCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  75



>gb|EYU20511.1| hypothetical protein MIMGU_mgv1a009717mg [Erythranthe guttata]
Length=333

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWECS C NRNYAFRSFCNRCKQPRLLVD KTP DSKWLPRIGDWIC+
Sbjct  10   DWECSRCENRNYAFRSFCNRCKQPRLLVDCKTPADSKWLPRIGDWICS  57



>gb|AFW57701.1| hypothetical protein ZEAMMB73_045757 [Zea mays]
Length=86

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_009102295.1| PREDICTED: uncharacterized protein LOC103828444 [Brassica rapa]
 emb|CDY38165.1| BnaA07g02180D [Brassica napus]
Length=251

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T  +SKWLPRIGDWICT
Sbjct  8    DWECLGCNNRNYAFRSFCNRCKQPRLFMDNNTSQNSKWLPRIGDWICT  55



>ref|XP_002886140.1| zinc finger (Ran-binding) family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH62399.1| zinc finger (Ran-binding) family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=268

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC N NYAFRSFCNRCKQPRL +DN T P+SKWLPRIGDWICT
Sbjct  8    DWECLGCRNMNYAFRSFCNRCKQPRLFMDNNTSPNSKWLPRIGDWICT  55



>ref|XP_003580622.1| PREDICTED: asparagine-rich protein [Brachypodium distachyon]
Length=342

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWIC  233
            DW+C GCGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWIC
Sbjct  27   DWDCGGCGNRNYAFRSLCNRCKQPRLLVDPHTPRDSKWLPRAGDWIC  73



>ref|NP_001151762.1| LOC100285397 [Zea mays]
 gb|ACG44247.1| Zn-finger, RanBP-type, containing protein [Zea mays]
 gb|AFW57700.1| zn-finger, RanBP-type, containing protein [Zea mays]
Length=190

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICTDSXYMRV  257
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT     R+
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICTALGTKRL  78



>emb|CDY56585.1| BnaC07g48110D [Brassica napus]
Length=260

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DWEC GC NRNYAFRSFCNRCKQPRL +DN T  +SKWLPRIGDWICT
Sbjct  8    DWECLGCNNRNYAFRSFCNRCKQPRLFMDNNTSQNSKWLPRIGDWICT  55



>ref|XP_008662051.1| PREDICTED: LOC100285397 isoform X2 [Zea mays]
Length=317

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  71



>gb|ACR36944.1| unknown [Zea mays]
 tpg|DAA38750.1| TPA: zn-finger, RanBP-type, containing protein isoform 1 [Zea 
mays]
 tpg|DAA38751.1| TPA: zn-finger, RanBP-type, containing protein isoform 2 [Zea 
mays]
 tpg|DAA38752.1| TPA: zn-finger, RanBP-type, containing protein isoform 3 [Zea 
mays]
Length=348

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  28   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  75



>ref|NP_001159007.1| Zn-finger, RanBP-type, containing protein [Zea mays]
 gb|ACG35495.1| Zn-finger, RanBP-type, containing protein [Zea mays]
Length=348

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  28   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  75



>tpg|DAA38753.1| TPA: hypothetical protein ZEAMMB73_060091 [Zea mays]
Length=136

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  28   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  75



>ref|XP_008662050.1| PREDICTED: LOC100285397 isoform X1 [Zea mays]
 gb|AFW57699.1| hypothetical protein ZEAMMB73_045757 [Zea mays]
Length=343

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_002447426.1| hypothetical protein SORBIDRAFT_06g000870 [Sorghum bicolor]
 gb|EES11754.1| hypothetical protein SORBIDRAFT_06g000870 [Sorghum bicolor]
Length=350

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  30   DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  77



>ref|XP_008667522.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=446

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWICT
Sbjct  126  DWDCGSCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWICT  173



>dbj|BAJ93151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=335

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWIC  233
            DW C GCGNRNYAFRS CNRCKQPRLLVD  TP DSKWLPR GDWIC
Sbjct  21   DWYCGGCGNRNYAFRSLCNRCKQPRLLVDPNTPRDSKWLPRAGDWIC  67



>gb|AFW56696.1| hypothetical protein ZEAMMB73_305364 [Zea mays]
Length=86

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICTDS  242
            DW+C  CGNRNYAFRS CNRCK PRLLVD  TP DSKWLPR GDWICT +
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKHPRLLVDPNTPRDSKWLPRAGDWICTAA  73



>ref|NP_001131807.1| hypothetical protein [Zea mays]
 gb|ACF80383.1| unknown [Zea mays]
 gb|AFW56694.1| hypothetical protein ZEAMMB73_305364 [Zea mays]
Length=250

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCK PRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKHPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_008661402.1| PREDICTED: hypothetical protein isoform X5 [Zea mays]
 gb|AFW56695.1| hypothetical protein ZEAMMB73_305364 [Zea mays]
Length=343

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCK PRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKHPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_008661400.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=512

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCK PRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKHPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_008661399.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=561

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCK PRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKHPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_008661398.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=610

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  93   DWECSGCGNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            DW+C  CGNRNYAFRS CNRCK PRLLVD  TP DSKWLPR GDWICT
Sbjct  24   DWDCGSCGNRNYAFRSLCNRCKHPRLLVDPNTPRDSKWLPRAGDWICT  71



>ref|XP_006653104.1| PREDICTED: uncharacterized protein LOC102718733, partial [Oryza 
brachyantha]
Length=314

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = +3

Query  114  GNRNYAFRSFCNRCKQPRLLVDNKTPPDSKWLPRIGDWICT  236
            GNRNYAFRS CNRCKQPRLLVD  TPPDSKWLPR GDWICT
Sbjct  1    GNRNYAFRSLCNRCKQPRLLVDPNTPPDSKWLPRAGDWICT  41



>emb|CAN80816.1| hypothetical protein VITISV_020467 [Vitis vinifera]
Length=126

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  94   IGSVADAGTETTPSEASATDVSSLASW*TTKLLPIPSGSLELAIGSVPIA  243
            IGS ADA TETTPS+ SATD SSLAS  T K  PIP+G L   IGS P+A
Sbjct  60   IGSAADAETETTPSDPSATDASSLASSSTPKPPPIPNGFLASEIGSAPVA  109



>ref|XP_008372786.1| PREDICTED: uncharacterized protein LOC103436140 isoform X2 [Malus 
domestica]
Length=293

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 26/46 (57%), Gaps = 0/46 (0%)
 Frame = +1

Query  508  LDCLLFWLGCAWCVWXNDPIXCTNNNYASRXXCXKCXQPXEVXXMP  645
            L  +  WL C   V  N  I CTNNNYASR  C KC QP EV  MP
Sbjct  9    LVGVRTWLDCGLGVCGNGSIGCTNNNYASREKCKKCGQPKEVAAMP  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000