BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035F10

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFZ41795.1|  putative progesterone 5-beta-reductase                  329   2e-108   Duboisia hopwoodii
gb|ADG41743.1|  putative progesterone 5 beta-reductase                  328   6e-108   Nicotiana tabacum [American tobacco]
ref|XP_009771311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    328   6e-108   Nicotiana sylvestris
dbj|BAH47641.1|  progesterone 5beta reductase-B                         326   2e-107   Nicotiana tabacum [American tobacco]
gb|AIW09143.1|  progesterone 5-beta-reductase 1                         326   3e-107   Catharanthus roseus [chatas]
gb|ADG56540.1|  progesterone 5-beta-reductase                           324   1e-106   Nerium oleander [rose-bay]
ref|XP_006353962.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    323   2e-106   
gb|ADK13080.1|  putative progesterone 5-beta-reductase                  323   5e-106   Nierembergia aristata
ref|XP_009593701.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    322   1e-105   Nicotiana tomentosiformis
gb|ADG46023.1|  progesterone 5-beta-reductase                           321   2e-105   Atropa belladonna [deadly nightshade]
ref|XP_009599751.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    321   3e-105   Nicotiana tomentosiformis
gb|AEX31544.1|  putative steroid 5beta-reductase                        320   5e-105   Solanum tuberosum [potatoes]
ref|NP_001266103.1|  putative steroid 5beta-reductase                   320   5e-105   
ref|XP_009771310.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    318   2e-104   Nicotiana sylvestris
ref|XP_006366601.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    317   8e-104   Solanum tuberosum [potatoes]
ref|XP_002285152.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    316   2e-103   Vitis vinifera
emb|CDO97253.1|  unnamed protein product                                316   2e-103   Coffea canephora [robusta coffee]
ref|XP_011088171.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    314   1e-102   Sesamum indicum [beniseed]
gb|ADG46029.1|  putative progesterone 5-beta-reductase                  314   1e-102   Corchorus capsularis [jute]
gb|AEX31542.1|  putative steroid 5beta-reductase                        313   3e-102   Vitis vinifera
gb|AIW09144.1|  progesterone 5-beta-reductase 2                         312   9e-102   Catharanthus roseus [chatas]
ref|XP_010271744.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    310   4e-101   Nelumbo nucifera [Indian lotus]
gb|KDP41649.1|  hypothetical protein JCGZ_16056                         310   6e-101   Jatropha curcas
ref|XP_004248770.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    306   8e-100   Solanum lycopersicum
ref|XP_008356369.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    306   1e-99    
ref|XP_010111562.1|  hypothetical protein L484_011348                   306   1e-99    Morus notabilis
gb|AEY82379.1|  putative progesterone 5-beta-reductase                  305   4e-99    Withania somnifera [ashwagandha]
gb|ADG46028.1|  putative progesterone 5-beta-reductase                  305   4e-99    Calotropis procera
gb|ADG56539.1|  progesterone 5-beta-reductase                           305   6e-99    Hoya carnosa [honeyplant]
ref|XP_006433107.1|  hypothetical protein CICLE_v10001388mg             304   1e-98    Citrus clementina [clementine]
ref|XP_006367946.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    303   2e-98    Solanum tuberosum [potatoes]
ref|XP_002510123.1|  conserved hypothetical protein                     303   3e-98    
ref|XP_007201077.1|  hypothetical protein PRUPE_ppa006872mg             303   3e-98    Prunus persica
gb|AGO01041.1|  putative progesterone 5-beta-reductase                  302   5e-98    Matthiola tricuspidata
ref|XP_006471790.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    301   1e-97    Citrus sinensis [apfelsine]
ref|XP_008220298.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    301   1e-97    Prunus mume [ume]
gb|EYU37596.1|  hypothetical protein MIMGU_mgv1a007982mg                300   2e-97    Erythranthe guttata [common monkey flower]
gb|ADG56538.1|  progesterone 5-beta-reductase                           300   2e-97    Asclepias curassavica
ref|XP_008377976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    300   2e-97    
gb|ADG56546.1|  progesterone 5-beta-reductase                           300   3e-97    Gomphocarpus fruticosus
gb|KJB58603.1|  hypothetical protein B456_009G217500                    300   4e-97    Gossypium raimondii
ref|XP_006433105.1|  hypothetical protein CICLE_v10001393mg             300   4e-97    Citrus clementina [clementine]
ref|XP_007223026.1|  hypothetical protein PRUPE_ppa006894mg             300   4e-97    
gb|ADG46022.1|  progesterone 5-beta-reductase                           300   5e-97    Mentha x piperita
ref|XP_007136738.1|  hypothetical protein PHAVU_009G070100g             296   7e-97    Phaseolus vulgaris [French bean]
ref|XP_009360382.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    299   8e-97    Pyrus x bretschneideri [bai li]
ref|XP_008393756.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    299   9e-97    
gb|AHZ44504.1|  putative progesterone 5 beta-reductase                  299   9e-97    Cochlearia officinalis [scurvy-grass]
ref|XP_008360976.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    299   9e-97    
ref|XP_004299763.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    299   1e-96    Fragaria vesca subsp. vesca
gb|ABA77556.1|  progesterone 5-beta-reductase                           299   1e-96    Digitalis viridiflora
gb|AFZ42259.1|  putative progesterone 5-beta-reductase                  299   1e-96    Aethionema grandiflorum
gb|AAS93802.1|  progesterone 5-beta-reductase                           299   1e-96    Digitalis grandiflora
ref|XP_008393755.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    299   1e-96    
gb|KDO81567.1|  hypothetical protein CISIN_1g0159921mg                  299   1e-96    Citrus sinensis [apfelsine]
gb|ABA77560.1|  progesterone 5-beta-reductase                           298   1e-96    Digitalis sibirica
gb|AEY82380.1|  putative progesterone 5-beta-reductase                  298   1e-96    Lunaria annua [honesty]
ref|XP_010059860.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    299   1e-96    Eucalyptus grandis [rose gum]
ref|XP_006433602.1|  hypothetical protein CICLE_v10001370mg             299   1e-96    Citrus clementina [clementine]
gb|ABA77558.1|  progesterone 5-beta-reductase                           298   2e-96    Digitalis davisiana
gb|ABA77554.1|  progesterone 5-beta-reductase                           298   2e-96    Digitalis cariensis
ref|XP_006374844.1|  hypothetical protein POPTR_0014s01970g             298   2e-96    
gb|ABK95134.1|  unknown                                                 298   2e-96    Populus trichocarpa [western balsam poplar]
gb|ABA77555.1|  progesterone 5-beta-reductase                           298   2e-96    Digitalis laevigata
gb|AEW67079.1|  putative progesterone 5-beta-reductase                  298   2e-96    Digitalis trojana
gb|AEW67078.1|  putative progesterone 5-beta-reductase                  298   2e-96    Digitalis ferruginea subsp. schischkinii
gb|EYU37597.1|  hypothetical protein MIMGU_mgv11b006498mg               298   2e-96    Erythranthe guttata [common monkey flower]
gb|AAU95076.1|  progesterone 5 beta reductase                           298   3e-96    Digitalis subalpina
gb|ABB36651.1|  progesterone 5beta-reductase                            298   3e-96    Isoplexis canariensis
gb|ABB36652.1|  progesterone 5beta-reductase                            298   3e-96    Isoplexis chalcantha
ref|XP_008236416.1|  PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(...    297   5e-96    
gb|AAU88204.1|  progesterone 5-beta-reductase                           297   5e-96    Digitalis ferruginea [rusty foxglove]
ref|XP_011029002.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    297   6e-96    Populus euphratica
ref|XP_007136737.1|  hypothetical protein PHAVU_009G070100g             297   7e-96    Phaseolus vulgaris [French bean]
ref|XP_011092523.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    296   8e-96    Sesamum indicum [beniseed]
gb|AGT29344.1|  putative progesterone 5-beta reductase 1_2              296   8e-96    Thymus serpyllum [creeping thyme]
gb|KJB58604.1|  hypothetical protein B456_009G217600                    296   9e-96    Gossypium raimondii
gb|AEW67076.1|  putative progesterone 5-beta-reductase                  296   1e-95    Digitalis cariensis
gb|ABB72433.1|  progesterone 5-beta-reductase                           296   1e-95    Digitalis nervosa
gb|ABK96780.1|  unknown                                                 296   1e-95    Populus trichocarpa x Populus deltoides
gb|AHI88614.1|  putative progesterone 5-beta-reductase                  296   2e-95    Hesperis matronalis
emb|CAD87012.1|  putative progesterone 5-beta-reductase                 296   2e-95    Digitalis obscura [willow-leaf foxglove]
ref|XP_004152001.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    296   2e-95    Cucumis sativus [cucumbers]
ref|XP_006471792.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    296   2e-95    Citrus sinensis [apfelsine]
gb|AFZ41796.1|  putative progesterone 5-beta-reductase                  296   2e-95    Sisymbrium officinale
gb|AFZ42257.2|  putative progesterone 5-beta-reductase                  295   2e-95    Thymus serpyllum [creeping thyme]
sp|Q6PQJ9.1|5BPOR_DIGLA  RecName: Full=3-oxo-Delta(4,5)-steroid 5...    295   3e-95    Digitalis lanata [Grecian foxglove]
ref|XP_011088182.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    295   3e-95    Sesamum indicum [beniseed]
ref|XP_009354120.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    295   3e-95    
ref|XP_006433101.1|  hypothetical protein CICLE_v10001374mg             295   3e-95    Citrus clementina [clementine]
gb|ABA77559.1|  progesterone 5-beta-reductase                           295   4e-95    Digitalis lutea [straw foxglove]
gb|AAS93803.1|  progesterone 5-beta-reductase                           295   5e-95    Digitalis parviflora
gb|AJE29749.1|  putative progesterone 5-beta-reductase                  295   5e-95    Cucurbita pepo
emb|CAC80137.1|  progesterone 5-beta-reductase                          295   5e-95    Digitalis purpurea
gb|AIA58905.1|  putative progesterone 5-beta-reductase                  295   5e-95    Malcolmia maritima
ref|XP_003638459.1|  Progesterone 5-beta-reductase                      294   6e-95    
gb|AAS93805.1|  putative progesterone 5-beta-reductase                  294   6e-95    Digitalis purpurea
gb|ABF51668.1|  progesterone 5-beta-reductase                           294   6e-95    Digitalis minor var. minor
ref|XP_006471787.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    295   7e-95    Citrus sinensis [apfelsine]
gb|AIF73578.1|  progesterone 5-beta-reductase                           294   7e-95    Digitalis lanata [Grecian foxglove]
gb|AHZ44508.1|  putative progesterone 5 beta-reductase                  294   7e-95    Stellaria media
gb|AFZ41791.1|  putative progesterone 5-beta-reductase                  294   8e-95    Thymus vulgaris [garden thyme]
gb|AEW67077.1|  putative progesterone 5-beta-reductase                  294   9e-95    Digitalis lamarckii
ref|XP_010277137.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    294   9e-95    Nelumbo nucifera [Indian lotus]
ref|XP_006472269.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    294   1e-94    Citrus sinensis [apfelsine]
ref|XP_009360365.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    294   1e-94    Pyrus x bretschneideri [bai li]
gb|AGT29342.1|  putative progesterone 5-beta reductase                  293   1e-94    Barbarea vulgaris [upland cress]
ref|XP_007018551.1|  NAD(P)-binding Rossmann-fold superfamily pro...    293   1e-94    
gb|AFZ42258.1|  putative progesterone 5-beta-reductase                  293   2e-94    Nasturtium officinale [watercress]
gb|AEX31541.1|  putative steroid 5beta-reductase                        293   2e-94    Armoracia rusticana [horseradish]
gb|KDO81568.1|  hypothetical protein CISIN_1g0159921mg                  293   2e-94    Citrus sinensis [apfelsine]
gb|ADG46027.1|  putative progesterone 5-beta-reductase                  293   3e-94    Coffea arabica [arabica coffee]
ref|XP_006413460.1|  hypothetical protein EUTSA_v10025425mg             293   3e-94    Eutrema salsugineum [saltwater cress]
gb|ABB36654.1|  progesterone 5beta-reductase                            292   3e-94    Isoplexis sceptrum
gb|AGL96526.1|  putative progesterone 5-beta-reductase                  292   4e-94    Brassica rapa subsp. pekinensis [bai cai]
gb|AFW16645.1|  putative progesterone 5beta-reductase                   292   4e-94    Bupleurum falcatum
ref|XP_011016706.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    292   6e-94    Populus euphratica
ref|XP_004289734.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    292   6e-94    Fragaria vesca subsp. vesca
emb|CDY08911.1|  BnaC08g11410D                                          292   7e-94    Brassica napus [oilseed rape]
ref|XP_002869731.1|  hypothetical protein ARALYDRAFT_914168             291   8e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_003525919.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    291   1e-93    Glycine max [soybeans]
gb|ABA77557.1|  progesterone 5-beta-reductase                           291   1e-93    Digitalis ciliata
ref|XP_003598452.1|  Progesterone 5-beta-reductase                      291   2e-93    Medicago truncatula
ref|XP_010673631.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    291   2e-93    Beta vulgaris subsp. vulgaris [field beet]
gb|AGM16376.1|  putative progesterone 5-beta-reductase                  290   2e-93    Cakile maritima [European sea-rocket]
gb|AAU88205.1|  progesterone 5-beta-reductase                           290   3e-93    Digitalis thapsi
ref|XP_008447374.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    290   4e-93    Cucumis melo [Oriental melon]
gb|AAU88203.1|  progesterone 5-beta-reductase                           290   4e-93    Digitalis purpurea subsp. heywoodii
ref|XP_003636813.1|  Progesterone 5-beta-reductase                      290   5e-93    
ref|XP_009109253.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    290   5e-93    Brassica rapa
gb|EPS65468.1|  progesterone 5-beta-reductase                           289   6e-93    Genlisea aurea
gb|AFZ41789.1|  putative progesterone 5-beta-reductase                  289   8e-93    Raphanus sativus
gb|ABB36653.1|  progesterone 5beta-reductase                            289   8e-93    Isoplexis isabelliana
ref|XP_006374846.1|  hypothetical protein POPTR_0014s01980g             288   9e-93    
gb|AHZ44506.1|  putative progesterone 5 beta-reductase                  289   9e-93    Iberis amara [bitter candytuft]
ref|XP_011088183.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    288   1e-92    
gb|AHI88613.1|  putative steroid 5-beta-reductase                       288   1e-92    Sinapis arvensis [charlock mustard]
ref|XP_011017140.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    288   2e-92    Populus euphratica
ref|NP_194153.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase             288   3e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AFN22088.1|  putative progesterone 5-beta-reductase                  287   3e-92    Draba aizoides
ref|XP_006387422.1|  hypothetical protein POPTR_1058s00200g             288   3e-92    
gb|AFW97632.1|  putative progesterone 5-beta-reductase                  287   4e-92    Salvia rosmarinus
ref|XP_011028990.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    287   4e-92    Populus euphratica
gb|ADG56544.1|  progesterone 5-beta-reductase                           287   5e-92    Erysimum crepidifolium
gb|AEO36948.1|  progesterone 5beta-reductase                            287   5e-92    Erysimum capitatum var. purshii
gb|AEZ01594.1|  progesterone 5-beta-reductase                           286   7e-92    Erysimum cheiri [wallflower]
ref|XP_006432523.1|  hypothetical protein CICLE_v10001412mg             286   8e-92    Citrus clementina [clementine]
emb|CDY03474.1|  BnaC01g16080D                                          286   9e-92    
gb|AFK42748.1|  unknown                                                 286   1e-91    Medicago truncatula
ref|XP_006374845.1|  hypothetical protein POPTR_0014s01980g             285   1e-91    
gb|AFK45113.1|  unknown                                                 286   1e-91    Medicago truncatula
gb|AGT29341.1|  putative progesterone 5-beta reductase                  286   1e-91    Cardamine pratensis [cuckoo flower]
ref|XP_010448593.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    286   2e-91    
ref|XP_006283899.1|  hypothetical protein CARUB_v10005016mg             285   2e-91    Capsella rubella
ref|XP_009137807.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    285   2e-91    Brassica rapa
ref|XP_007223050.1|  hypothetical protein PRUPE_ppa006944mg             285   2e-91    
gb|AEZ01593.1|  progesterone 5-beta-reductase                           285   2e-91    Erysimum odoratum
ref|XP_006374842.1|  hypothetical protein POPTR_0014s01950g             285   3e-91    
gb|ADG56545.1|  progesterone 5-beta-reductase                           285   3e-91    Erysimum rhaeticum
emb|CAA68126.1|  unnamed protein product                                285   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222999.1|  hypothetical protein PRUPE_ppa006780mg             285   4e-91    
ref|XP_006284965.1|  hypothetical protein CARUB_v10006268mg             284   5e-91    Capsella rubella
gb|ADG56543.1|  progesterone 5-beta-reductase                           284   5e-91    Erysimum x marshallii
ref|XP_002518657.1|  conserved hypothetical protein                     284   6e-91    Ricinus communis
ref|XP_004501803.1|  PREDICTED: uncharacterized protein LOC101510608    295   1e-90    
gb|AEO36945.1|  progesterone 5beta-reductase                            283   1e-90    Erysimum albescens
gb|AEO36946.1|  progesterone 5beta-reductase                            283   1e-90    Erysimum scoparium
emb|CAN63254.1|  hypothetical protein VITISV_028488                     298   1e-90    Vitis vinifera
ref|XP_003636810.1|  Progesterone 5-beta-reductase                      295   1e-90    
ref|XP_009360311.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    282   3e-90    Pyrus x bretschneideri [bai li]
ref|NP_001078438.1|  3-oxo-Delta(4,5)-steroid 5-beta-reductase          282   4e-90    Arabidopsis thaliana [mouse-ear cress]
gb|ADG56542.1|  progesterone 5-beta-reductase                           282   5e-90    Erysimum capitatum var. purshii
gb|AHZ44505.1|  putative progesterone 5 beta-reductase                  282   5e-90    Draba verna
gb|AGN74845.1|  putative enone 5-beta-reductase                         282   5e-90    Lepidium sativum
ref|XP_010521424.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    281   6e-90    
gb|AIW09145.1|  progesterone 5-beta-reductase 3                         281   7e-90    Catharanthus roseus [chatas]
ref|XP_006471285.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    281   8e-90    Citrus sinensis [apfelsine]
gb|AEO36947.1|  progesterone 5beta-reductase                            281   1e-89    Erysimum caboverdeanum
gb|AAO63776.1|  unknown                                                 281   2e-89    Populus tremuloides
gb|AHZ44509.1|  putative progesterone 5 beta-reductase                  280   2e-89    Thlaspi arvense
ref|XP_009360316.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    280   2e-89    Pyrus x bretschneideri [bai li]
gb|AHZ44507.1|  putative progesterone 5 beta-reductase                  280   3e-89    Isatis tinctoria [woad]
gb|AFZ41790.1|  putative progesterone 5-beta-reductase                  279   6e-89    Spinacia oleracea
ref|XP_006386483.1|  hypothetical protein POPTR_0002s12150g             279   6e-89    
ref|XP_002272271.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    278   9e-89    Vitis vinifera
gb|KJB29426.1|  hypothetical protein B456_005G100200                    278   1e-88    Gossypium raimondii
ref|XP_010530504.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    278   2e-88    Tarenaya hassleriana [spider flower]
ref|XP_006432526.1|  hypothetical protein CICLE_v10001422mg             278   2e-88    
ref|XP_006495338.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    272   2e-88    Citrus sinensis [apfelsine]
ref|XP_008220361.1|  PREDICTED: uncharacterized protein LOC103320460    288   4e-88    Prunus mume [ume]
ref|XP_007223008.1|  hypothetical protein PRUPE_ppa006816mg             276   6e-88    
ref|XP_006432522.1|  hypothetical protein CICLE_v100016291mg            271   7e-88    
ref|XP_006847874.1|  hypothetical protein AMTR_s00029p00093020          276   9e-88    Amborella trichopoda
gb|AIW09146.1|  progesterone 5-beta-reductase 4                         276   9e-88    Catharanthus roseus [chatas]
ref|XP_004300685.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    276   1e-87    Fragaria vesca subsp. vesca
ref|XP_008351978.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    274   5e-87    Malus domestica [apple tree]
ref|XP_003638458.1|  Progesterone 5-beta-reductase                      274   6e-87    
gb|KDO81569.1|  hypothetical protein CISIN_1g0159921mg                  274   6e-87    Citrus sinensis [apfelsine]
ref|XP_008367783.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   7e-87    
ref|XP_006495229.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    274   7e-87    Citrus sinensis [apfelsine]
ref|XP_011022580.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   8e-87    Populus euphratica
gb|AFW16644.1|  putative progesterone 5beta-reductase                   273   1e-86    Passiflora incarnata
ref|XP_011017141.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    273   2e-86    Populus euphratica
ref|XP_006432524.1|  hypothetical protein CICLE_v10001422mg             273   2e-86    Citrus clementina [clementine]
ref|XP_006471280.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    272   4e-86    Citrus sinensis [apfelsine]
ref|XP_007042587.1|  Progesterone 5-beta-reductase, putative isof...    271   6e-86    
ref|XP_011017142.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    271   8e-86    Populus euphratica
ref|XP_011069776.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    271   9e-86    Sesamum indicum [beniseed]
ref|XP_006432505.1|  hypothetical protein CICLE_v10001414mg             271   1e-85    Citrus clementina [clementine]
ref|XP_006433601.1|  hypothetical protein CICLE_v10001445mg             271   1e-85    Citrus clementina [clementine]
ref|XP_006450012.1|  hypothetical protein CICLE_v10013989mg             270   4e-85    Citrus clementina [clementine]
ref|XP_006472267.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    269   5e-85    Citrus sinensis [apfelsine]
ref|XP_002304533.1|  hypothetical protein POPTR_0003s13440g             268   9e-85    Populus trichocarpa [western balsam poplar]
ref|XP_006432519.1|  hypothetical protein CICLE_v10001420mg             267   2e-84    Citrus clementina [clementine]
ref|XP_002302422.2|  hypothetical protein POPTR_0002s12170g             267   2e-84    
emb|CDP01226.1|  unnamed protein product                                266   6e-84    Coffea canephora [robusta coffee]
ref|XP_006471279.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    266   8e-84    Citrus sinensis [apfelsine]
ref|XP_003589112.1|  hypothetical protein MTR_1g018610                  267   1e-83    
ref|XP_010939097.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    268   1e-83    
ref|XP_006472268.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    265   3e-83    Citrus sinensis [apfelsine]
ref|XP_008790041.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    264   5e-83    Phoenix dactylifera
ref|XP_008790634.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    264   6e-83    Phoenix dactylifera
gb|KJB32255.1|  hypothetical protein B456_005G233200                    263   2e-82    Gossypium raimondii
pdb|2V6F|A  Chain A, Structure Of Progesterone 5beta-Reductase Fr...    260   7e-82    Digitalis lanata [Grecian foxglove]
ref|XP_007042586.1|  Progesterone 5-beta-reductase, putative isof...    261   1e-81    
gb|KHN21407.1|  Hypothetical protein glysoja_042470                     257   1e-81    Glycine soja [wild soybean]
gb|ABD33275.2|  progesterone 5-beta-reductase, putative                 259   2e-81    Medicago truncatula
ref|XP_004499012.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    259   3e-81    Cicer arietinum [garbanzo]
ref|XP_011088173.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    258   7e-81    
gb|ABD93571.1|  developmental process IMP                               250   9e-81    Solanum lycopersicum
ref|XP_007226426.1|  hypothetical protein PRUPE_ppa023813mg             256   2e-80    
gb|AHI88616.2|  progesterone 5-beta-reductase                           256   4e-80    Capsella bursa-pastoris
gb|AES59361.2|  3-oxo-delta(4,5)-steroid 5-beta-reductase-like pr...    256   4e-80    Medicago truncatula
ref|XP_010905260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    256   4e-80    Elaeis guineensis
ref|XP_006420622.1|  hypothetical protein CICLE_v10006945mg             256   7e-80    
ref|XP_010905259.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    256   1e-79    Elaeis guineensis
ref|XP_006432518.1|  hypothetical protein CICLE_v10003867mg             253   2e-79    
ref|XP_010497523.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    246   2e-79    
gb|KJB83175.1|  hypothetical protein B456_013G233500                    254   3e-79    Gossypium raimondii
gb|KHG08322.1|  Uncharacterized protein F383_14595                      254   4e-79    Gossypium arboreum [tree cotton]
ref|XP_010099074.1|  hypothetical protein L484_011508                   250   8e-78    
ref|XP_006489807.1|  PREDICTED: uncharacterized protein LOC102610524    260   1e-77    
gb|ABD33273.2|  VEP1 , putative                                         250   2e-77    Medicago truncatula
gb|AHC23071.1|  putative progesterone 5beta-reductase                   248   2e-77    Thymus x citriodorus
ref|XP_003589110.1|  hypothetical protein MTR_1g018590                  249   2e-77    
ref|XP_006432520.1|  hypothetical protein CICLE_v10003925mg             250   3e-77    
gb|AHC23070.1|  putative progesterone 5beta-reductase                   248   3e-77    Thymus x citriodorus
gb|AHC23069.1|  putative progesterone 5beta-reductase                   248   3e-77    Thymus x citriodorus
ref|XP_006374843.1|  hypothetical protein POPTR_0014s01960g             248   9e-77    
ref|XP_006387765.1|  hypothetical protein POPTR_0602s00210g             247   1e-76    
ref|XP_006387764.1|  hypothetical protein POPTR_0602s00200g             248   2e-76    
ref|XP_010905261.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    247   3e-76    Elaeis guineensis
gb|ABK96579.1|  unknown                                                 246   4e-76    Populus trichocarpa x Populus deltoides
ref|XP_010556422.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    244   2e-75    Tarenaya hassleriana [spider flower]
ref|XP_010556421.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    244   3e-75    Tarenaya hassleriana [spider flower]
gb|ABK24388.1|  unknown                                                 243   1e-74    Picea sitchensis
ref|XP_009396895.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    242   2e-74    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011042197.1|  PREDICTED: uncharacterized protein LOC105137942    251   4e-74    Populus euphratica
gb|ABK24243.1|  unknown                                                 241   7e-74    Picea sitchensis
gb|ABR16676.1|  unknown                                                 239   2e-73    Picea sitchensis
emb|CBI22490.3|  unnamed protein product                                237   4e-73    Vitis vinifera
ref|XP_009406008.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    238   7e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16709.1|  unknown                                                 235   9e-72    Picea sitchensis
gb|AFD96485.1|  putative enone 5-beta-reductase                         234   1e-71    Brassica oleracea var. gemmifera
sp|K7WDL7.1|IRIS_CATRO  RecName: Full=Iridoid synthase                  233   4e-71    Catharanthus roseus [chatas]
ref|XP_009137433.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    232   1e-70    Brassica rapa
gb|AIW09147.1|  progesterone 5-beta-reductase 5                         232   1e-70    Catharanthus roseus [chatas]
ref|XP_010687527.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    231   5e-70    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY10994.1|  BnaA03g46530D                                          229   1e-69    Brassica napus [oilseed rape]
emb|CDX92623.1|  BnaC07g38810D                                          227   5e-69    
gb|AHA82033.1|  iridoid synthase                                        227   7e-69    Catharanthus roseus [chatas]
gb|AGN74846.1|  putative enone 5-beta-reductase                         226   2e-68    Brassica juncea var. juncea
ref|XP_006665039.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    223   6e-67    
ref|XP_010520747.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    218   2e-65    Tarenaya hassleriana [spider flower]
tpg|DAA45880.1|  TPA: hypothetical protein ZEAMMB73_620077              219   2e-65    
ref|XP_003562377.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    217   8e-65    Brachypodium distachyon [annual false brome]
gb|AHI88615.1|  putative progesterone 5-beta-reductase                  217   8e-65    Tarenaya spinosa
gb|EAY90583.1|  hypothetical protein OsI_12184                          217   1e-64    Oryza sativa Indica Group [Indian rice]
ref|XP_002465092.1|  hypothetical protein SORBIDRAFT_01g031950          216   2e-64    Sorghum bicolor [broomcorn]
dbj|BAK04809.1|  predicted protein                                      216   2e-64    
dbj|BAJ93442.1|  predicted protein                                      216   3e-64    
ref|NP_001050440.1|  Os03g0436400                                       214   1e-63    
emb|CDP01225.1|  unnamed protein product                                211   2e-62    
emb|CDM86919.1|  unnamed protein product                                209   1e-61    
ref|XP_007201878.1|  hypothetical protein PRUPE_ppa009693mg             204   3e-61    
ref|XP_004983958.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    207   5e-61    
gb|KDO36382.1|  hypothetical protein CISIN_1g046987mg                   196   3e-60    
gb|ACZ66261.1|  progesterone 5beta-reductase 2                          204   7e-60    
gb|ABD33272.2|  hypothetical protein MtrDRAFT_AC158501g31v2             203   1e-59    
ref|XP_006379172.1|  hypothetical protein POPTR_0009s09500g             196   2e-59    
gb|ADL28122.1|  putative progesterone 5-beta-reductase 2                203   2e-59    
ref|XP_003589109.1|  hypothetical protein MTR_1g018580                  201   5e-59    
emb|CDM86889.1|  unnamed protein product                                199   5e-58    
dbj|BAH57049.1|  AT4G24220                                              197   2e-57    
ref|XP_009394340.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    198   2e-57    
ref|XP_009394339.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    198   3e-57    
ref|XP_006339461.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    196   8e-57    
ref|XP_004229838.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    196   8e-57    
ref|XP_002449263.1|  hypothetical protein SORBIDRAFT_05g006930          196   1e-56    
ref|NP_001167740.1|  hypothetical protein                               193   1e-55    
ref|XP_008657260.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    192   4e-55    
ref|XP_002969677.1|  hypothetical protein SELMODRAFT_92604              189   4e-54    
ref|XP_004983959.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    188   1e-53    
ref|XP_009762620.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    187   2e-53    
ref|XP_002967522.1|  hypothetical protein SELMODRAFT_86462              186   2e-53    
ref|XP_002967521.1|  hypothetical protein SELMODRAFT_86439              186   7e-53    
ref|XP_002981288.1|  hypothetical protein SELMODRAFT_444825             186   8e-53    
ref|XP_002960184.1|  hypothetical protein SELMODRAFT_74145              185   2e-52    
ref|XP_002960090.1|  hypothetical protein SELMODRAFT_74346              183   4e-52    
ref|XP_001754205.1|  predicted protein                                  179   2e-50    
ref|XP_010099073.1|  hypothetical protein L484_011507                   178   2e-50    
gb|ACE96881.1|  putative protein                                        174   2e-49    
gb|ACE96889.1|  putative protein                                        174   2e-49    
gb|ACE96904.1|  putative protein                                        172   1e-48    
gb|ACE96903.1|  putative protein                                        171   2e-48    
ref|XP_002984047.1|  hypothetical protein SELMODRAFT_234421             170   4e-47    
ref|NP_001060201.2|  Os07g0601600                                       166   2e-45    
ref|XP_004983960.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    165   3e-45    
gb|KDO53351.1|  hypothetical protein CISIN_1g045430mg                   160   1e-43    
gb|EMT09140.1|  hypothetical protein F775_25898                         147   2e-38    
ref|XP_011069777.1|  PREDICTED: iridoid synthase-like                   147   2e-38    
ref|XP_002991995.1|  hypothetical protein SELMODRAFT_448625             144   4e-37    
ref|XP_002991996.1|  hypothetical protein SELMODRAFT_448626             144   5e-37    
ref|XP_006855299.1|  hypothetical protein AMTR_s00057p00056400          138   2e-36    
ref|XP_002989827.1|  hypothetical protein SELMODRAFT_235888             142   2e-36    
ref|XP_002991994.1|  hypothetical protein SELMODRAFT_186462             141   4e-36    
ref|XP_002960183.1|  hypothetical protein SELMODRAFT_402259             141   4e-36    
ref|XP_002989828.1|  hypothetical protein SELMODRAFT_160458             141   4e-36    
ref|XP_011037153.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    139   2e-35    
ref|XP_002276159.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    136   3e-34    
ref|XP_010649532.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    135   5e-34    
gb|AGI15839.1|  collinsiaXVII-like protein                              130   8e-34    
ref|XP_006372881.1|  hypothetical protein POPTR_0017s05940g             134   1e-33    
gb|ABK96577.1|  unknown                                                 134   1e-33    
ref|XP_006372880.1|  hypothetical protein POPTR_0017s05930g             134   2e-33    
gb|AGI15840.1|  collinsiaXVII-like protein                              130   2e-33    
gb|AGI15841.1|  collinsiaXVII-like protein                              130   2e-33    
gb|AGI15842.1|  collinsiaXVII-like protein                              130   2e-33    
ref|XP_011037089.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    134   2e-33    
gb|AGI15834.1|  collinsiaXVII-like protein                              130   2e-33    
gb|AGI15837.1|  collinsiaXVII-like protein                              130   2e-33    
gb|AGI15835.1|  collinsiaXVII-like protein                              130   2e-33    
gb|AGI15847.1|  collinsiaXVII-like protein                              130   3e-33    
gb|AIW09148.1|  progesterone 5-beta-reductase 6                         133   4e-33    
ref|WP_010795227.1|  hypothetical protein                               132   5e-33    
gb|AGI15844.1|  collinsiaXVII-like protein                              129   6e-33    
ref|WP_039454192.1|  NAD-dependent dehydratase                          129   6e-33    
ref|WP_019366346.1|  NAD dependent epimerase/dehydratase                132   8e-33    
ref|WP_007963504.1|  NAD dependent epimerase/dehydratase                132   1e-32    
ref|WP_007971235.1|  NAD dependent epimerase/dehydratase                132   1e-32    
gb|KHN02917.1|  Hypothetical protein glysoja_009783                     132   1e-32    
ref|XP_003529541.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    132   1e-32    
ref|WP_022559177.1|  MULTISPECIES: hypothetical protein                 131   1e-32    
gb|AGI15852.1|  collinsiaXVII-like protein                              128   1e-32    
ref|XP_007154725.1|  hypothetical protein PHAVU_003G142200g             131   2e-32    
ref|XP_007154349.1|  hypothetical protein PHAVU_003G111300g             131   2e-32    
ref|WP_019303656.1|  NAD dependent epimerase/dehydratase                131   2e-32    
ref|WP_019300231.1|  NAD dependent epimerase/dehydratase                131   2e-32    
gb|AGI15851.1|  collinsiaXVII-like protein                              128   2e-32    
ref|WP_029219948.1|  NAD-dependent dehydratase                          130   2e-32    
ref|WP_010378792.1|  NAD dependent epimerase/dehydratase                130   3e-32    
ref|WP_024745109.1|  NAD-dependent dehydratase                          130   4e-32    
gb|AHA84141.1|  3-oxo-delta(4,5)-steroid 5-beta-reductase               130   4e-32    
ref|WP_039434936.1|  NAD-dependent dehydratase                          130   4e-32    
ref|XP_007154348.1|  hypothetical protein PHAVU_003G111200g             130   5e-32    
ref|XP_006478687.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    130   5e-32    
ref|XP_006443046.1|  hypothetical protein CICLE_v10020613mg             130   6e-32    
gb|EMT17902.1|  hypothetical protein F775_30194                         130   6e-32    
ref|WP_017118699.1|  NAD dependent epimerase/dehydratase                129   6e-32    
ref|WP_002802208.1|  hypothetical protein                               129   6e-32    
gb|AAM36940.1|  conserved hypothetical protein                          130   6e-32    
ref|WP_017166275.1|  NAD dependent epimerase/dehydratase                129   7e-32    
ref|WP_015463169.1|  MULTISPECIES: hypothetical protein                 129   7e-32    
ref|WP_017156613.1|  NAD dependent epimerase/dehydratase                129   7e-32    
ref|WP_033483167.1|  NAD-dependent dehydratase                          129   8e-32    
ref|WP_011347453.1|  NAD dependent epimerase/dehydratase                129   8e-32    
ref|WP_014090247.1|  NAD dependent epimerase/dehydratase                129   8e-32    
ref|WP_008576655.1|  NAD dependent epimerase/dehydratase                129   8e-32    
ref|WP_029819497.1|  NAD-dependent dehydratase                          129   8e-32    
ref|WP_031422845.1|  NAD-dependent dehydratase                          129   8e-32    
ref|XP_006443047.1|  hypothetical protein CICLE_v10023804mg             129   9e-32    
gb|AGI15853.1|  collinsiaXVII-like protein                              126   1e-31    
ref|WP_039409071.1|  NAD-dependent dehydratase                          129   1e-31    
gb|AGI15854.1|  collinsiaXVII-like protein                              125   1e-31    
ref|WP_014507837.1|  NAD dependent epimerase/dehydratase                128   2e-31    
ref|WP_010373324.1|  NAD dependent epimerase/dehydratase                128   2e-31    
ref|WP_042599156.1|  NAD-dependent dehydratase                          128   2e-31    
ref|XP_006443045.1|  hypothetical protein CICLE_v10020568mg             128   2e-31    
ref|WP_005916734.1|  MULTISPECIES: hypothetical protein                 128   2e-31    
ref|WP_042822590.1|  NAD-dependent dehydratase                          128   2e-31    
gb|KDO47326.1|  hypothetical protein CISIN_1g0282581mg                  124   2e-31    
ref|XP_006478688.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    128   2e-31    
ref|WP_005929774.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    127   3e-31    
ref|WP_039577579.1|  NAD-dependent dehydratase                          127   3e-31    
ref|WP_039586834.1|  NAD-dependent dehydratase                          127   3e-31    
gb|KGK58255.1|  NAD-dependent dehydratase                               127   3e-31    
ref|XP_003607179.1|  hypothetical protein MTR_4g073090                  128   3e-31    
dbj|GAE56516.1|  hypothetical protein XPR_3151                          127   4e-31    
ref|XP_009787618.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    127   6e-31    
ref|WP_002631381.1|  Nucleoside diphosphate sugar epimerase             127   6e-31    
ref|WP_012438234.1|  NAD dependent epimerase/dehydratase                127   6e-31    
ref|WP_011037275.1|  NAD dependent epimerase/dehydratase                127   6e-31    
gb|AGI15855.1|  collinsiaXVII-like protein                              124   6e-31    
ref|WP_043095840.1|  NAD-dependent dehydratase                          127   7e-31    
ref|WP_023904087.1|  hypothetical protein                               127   7e-31    
ref|WP_010342645.1|  NAD dependent epimerase/dehydratase                127   7e-31    
ref|XP_003609735.1|  hypothetical protein MTR_4g121570                  127   7e-31    
ref|XP_008384807.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    127   7e-31    
ref|WP_016902584.1|  NAD dependent epimerase/dehydratase                126   8e-31    
ref|WP_039527127.1|  NAD-dependent dehydratase                          126   8e-31    
ref|WP_039521715.1|  NAD-dependent dehydratase                          126   8e-31    
ref|WP_039815830.1|  NAD-dependent dehydratase                          126   8e-31    
ref|WP_006449597.1|  NAD dependent epimerase/dehydratase                126   8e-31    
ref|WP_039514425.1|  NAD-dependent dehydratase                          126   9e-31    
ref|WP_017912517.1|  NAD dependent epimerase/dehydratase                126   9e-31    
ref|WP_007160663.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    126   1e-30    
ref|WP_024938681.1|  NAD-dependent dehydratase                          126   1e-30    
ref|XP_007207642.1|  hypothetical protein PRUPE_ppa021134mg             126   2e-30    
gb|KJB34689.1|  hypothetical protein B456_006G078700                    124   2e-30    
ref|WP_009593554.1|  Putative secreted protein                          125   3e-30    
ref|WP_003474153.1|  hypothetical protein                               124   4e-30    
ref|XP_009371502.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    125   4e-30    
ref|XP_010259353.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    124   5e-30    
ref|WP_003472785.1|  hypothetical protein                               124   5e-30    
ref|XP_010092100.1|  hypothetical protein L484_001148                   122   7e-30    
ref|XP_010043435.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    124   7e-30    
emb|CAQ43088.1|  hypothetical protein                                   124   8e-30    
ref|WP_017914865.1|  NAD dependent epimerase/dehydratase                124   8e-30    
ref|XP_007016112.1|  NAD(P)-binding Rossmann-fold superfamily pro...    124   8e-30    
ref|WP_020715716.1|  hypothetical protein                               124   9e-30    
ref|WP_027601512.1|  MULTISPECIES: NAD-dependent dehydratase            124   9e-30    
ref|WP_020708017.1|  hypothetical protein                               124   1e-29    
ref|WP_042137883.1|  NAD-dependent dehydratase                          123   1e-29    
ref|WP_005995663.1|  NAD dependent epimerase/dehydratase                123   1e-29    
ref|XP_008221108.1|  PREDICTED: iridoid synthase                        124   1e-29    
ref|WP_022974216.1|  NAD dependent epimerase/dehydratase                123   1e-29    
gb|KEH34249.1|  3-oxo-delta(4,5)-steroid 5-beta-reductase-like pr...    123   1e-29    
ref|XP_009603666.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    123   2e-29    
ref|WP_017638618.1|  NAD dependent epimerase/dehydratase                123   2e-29    
gb|KDO36488.1|  hypothetical protein CISIN_1g042242mg                   122   2e-29    
ref|WP_034486429.1|  NAD-dependent dehydratase                          122   2e-29    
ref|WP_039420711.1|  NAD-dependent dehydratase                          122   2e-29    
ref|WP_022520364.1|  hypothetical protein                               122   2e-29    
ref|WP_027957666.1|  MULTISPECIES: NAD-dependent dehydratase            122   2e-29    
ref|XP_009347565.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    122   3e-29    
ref|XP_006488686.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    122   3e-29    
ref|WP_039006558.1|  NAD-dependent dehydratase                          122   4e-29    
gb|KJB83174.1|  hypothetical protein B456_013G233500                    120   4e-29    
ref|WP_038466560.1|  NAD-dependent dehydratase                          122   4e-29    
ref|WP_017909301.1|  NAD dependent epimerase/dehydratase                122   4e-29    
ref|XP_002277965.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    122   5e-29    
ref|WP_015247641.1|  NAD dependent epimerase/dehydratase                121   7e-29    
ref|XP_010098784.1|  hypothetical protein L484_000585                   121   8e-29    
ref|XP_006425059.1|  hypothetical protein CICLE_v10030323mg             121   1e-28    
ref|XP_004500265.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    121   1e-28    
ref|WP_039860768.1|  NAD-dependent dehydratase                          120   1e-28    
ref|XP_003609737.1|  hypothetical protein MTR_4g121590                  120   1e-28    
gb|AGO01040.1|  putative progesterone 5-beta-reductase                  120   2e-28    
ref|WP_007111782.1|  NAD dependent epimerase/dehydratase                120   2e-28    
ref|WP_037336660.1|  NAD-dependent dehydratase                          120   2e-28    
ref|XP_011080861.1|  PREDICTED: iridoid synthase                        119   3e-28    
ref|XP_010685564.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    120   3e-28    
gb|KDO66878.1|  hypothetical protein CISIN_1g0376631mg                  117   5e-28    
ref|WP_026386982.1|  NAD-dependent dehydratase                          119   5e-28    
ref|XP_010671934.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    119   5e-28    
gb|AAP20856.1|  hypothetical protein OSJNBa0032H19.30                   118   5e-28    
ref|WP_020515775.1|  hypothetical protein                               118   7e-28    
ref|WP_037496607.1|  NAD-dependent dehydratase                          118   7e-28    
gb|KJB51009.1|  hypothetical protein B456_008G197000                    119   7e-28    
gb|ABF96680.1|  progesterone 5-beta-reductase, putative                 118   7e-28    
ref|NP_001050389.2|  Os03g0422600                                       117   8e-28    
ref|WP_035576458.1|  NAD-dependent dehydratase                          118   8e-28    
ref|WP_018918183.1|  NAD dependent epimerase/dehydratase                118   8e-28    
ref|XP_011032121.1|  PREDICTED: iridoid synthase                        118   8e-28    
ref|XP_008457377.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    118   9e-28    
ref|XP_008457376.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    118   1e-27    
ref|WP_036303270.1|  NAD-dependent dehydratase                          118   1e-27    
gb|EEE59280.1|  hypothetical protein OsJ_11316                          118   1e-27    
gb|EEC75505.1|  hypothetical protein OsI_12105                          117   1e-27    
ref|XP_004295755.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    118   1e-27    
gb|KGB25251.1|  Nucleoside-diphosphate-sugar epimerase                  114   2e-27    
gb|KHN06235.1|  Hypothetical protein glysoja_030301                     117   2e-27    
ref|WP_015073026.1|  oxidoreductase                                     117   3e-27    
ref|XP_009120390.1|  PREDICTED: iridoid synthase                        117   3e-27    
ref|XP_003552956.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    116   4e-27    
ref|WP_018325470.1|  hypothetical protein                               116   4e-27    
ref|WP_035225966.1|  NAD-dependent dehydratase                          116   5e-27    
emb|CDY52126.1|  BnaA10g29550D                                          116   6e-27    
ref|XP_004145319.1|  PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-r...    116   7e-27    
ref|WP_014819976.1|  NAD dependent epimerase/dehydratase                115   8e-27    
ref|WP_023445534.1|  MULTISPECIES: NAD dependent epimerase/dehydr...    115   9e-27    
emb|CBI19431.3|  unnamed protein product                                110   9e-27    
emb|CDY67905.1|  BnaCnng56900D                                          115   1e-26    
ref|WP_029009262.1|  NAD-dependent dehydratase                          115   1e-26    
gb|EXF43104.1|  NAD-dependent epimerase/dehydratase                     112   1e-26    
ref|WP_018984402.1|  NAD dependent epimerase/dehydratase                114   2e-26    
ref|WP_037095398.1|  NAD-dependent dehydratase                          114   2e-26    
ref|WP_037157291.1|  NAD-dependent dehydratase                          114   2e-26    
ref|WP_007281813.1|  oxidoreductase                                     114   2e-26    
ref|WP_037204462.1|  NAD-dependent dehydratase                          114   2e-26    



>gb|AFZ41795.1| putative progesterone 5-beta-reductase [Duboisia hopwoodii]
Length=388

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 175/192 (91%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K++SVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDIS+ ED  SKLSVLTDVTHVFYVTWA+R TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQCDISNTEDTQSKLSVLTDVTHVFYVTWASRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVL+ +IPN P+L+HICLQTG+KHY G F+++GKVAHD+P HEDLPRL++PNF
Sbjct  118  INGKMFQNVLSVIIPNCPNLRHICLQTGRKHYLGPFELYGKVAHDSPFHEDLPRLDAPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF EV
Sbjct  178  YYTLEDVLFKEV  189



>gb|ADG41743.1| putative progesterone 5 beta-reductase [Nicotiana tabacum]
Length=388

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 175/192 (91%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCDIS+ ED  SKLS+LTDVTHVFYVTWA+R TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVL+ +IPN P+L+HICLQTG+KHY G F+++GKVAHD+P HEDLPRL++PNF
Sbjct  118  INGKMFQNVLSVIIPNCPNLRHICLQTGRKHYLGPFELYGKVAHDSPFHEDLPRLDAPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF EV
Sbjct  178  YYTLEDVLFKEV  189



>ref|XP_009771311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=388

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 175/192 (91%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCDIS+ ED  SKLS+LTDVTHVFYVTWA+R TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVL+ +IPN P+L+HICLQTG+KHY G F+++GKVAHD+P HEDLPRL++PNF
Sbjct  118  INGKMFQNVLSVIIPNCPNLRHICLQTGRKHYLGPFELYGKVAHDSPFHEDLPRLDAPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF EV
Sbjct  178  YYTLEDVLFKEV  189



>dbj|BAH47641.1| progesterone 5beta reductase-B [Nicotiana tabacum]
Length=388

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 174/192 (91%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCDIS+ ED  SKLS+LTDVTHVFYVTWA+R TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVL+ +IPN P+L+HICLQTG+KHY G F+++GKVAHD P HEDLPRL++PNF
Sbjct  118  INGKMFQNVLSVIIPNCPNLRHICLQTGRKHYLGPFELYGKVAHDFPFHEDLPRLDAPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF EV
Sbjct  178  YYTLEDVLFKEV  189



>gb|AIW09143.1| progesterone 5-beta-reductase 1 [Catharanthus roseus]
Length=387

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FE DD   AP K+QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEFDD---APPKYQSVGLILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDISD E+  SKLS LTDVTHVFYVTW N+ TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQCDISDPEETESKLSKLTDVTHVFYVTWTNKSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANGKM RNVLNA+IPN P+L+HICLQTG KHYFG F+ FGK A +TP HEDLPRL+ PNF
Sbjct  118  ANGKMFRNVLNAIIPNCPNLQHICLQTGLKHYFGPFEFFGKAAQETPFHEDLPRLDVPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  178  YYTLEDILFEEV  189



>gb|ADG56540.1| progesterone 5-beta-reductase [Nerium oleander]
Length=387

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 173/192 (90%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+F++DD   AP K+QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKFDDDD---APAKYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EY+QCDISD+EDA SKLS LTDVTHVFYVTWA++ TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPVEYVQCDISDKEDAESKLSKLTDVTHVFYVTWASKSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANGKM RNVL+A+IPN P+L+HICLQTG KHY G F++FGKV H+ P  EDLPRL+ PNF
Sbjct  118  ANGKMFRNVLDAIIPNCPNLQHICLQTGLKHYLGPFELFGKVGHEPPFTEDLPRLDVPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  178  YYTLEDILFEEV  189



>ref|XP_006353962.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 171/192 (89%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+   AP K++SVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---APPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHP+EY+QCDIS+ ED  SKLSVLTDVTHVFYVTWANR  E+ENCE
Sbjct  58   VYGVARRARPSWNADHPIEYVQCDISNPEDTQSKLSVLTDVTHVFYVTWANRSKEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM RNVLN +IPN P L+HICLQTG+KHY G F+++GKV+HD+P HEDLPRL++PNF
Sbjct  118  INGKMFRNVLNVIIPNCPHLRHICLQTGRKHYLGPFELYGKVSHDSPFHEDLPRLDAPNF  177

Query  622  YYTLEDILFDEV  657
            YY LEDILF EV
Sbjct  178  YYVLEDILFKEV  189



>gb|ADK13080.1| putative progesterone 5-beta-reductase [Nierembergia aristata]
Length=387

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWW-AGAIGAAKKKFEEDD---APPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDIS+  D  SKLSVL+DVTHVFYVTWANR TE+ENCE
Sbjct  57   VYGVARRPRPSWNADHPIEYIQCDISNPTDIQSKLSVLSDVTHVFYVTWANRSTEVENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVLN +IPN P+L+HICLQTG+KHY G F++ GKVAHD P  EDLPRL+ PNF
Sbjct  117  INGKMFKNVLNVIIPNCPNLRHICLQTGRKHYLGPFEMLGKVAHDPPFQEDLPRLQVPNF  176

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  177  YYTLEDILFEEV  188



>ref|XP_009593701.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
Length=390

 Score =   322 bits (824),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 173/193 (90%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPL-KHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSWW +GAIGAA+K+ E+DD   AP+ KHQSVALI+GVTGIVGNSLAEILPL+DTPGGPW
Sbjct  1    MSWWWSGAIGAAKKKVEQDD---APVQKHQSVALIIGVTGIVGNSLAEILPLSDTPGGPW  57

Query  259  KVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENC  438
            KVYGVARRPRP+WN+DHP+EYIQCDIS+ ED  SKL++L DVTHVFYVTWA+R TE++NC
Sbjct  58   KVYGVARRPRPSWNADHPIEYIQCDISNPEDTQSKLTLLGDVTHVFYVTWASRSTEIQNC  117

Query  439  EANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPN  618
            E NGKM +N+LNA+IPN P+L HICLQTG+KHY G F++FGKVAHDTPHHE LPRL  PN
Sbjct  118  ETNGKMFKNLLNAIIPNYPNLSHICLQTGRKHYHGPFELFGKVAHDTPHHEGLPRLPVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|ADG46023.1| progesterone 5-beta-reductase [Atropa belladonna]
Length=387

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 169/192 (88%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWW-AGAIGAAKKKFEEDD---APPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DH +EY+QCDIS+ ED  S LS+LTDVTHVFYVTWANR TE+ENCE
Sbjct  57   VYGVARRPRPSWNADHSIEYVQCDISNPEDTQSNLSLLTDVTHVFYVTWANRSTEIENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM RNVLN +IPN P+L+HICLQ G+KHY G F+++GKVAHD+P HEDLPRL  PNF
Sbjct  117  INGKMFRNVLNVIIPNCPNLRHICLQAGRKHYLGPFELYGKVAHDSPFHEDLPRLSGPNF  176

Query  622  YYTLEDILFDEV  657
            YY LEDILF E+
Sbjct  177  YYILEDILFKEM  188



>ref|XP_009599751.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
tomentosiformis]
 dbj|BAH47640.1| progesterone 5beta reductase-A [Nicotiana tabacum]
Length=389

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 175/193 (91%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG+ARRPRP+WN+DHP++YIQCDIS+ ED  SKLS+LTDVTHVFYVTWA+R TE+ENCE
Sbjct  58   VYGLARRPRPSWNADHPIDYIQCDISNPEDTQSKLSLLTDVTHVFYVTWASRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGK-VAHDTPHHEDLPRLESPN  618
             NGKM +NV++ VIPN P+L+HICLQTG+KHY G F+++GK VAHD+P HEDLPRL++PN
Sbjct  118  INGKMFQNVVSVVIPNCPNLRHICLQTGRKHYLGPFELYGKLVAHDSPFHEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF EV
Sbjct  178  FYYTLEDVLFKEV  190



>gb|AEX31544.1| putative steroid 5beta-reductase [Solanum tuberosum]
Length=387

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 171/192 (89%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+   AP K++SVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWW-AGAIGAAKKKFEEDE---APPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHP+EY+QCDIS+ ED  SKLSVLTDVTHVFYVTWANR  E+ENCE
Sbjct  57   VYGVARRARPSWNADHPIEYVQCDISNPEDTQSKLSVLTDVTHVFYVTWANRSKEVENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM RNVLN +IPN P L+HICLQTG+KHY G F+++GKV+HD+P HEDLPRL++PNF
Sbjct  117  INGKMFRNVLNVIIPNCPHLRHICLQTGRKHYLGPFELYGKVSHDSPFHEDLPRLDAPNF  176

Query  622  YYTLEDILFDEV  657
            YY LEDILF EV
Sbjct  177  YYVLEDILFKEV  188



>ref|NP_001266103.1| putative steroid 5beta-reductase [Solanum lycopersicum]
 gb|AEX31545.1| putative steroid 5beta-reductase [Solanum lycopersicum]
Length=387

 Score =   320 bits (820),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 172/192 (90%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FE+D+   AP K++SVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWW-AGAIGAAKKKFEDDE---APPKYESVALIIGVTGIVGNSLAEILPLADTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHP+EY+QCDIS+ ED  SKLSVLTDVTHVFYVTWANR TE+ENCE
Sbjct  57   VYGVARRARPSWNADHPIEYVQCDISNPEDTQSKLSVLTDVTHVFYVTWANRSTEVENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM RNVLN +IPN P+L+HICLQTG+KHY G F+++GKV+HD P HEDLPRL++PNF
Sbjct  117  INGKMFRNVLNVIIPNCPNLRHICLQTGRKHYLGPFELYGKVSHDPPFHEDLPRLDAPNF  176

Query  622  YYTLEDILFDEV  657
            YY LEDILF EV
Sbjct  177  YYVLEDILFKEV  188



>ref|XP_009771310.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nicotiana 
sylvestris]
Length=390

 Score =   318 bits (816),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 173/193 (90%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPL-KHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSWW +GAIGAA+K+ ++DD   AP+ K+QSVALI+GVTGIVGNSLAEILPL+DTPGGPW
Sbjct  1    MSWWWSGAIGAAKKKIDQDD---APIQKYQSVALIIGVTGIVGNSLAEILPLSDTPGGPW  57

Query  259  KVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENC  438
            KVYGVARRPRP+WN+DHP+EYIQCDIS+ ED+ SKL++ +DVTHVFYVTWA+R TE+ENC
Sbjct  58   KVYGVARRPRPSWNADHPIEYIQCDISNPEDSQSKLTLFSDVTHVFYVTWASRSTEIENC  117

Query  439  EANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPN  618
            E NG+M +NVLNA+IPN P+L HICLQTG+KHY G F++FGKV HDTPHHE LPRL  PN
Sbjct  118  ETNGEMFKNVLNAIIPNCPNLSHICLQTGRKHYHGPFELFGKVGHDTPHHEGLPRLPVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>ref|XP_006366601.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   317 bits (812),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+FEEDD    P   QSVALI+GVTGIVGNSLAEILP ADTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKKFEEDD---VPQNFQSVALIIGVTGIVGNSLAEILPCADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN DHP+EYIQCDIS++E+A SKL++LTDVTHVFYVTWANRPTE+ENCE
Sbjct  58   VYGVARRPRPSWNVDHPIEYIQCDISNKEEAQSKLTLLTDVTHVFYVTWANRPTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVL+A+IPN P+L HICLQTG KHY G+F++FGKVAHDTP+HE LPRL    F
Sbjct  118  INGKMFQNVLDAIIPNCPNLSHICLQTGLKHYHGSFELFGKVAHDTPYHEGLPRLPVTIF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+EV
Sbjct  178  YYTQEDILFEEV  189



>ref|XP_002285152.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=390

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 169/193 (88%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+EDD   AP   QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDEDD---APRGFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD EDA +KLS LTDVTHVFYVTW NR TE+ENCE
Sbjct  58   VYGVARRPRPDWNADHPVEYIQCDISDSEDALAKLSPLTDVTHVFYVTWTNRATEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL A+IPN+P+L+HICLQTG KHY G F+ FGK+  HD P+HEDLPRL++PN
Sbjct  118  ANGTMLRNVLRALIPNAPNLRHICLQTGGKHYIGPFEAFGKIKPHDPPYHEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+E 
Sbjct  178  FYYTLEDILFEEC  190



>emb|CDO97253.1| unnamed protein product [Coffea canephora]
Length=387

 Score =   316 bits (809),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP ++QSVALIVGVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APPQYQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG+ARRPRP+WN+DHP+ YIQCDISD +D  SKLS L D+TH+FYVTWANR TEL+NC+
Sbjct  58   VYGLARRPRPSWNADHPIHYIQCDISDPQDTQSKLSHLDDITHLFYVTWANRSTELDNCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NG M RN+L+AVIP+SP+L+HICLQTG+KHY G F++FGKV HD P HEDLPRL+  NF
Sbjct  118  VNGNMFRNLLSAVIPSSPNLRHICLQTGRKHYLGPFELFGKVGHDPPFHEDLPRLDVQNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  178  YYTLEDILFEEV  189



>ref|XP_011088171.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Sesamum 
indicum]
Length=389

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 168/193 (87%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+   AP KH+SVALIVGVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKIEEDE---APRKHESVALIVGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN D+P+ YIQCD+SD +DA +KLS LTD+THVFYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPSWNDDNPINYIQCDVSDPDDAQAKLSTLTDITHVFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVL+AVIPN P LKHICLQTG+KHY G F++FGK+  HD P+ EDLPRL   N
Sbjct  118  ANGKMLKNVLDAVIPNCPKLKHICLQTGRKHYIGPFEIFGKIETHDPPYTEDLPRLNYIN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|ADG46029.1| putative progesterone 5-beta-reductase [Corchorus capsularis]
 gb|ADK11283.1| putative progesterone 5-beta-reductase [Corchorus olitorius]
Length=387

 Score =   314 bits (804),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 170/192 (89%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+EDD   AP ++QSVALIVGVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDEDD---APPQYQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG+ARRPRP+WN+DHP+ YIQCDISD +D  SKLS L D+TH+FYVTWANR TEL+NC+
Sbjct  58   VYGLARRPRPSWNADHPIHYIQCDISDPQDTQSKLSHLDDITHLFYVTWANRSTELDNCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NG M RN+L+AVIP+SP+L+HICLQTG+KHY G F++FGKV HD P HEDLPRL+  NF
Sbjct  118  VNGNMFRNLLSAVIPSSPNLRHICLQTGRKHYLGPFELFGKVGHDPPFHEDLPRLDVHNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  178  YYTLEDILFEEV  189



>gb|AEX31542.1| putative steroid 5beta-reductase [Vitis vinifera]
Length=390

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 169/193 (88%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+EDD   AP   Q+V L++GVTGIVG+SLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDEDD---APRGFQNVGLVIGVTGIVGDSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD EDA +KLS LTDVTHVFYVTW NR TE+ENCE
Sbjct  58   VYGVARRPRPDWNADHPVEYIQCDISDSEDALAKLSPLTDVTHVFYVTWTNRATEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL A+IPN+P+L+HICLQTG KHY G F+ FGK+  HD P+HEDLPRL++PN
Sbjct  118  ANGTMLRNVLRALIPNAPNLRHICLQTGGKHYIGPFEAFGKIKPHDPPYHEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+E 
Sbjct  178  FYYTLEDILFEEC  190



>gb|AIW09144.1| progesterone 5-beta-reductase 2 [Catharanthus roseus]
Length=389

 Score =   312 bits (799),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 168/194 (87%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIG A+++    DD DAP K+QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGVAKRKL---DDFDAPPKYQSVGLILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDISD EDA S LS LTDVTHVFYVTWA++ TE+ENCE
Sbjct  58   VYGVARRPRPSWNADHPVEYIQCDISDPEDAQSMLSKLTDVTHVFYVTWASKSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGK--VAHDTPHHEDLPRLESP  615
             N KM RNVLNA+IPN P+L+HICLQTG KHY G F++FGK  VAH+ P HE+LPRL+ P
Sbjct  118  VNSKMFRNVLNAIIPNCPNLQHICLQTGLKHYLGPFELFGKAAVAHEPPFHEELPRLDVP  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLEDILF+EV
Sbjct  178  NFYYTLEDILFEEV  191



>ref|XP_010271744.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=389

 Score =   310 bits (794),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED     PLKHQSV LI+GVTG+VGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDV---VPLKHQSVGLIIGVTGVVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCD+SD E+  SKLS LTDVTH+FYVTW NR TE  NCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQCDVSDPEETQSKLSPLTDVTHIFYVTWTNRHTESANCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL AVIPN+P+L HICLQTG KHY G F+ FG++  HD P HEDLPRL  PN
Sbjct  118  ANGAMLRNVLTAVIPNAPNLNHICLQTGLKHYVGPFESFGRIQPHDPPFHEDLPRLNVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT+EDIL +EV
Sbjct  178  FYYTMEDILLEEV  190



>gb|KDP41649.1| hypothetical protein JCGZ_16056 [Jatropha curcas]
Length=390

 Score =   310 bits (793),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD   AP  +QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---APRSYQSVGLVLGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD+ +  SKLS LTDVTH+FYVTWANR +E ENCE
Sbjct  58   VYGVARRPRPNWNADHPIEYIQCDISDQAETQSKLSQLTDVTHIFYVTWANRSSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L HICLQTG KHY G F++ GK+  HD P  EDLPRL++PN
Sbjct  118  INGLMFRNVLQAVIPNAPNLGHICLQTGTKHYLGPFELLGKIQPHDPPFSEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>ref|XP_004248770.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
lycopersicum]
Length=385

 Score =   306 bits (785),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 167/192 (87%), Gaps = 6/192 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K F+ED++       QSVALI+GVTGIVGNSLA ILP ADTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKIFDEDENF------QSVALIIGVTGIVGNSLAAILPCADTPGGPWK  54

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN + P+EYIQCDIS+ E+  S+L++LTD+THVFYVTWANRPTE+ENCE
Sbjct  55   VYGVARRPRPPWNVNDPIEYIQCDISNREETQSRLTLLTDITHVFYVTWANRPTEVENCE  114

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKML+NVL+A+IPN P+L HICLQTG KHY G+F++FGK+AHDTP+HE LPRL  PNF
Sbjct  115  INGKMLQNVLDAIIPNCPNLCHICLQTGLKHYHGSFELFGKIAHDTPYHEGLPRLPVPNF  174

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  175  YYTLEDILFEEV  186



>ref|XP_008356369.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=391

 Score =   306 bits (785),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 167/193 (87%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K F+ +D    P K+QSVAL++GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKTFDPND---VPPKYQSVALVLGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP+EYIQCD+SD    HS+LS LTDVTHVFYVTWA++PTE ENCE
Sbjct  58   VYGVARRPRPAWNADHPVEYIQCDLSDPHQTHSQLSQLTDVTHVFYVTWASKPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RN+L+AVI N+P+L+HICLQTG+KHY G F++ GKV  H+ P HEDLPRL+ PN
Sbjct  118  VNGNMFRNLLDAVISNAPNLQHICLQTGRKHYIGPFEILGKVEPHEPPFHEDLPRLDVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>ref|XP_010111562.1| hypothetical protein L484_011348 [Morus notabilis]
 gb|EXC31269.1| hypothetical protein L484_011348 [Morus notabilis]
Length=389

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEE++   AP+ +QSV L+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEENE---APISYQSVGLVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGV RRPRP WN+DHP+EYIQCDISD ED ++KLS LTDVTH+FYVTWANR TE+ENCE
Sbjct  58   VYGVGRRPRPNWNADHPIEYIQCDISDPEDTNTKLSTLTDVTHIFYVTWANRATEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M  NVL A+IPN+P+L HICLQTG KHY G F+ FGK+  HD P  EDLPRLE PN
Sbjct  118  VNGAMFHNVLRALIPNAPNLSHICLQTGTKHYIGPFESFGKIKPHDPPFTEDLPRLEYPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+L +EV
Sbjct  178  FYYTLEDVLQEEV  190



>gb|AEY82379.1| putative progesterone 5-beta-reductase [Withania somnifera]
Length=388

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+   AP K+QSVALI+GVTGIVGNSLA+ILPLADTPGGPWK
Sbjct  1    MSWW-AGAIGAAKKKLEEDE---APPKYQSVALIIGVTGIVGNSLADILPLADTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHPMEYIQCDIS+ ED  SKLS+LTDVTHVFYV  A R TE+ENCE
Sbjct  57   VYGVARRSRPSWNTDHPMEYIQCDISNAEDTQSKLSLLTDVTHVFYVASAKRSTEVENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NV+N +IPN P+L+HICLQTG+KHY G  +++GK AHD P HE+LPRL++PNF
Sbjct  117  INGKMFQNVVNVIIPNCPELRHICLQTGRKHYLGPLELYGKGAHDPPFHEELPRLDAPNF  176

Query  622  YYTLEDILFDEV  657
            YY LEDILF EV
Sbjct  177  YYVLEDILFKEV  188



>gb|ADG46028.1| putative progesterone 5-beta-reductase [Calotropis procera]
Length=387

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+    DD  A  K QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKK---TDDYTALTKFQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP+EY+QCDI++ ED   KLS LTDVTHVFYVTWAN+  E+ENCE
Sbjct  58   VYGVARRPRPAWNADHPIEYVQCDIANREDTEEKLSKLTDVTHVFYVTWANKSNEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKML+NVL+A+IPN P L+HICLQTG KHY G F++FGKV H+ P  EDLPRL+ PNF
Sbjct  118  VNGKMLKNVLDALIPNCPKLQHICLQTGGKHYCGPFELFGKVGHEPPFTEDLPRLDVPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+ V
Sbjct  178  YYTLEDVLFEAV  189



>gb|ADG56539.1| progesterone 5-beta-reductase [Hoya carnosa]
Length=387

 Score =   305 bits (780),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+    DD +AP K+QSVALI+GVTGIVG+SLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKK---SDDYEAPSKYQSVALIIGVTGIVGSSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+D P+EY+QCDI + ED  SKLS LTDVTHVFYVTWA++  E+ENCE
Sbjct  58   VYGVARRPRPAWNADCPIEYVQCDIGNREDTESKLSKLTDVTHVFYVTWASKSNEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +N L+A+IPN P+L+HICLQTG KHY G F+++GKV H++P+ EDLPRL++PNF
Sbjct  118  VNGKMFKNALDALIPNCPNLQHICLQTGGKHYAGPFELWGKVGHESPYTEDLPRLDAPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+ V
Sbjct  178  YYTLEDVLFEAV  189



>ref|XP_006433107.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
 gb|ESR46347.1| hypothetical protein CICLE_v10001388mg [Citrus clementina]
Length=397

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 1/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEE++    P  +Q V L++GVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEENERPPQPQDYQHVGLLIGVTGIVGNSLAEILPRQDTPGGPWK  60

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SDE+D  +KL+ LTDVTH+FYVTWA+RPTE ENCE
Sbjct  61   VYGVARRPRPDWNADHPIEYIQCDVSDEDDTQAKLTKLTDVTHIFYVTWASRPTEAENCE  120

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+H+CLQTG KHY G F+ FGK+  HDTP  EDLPRL  PN
Sbjct  121  VNGAMLRNVLRSVIPNAPNLRHVCLQTGAKHYVGPFESFGKIRPHDTPFTEDLPRLNVPN  180

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  181  FYYTQEDILFEEV  193



>ref|XP_006367946.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Solanum 
tuberosum]
Length=388

 Score =   303 bits (777),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 164/192 (85%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW + AIGA +++ EEDD    P K QSV LI+GVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWSRAIGATKEKVEEDD---VPKKCQSVGLIIGVTGIVGNSLAEILPGTDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN ++P+EYIQCDIS  E+  SKL++LTDVTHVFYVTWA RPTELENCE
Sbjct  58   VYGVARRPRPSWNVNYPIEYIQCDISSPEETQSKLTLLTDVTHVFYVTWAIRPTELENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKM +NVL+A+IPN P+L HICLQTG KHY G+F++F K+AHDTP+HE LPRL +PNF
Sbjct  118  INGKMFQNVLDAIIPNCPNLSHICLQTGLKHYHGSFELFEKIAHDTPYHEGLPRLPAPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+EV
Sbjct  178  YYTLEDILFEEV  189



>ref|XP_002510123.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52310.1| conserved hypothetical protein [Ricinus communis]
Length=390

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP   QSVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKQEEDD---APRSFQSVALVLGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD  +  SKLS LTD+TH+FYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPTWNADHPVEYIQCDISDSAETQSKLSQLTDITHIFYVTWTNRQSEDENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+HICLQTG KHY G F+  GK+  HD P  EDLPRL++PN
Sbjct  118  INGLMFRNVLQAVIPNAPNLRHICLQTGAKHYVGPFESLGKIQTHDPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDI+F+EV
Sbjct  178  FYYTLEDIMFEEV  190



>ref|XP_007201077.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
 gb|EMJ02276.1| hypothetical protein PRUPE_ppa006872mg [Prunus persica]
Length=392

 Score =   303 bits (775),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 167/193 (87%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+ +D   AP K+QSVAL+ GVTGIVGNSLA+ILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDPND---APPKYQSVALVAGVTGIVGNSLADILPLPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN+DHP+EYIQCD+SD    HS+LS LTDVTH+FYVTWA++PTE ENCE
Sbjct  58   VYGVARRARPDWNADHPIEYIQCDLSDPHQTHSELSQLTDVTHIFYVTWASKPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG M RN+L+AVIPN+P+L+HICLQTG+KHY G+F++ GKV  H+ P HEDLPRL  PN
Sbjct  118  ANGNMFRNLLDAVIPNAPNLQHICLQTGRKHYVGSFEMLGKVEPHEPPFHEDLPRLNVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|AGO01041.1| putative progesterone 5-beta-reductase [Matthiola tricuspidata]
Length=387

 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLEEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCDISD EDA SKLS L DVTHVFYVTW NRP+E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDISDAEDARSKLSSLADVTHVFYVTWTNRPSEGENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+H+CLQTG KHY G F   GK  HD P  EDLPRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHVCLQTGTKHYLGPFDNLGKSHHDPPFTEDLPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>ref|XP_006471790.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471791.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=397

 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 1/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEE++    P  +Q V L++GVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEENERPPQPQDYQHVGLLIGVTGIVGNSLAEILPRQDTPGGPWK  60

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SDE+D  +KL+ LTDVTH+FYVTWA+RPTE ENCE
Sbjct  61   VYGVARRPRPDWNTDHPIEYIQCDVSDEDDTQAKLTKLTDVTHIFYVTWASRPTEAENCE  120

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+H+CLQTG KHY G  + FGK+  HDTP  EDLPRL  PN
Sbjct  121  VNGAMLRNVLRSVIPNAPNLRHVCLQTGAKHYLGPSESFGKIRPHDTPFTEDLPRLNVPN  180

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  181  FYYTQEDILFEEV  193



>ref|XP_008220298.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Prunus mume]
 ref|XP_008220299.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Prunus mume]
 ref|XP_008220300.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Prunus mume]
Length=391

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 166/193 (86%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+F+ED+   AP   +SV L++GVTGIVGNSLAEILP++DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKFDEDE---APRSPESVGLVIGVTGIVGNSLAEILPISDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD +DA +KLS L+DVTH+FYVTW NR TE E+CE
Sbjct  58   VYGVARRPRPNWNADHPVEYIQCDISDADDAKAKLSPLSDVTHIFYVTWTNRSTEAESCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG M RNVLN+VIPN+P+L+H+CLQTG KHY G F+ FGK+  H++P  EDLPRL+ PN
Sbjct  118  ANGAMFRNVLNSVIPNAPNLRHVCLQTGAKHYVGPFEAFGKIQPHESPFTEDLPRLDYPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF EV
Sbjct  178  FYYTLEDLLFAEV  190



>gb|EYU37596.1| hypothetical protein MIMGU_mgv1a007982mg [Erythranthe guttata]
Length=389

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+      KHQ+VALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKIDEDEPQQ---KHQAVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN D+P+ YI+CDISD +D  +KLS LTD+THVFYVTWANR TE+ENCE
Sbjct  58   VYGVARRPRPTWNDDNPINYIRCDISDPDDIQAKLSPLTDITHVFYVTWANRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            +NGKML+NVL+ VIPNSP+LKHICLQTG+KHY G F+ +GK+  HD P+ EDLPRL   N
Sbjct  118  SNGKMLKNVLDVVIPNSPNLKHICLQTGRKHYIGPFESYGKIETHDPPYSEDLPRLNYIN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF EV
Sbjct  178  FYYTLEDILFAEV  190



>gb|ADG56538.1| progesterone 5-beta-reductase [Asclepias curassavica]
Length=387

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+    DD  A  K QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKK---TDDYSALTKFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP+EY+QCDI++ ED   KLS LTDVTHVFYVTWAN+  E+ENCE
Sbjct  58   VYGVARRPRPAWNADHPIEYVQCDIANREDTEEKLSKLTDVTHVFYVTWANKSNEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKML+NVL+ +IPN P L+H+CLQTG KHY G F+++GKV H+ P  EDLPRL+ PNF
Sbjct  118  VNGKMLKNVLDVLIPNCPKLQHVCLQTGGKHYCGPFELYGKVGHEPPFTEDLPRLDVPNF  177

Query  622  YYTLEDILFDEV  657
            YY+LED+LF+ V
Sbjct  178  YYSLEDVLFEAV  189



>ref|XP_008377976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
 ref|XP_008347607.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+FEED+ L  P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKFEEDEHLRGP---QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DH +EYIQCDISD +DA +KLS LTDVTH+FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPNWNADHLVEYIQCDISDPDDAKAKLSPLTDVTHIFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL++VIPN+P L HICLQTG KHY G F+ FGK+  HD P  EDLPRL++PN
Sbjct  118  VNGNMLRNVLDSVIPNAPKLSHICLQTGAKHYVGPFESFGKIQPHDPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF EV
Sbjct  178  FYYTQEDLLFAEV  190



>gb|ADG56546.1| progesterone 5-beta-reductase [Gomphocarpus fruticosus]
Length=388

 Score =   300 bits (768),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAAR++  + DD  A  K QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAARQK--KTDDYTALTKFQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP+EY+QCDI++ ED   KLS LTDVTHVFYVTWAN+  E+ENCE
Sbjct  59   VYGVARRPRPAWNADHPIEYVQCDIANREDTEEKLSKLTDVTHVFYVTWANKSNEIENCE  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NGKML+NVL+ ++PN P L+H+CLQTG KHY G F+++GKV H+ P  EDLPRL+ PNF
Sbjct  119  VNGKMLKNVLDVLVPNCPKLQHVCLQTGGKHYCGPFELYGKVGHEPPFTEDLPRLDVPNF  178

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+ V
Sbjct  179  YYTLEDVLFEAV  190



>gb|KJB58603.1| hypothetical protein B456_009G217500 [Gossypium raimondii]
Length=391

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+   AP   QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---APRSFQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SD  D  SKLS LTDVTH+FYV+W NR +E ENCE
Sbjct  58   VYGVARRPRPNWNADHPIEYIQCDVSDPNDTESKLSQLTDVTHIFYVSWINRTSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL++VIPN+P+L+HICLQTG KHY G F++ GK+  HD P  EDLPRL +PN
Sbjct  118  INGSMLRNVLHSVIPNAPNLRHICLQTGAKHYLGPFELLGKIQPHDPPFTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+E+
Sbjct  178  FYYHQEDILFEEI  190



>ref|XP_006433105.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
 gb|ESR46345.1| hypothetical protein CICLE_v10001393mg [Citrus clementina]
Length=397

 Score =   300 bits (769),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 161/193 (83%), Gaps = 1/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+    P  +Q V L++G+TGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDERPPQPQDYQHVGLVIGITGIVGNSLAEILPRQDTPGGPWK  60

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG ARRPRP WN+DHP+EYIQCD+SD++D  +KL+ LTDVTH+FYVTWA+RPTE ENCE
Sbjct  61   VYGAARRPRPDWNTDHPIEYIQCDVSDQDDTQAKLTKLTDVTHIFYVTWASRPTEAENCE  120

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+H+CLQTG KHY G  + FGK+  HDTP  EDLPRL  PN
Sbjct  121  VNGTMLRNVLRSVIPNAPNLRHVCLQTGAKHYLGPSESFGKIRPHDTPFTEDLPRLNVPN  180

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  181  FYYTQEDILFEEV  193



>ref|XP_007223026.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
 gb|EMJ24225.1| hypothetical protein PRUPE_ppa006894mg [Prunus persica]
Length=391

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+F+ED+   AP   +SV L++GVTGIVGNSLAEILP++DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKFDEDE---APRSPESVGLVIGVTGIVGNSLAEILPISDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD +DA +KLS L+DVTH+FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPNWNADHPVEYIQCDISDADDAKAKLSPLSDVTHIFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG M RNVLN+VIPN+P+L+H+CLQTG KHY G F+ FGK+  H+ P  EDLPRL+ PN
Sbjct  118  ANGAMFRNVLNSVIPNAPNLRHVCLQTGAKHYVGPFEAFGKIQPHEPPFTEDLPRLDYPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT+ED+LF E+
Sbjct  178  FYYTMEDLLFAEM  190



>gb|ADG46022.1| progesterone 5-beta-reductase [Mentha x piperita]
Length=389

 Score =   300 bits (768),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+   AP  +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDE---APPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS LTD+T++FYVTW N+ TE ENCE
Sbjct  58   VYGVARRPRPAWNDDHPITYIRCDVSDSGDAKEKLSPLTDLTNIFYVTWTNKSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVL+A+IPN P+LKH+CL TG+KHY G F+  GK+ AHD P  EDLPRL+ PN
Sbjct  118  ANGKMLKNVLDALIPNCPNLKHVCLLTGRKHYVGPFESVGKIRAHDPPFTEDLPRLDCPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>ref|XP_007136738.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
 gb|ESW08732.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
Length=295

 Score =   296 bits (758),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+    P   +SV L++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---PPRSFESVGLVIGVTGIVGNSLAEILPLHDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EY+QCD+SD  DA SKLSVLTDVTHVF+V+W NRPTE ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYVQCDVSDPADAESKLSVLTDVTHVFFVSWTNRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ LQTG KHY G+F+  GK+ +H+ P  EDLPRL++PN
Sbjct  118  VNGAMLQNVLRAVIPNAPNLRHVSLQTGTKHYLGSFESIGKIQSHEPPFTEDLPRLDTPN  177

Query  619  FYYTLEDILFDE  654
            FYY  EDILF+E
Sbjct  178  FYYNQEDILFEE  189



>ref|XP_009360382.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+F+E++    P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKFDEEE---PPRTPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD +DA +KLS +TDVTH+FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPNWNADHPVEYIQCDISDPDDAKTKLSPITDVTHIFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  MLRNVLN+VIPN+P L+H+CLQTG KHY G F++FGK+  H+ P  EDLPRL++PN
Sbjct  118  ANAVMLRNVLNSVIPNAPKLQHVCLQTGAKHYVGPFELFGKIQPHEPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF EV
Sbjct  178  FYYTLEDLLFAEV  190



>ref|XP_008393756.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   299 bits (766),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ +ED+   AP   +SV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKADEDEQPRAP---ESVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++DHP+EY+QCD+SD EDA +KLS LTDVTH+FYVTWANR TE+ENCE
Sbjct  58   VYGVARRPRPNWSADHPIEYVQCDVSDPEDAKTKLSPLTDVTHIFYVTWANRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+HICLQTG KHY G F+ FGK+  HD P  EDLPRL++PN
Sbjct  118  VNGNMLRNVLESVIPNAPNLRHICLQTGGKHYLGPFESFGKIQPHDPPFTEDLPRLDTPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF EV
Sbjct  178  FYYTQEDLLFAEV  190



>gb|AHZ44504.1| putative progesterone 5 beta-reductase [Cochlearia officinalis]
Length=389

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR +ED+ +     ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKRIDEDEPIQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WNSDHP++YIQCD+SD EDA SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNSDHPIDYIQCDVSDAEDARSKLSPLTDVTHVFYVTWTKRESETENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL AV+P++P+L H+CLQTG KHY G F+  GK  H+ P  EDLPRL+  NF
Sbjct  118  ANGSMLRNVLRAVVPHAPNLVHVCLQTGTKHYIGPFENIGKSHHEAPFTEDLPRLQVANF  177

Query  622  YYTLEDILFDEV  657
            YY+LED+LF+E+
Sbjct  178  YYSLEDVLFEEI  189



>ref|XP_008360976.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   299 bits (766),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ +ED+   AP   +SV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKADEDEQPRAP---ESVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++DHP+EY+QCD+SD EDA +KLS LTDVTH+FYVTWANR TE+ENCE
Sbjct  58   VYGVARRPRPNWSADHPIEYVQCDVSDPEDAKTKLSPLTDVTHIFYVTWANRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+HICLQTG KHY G F+ FGK+  HD P  EDLPRL++PN
Sbjct  118  VNGNMLRNVLESVIPNAPNLRHICLQTGGKHYLGPFESFGKIQPHDPPFTEDLPRLDTPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF EV
Sbjct  178  FYYTQEDLLFAEV  190



>ref|XP_004299763.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=390

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+  ED+    P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKLVEDE---GPRTPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SD +DA  KLS LTDVTH+FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPNWNADHPVEYIQCDVSDADDAKGKLSPLTDVTHIFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  MLRNVL +VIPN+P+LKHICLQTG KHY G+F+ +GK+  HD+P  EDLPRL+ PN
Sbjct  118  ANAAMLRNVLGSVIPNAPNLKHICLQTGAKHYIGSFESWGKIQPHDSPFTEDLPRLDVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF+EV
Sbjct  178  FYYTQEDLLFEEV  190



>gb|ABA77556.1| progesterone 5-beta-reductase [Digitalis viridiflora]
Length=389

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIILEEV  190



>gb|AFZ42259.1| putative progesterone 5-beta-reductase [Aethionema grandiflorum]
Length=388

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F   DD +    +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKF---DDYEPTQSYQSVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDIS+ E+A SKLS LTDVTHVFYVTW  R TELENCE
Sbjct  58   VYGVARRPRPNWNTDHPIEYIQCDISNAEEARSKLSPLTDVTHVFYVTWTQRSTELENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL AVIP++ +L+H+CLQTG KHY G F   GK  H+ P  EDLPRL+ PNF
Sbjct  118  ANGSMLRNVLQAVIPHASNLQHVCLQTGTKHYVGPFDNLGKSHHEAPFTEDLPRLQIPNF  177

Query  622  YYTLEDILFDEV  657
            YY  EDILF+E+
Sbjct  178  YYVQEDILFEEI  189



>gb|AAS93802.1| progesterone 5-beta-reductase [Digitalis grandiflora]
Length=389

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_008393755.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=390

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 164/192 (85%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+F+E++    P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKFDEEE---PPRXPQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCDISD +DA +KLS LTDVTH+FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPNWNADHPVEYIQCDISDPDDAKTKLSPLTDVTHIFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  MLRNVLN+VIPN+P L+H+CLQTG KHY G F++FGK+  H+ P  EDLPRL++PN
Sbjct  118  ANAVMLRNVLNSVIPNAPKLQHVCLQTGAKHYVGPFELFGKIQPHEPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDE  654
            FYYTLED+LF E
Sbjct  178  FYYTLEDLLFAE  189



>gb|KDO81567.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=397

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+FEED+   +   +QSVALIVGVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKFEEDEPARS---YQSVALIVGVTGIVGNSLAEILPLPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P WN+DH +EY+QCD+SD E+  +KLS LTDVTH+FYVTW NR TE ENC+
Sbjct  58   VYGVARRPKPNWNADHLVEYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG KHY G F+ FGK+  +D P  ED+PRL++PN
Sbjct  118  INGSMFRNVLRAVIPNAPNLRHVCLQTGTKHYLGPFEAFGKIKPYDPPFTEDMPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|ABA77560.1| progesterone 5-beta-reductase [Digitalis sibirica]
Length=389

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AEY82380.1| putative progesterone 5-beta-reductase [Lunaria annua]
Length=389

 Score =   298 bits (764),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFEEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD +DA SKLS LTDVTHVFYVTW NRP+E ++CE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSDADDARSKLSPLTDVTHVFYVTWTNRPSEHDSCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL A++PN+P+L+H+CLQTG KHY G F   GK   HD P  ED+PRL+  N
Sbjct  118  ANGSMLRNVLRAIVPNAPNLRHVCLQTGTKHYLGPFDNLGKSQHHDPPFTEDMPRLQIQN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+E+
Sbjct  178  FYYTLEDILFEEI  190



>ref|XP_010059860.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Eucalyptus 
grandis]
 gb|KCW66304.1| hypothetical protein EUGRSUZ_F00129 [Eucalyptus grandis]
Length=392

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR +E++   AP   QSV LI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRIDEEE---APKGFQSVGLILGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP+EYIQCD++DE DA +KLS LTDVTHVFYVTWAN  +E ENC 
Sbjct  58   VYGVARRPRPAWNADHPIEYIQCDLADEADAQAKLSPLTDVTHVFYVTWANLSSEEENCR  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RN L A++PN+P+L+H+CLQTG KHY G F+ +GKV  HD P  EDLPRL++PN
Sbjct  118  VNGAMFRNALQALVPNAPNLRHVCLQTGTKHYLGPFEAYGKVTPHDPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+E 
Sbjct  178  FYYTLEDILFEET  190



>ref|XP_006433602.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
 gb|ESR46842.1| hypothetical protein CICLE_v10001370mg [Citrus clementina]
Length=400

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+FEED+   +   +QSVALIVGVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKFEEDEPARS---YQSVALIVGVTGIVGNSLAEILPLPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P WN+DH +EY+QCD+SD E+  +KLS LTDVTH+FYVTW NR TE ENC+
Sbjct  58   VYGVARRPKPNWNADHLVEYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG KHY G F+ FGK+  +D P  ED+PRL++PN
Sbjct  118  INGSMFRNVLRAVIPNAPNLRHVCLQTGTKHYLGPFEAFGKIKPYDPPFTEDMPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|ABA77558.1| progesterone 5-beta-reductase [Digitalis davisiana]
Length=389

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEPENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL +EV
Sbjct  178  FYYDLEDILLEEV  190



>gb|ABA77554.1| progesterone 5-beta-reductase [Digitalis cariensis]
Length=389

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_006374844.1| hypothetical protein POPTR_0014s01970g [Populus trichocarpa]
 gb|ERP52641.1| hypothetical protein POPTR_0014s01970g [Populus trichocarpa]
Length=390

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+KR EED+   AP  +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKRSEEDE---APRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN DHP+EYIQCDISD  +  SKLS L DVTH+FYVTWA++PTE ENCE
Sbjct  58   VYGVARRSRPNWNEDHPVEYIQCDISDTAETQSKLSKLADVTHIFYVTWASKPTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG K Y G F+++GK+ AHD P  EDLPRL +PN
Sbjct  118  INGLMFRNVLQAVIPNAPNLRHVCLQTGGKQYVGPFELYGKIEAHDPPFTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  178  FYYTLEDVMFEEV  190



>gb|ABK95134.1| unknown [Populus trichocarpa]
Length=390

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+KR EED+   AP  +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKRSEEDE---APRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN DHP+EYIQCDISD  +  SKLS L DVTH+FYVTWA++PTE ENCE
Sbjct  58   VYGVARRSRPNWNEDHPVEYIQCDISDTAETQSKLSKLADVTHIFYVTWASKPTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG K Y G F+++GK+ AHD P  EDLPRL +PN
Sbjct  118  INGLMFRNVLQAVIPNAPNLRHVCLQTGGKQYVGPFELYGKIEAHDPPFTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  178  FYYTLEDVMFEEV  190



>gb|ABA77555.1| progesterone 5-beta-reductase [Digitalis laevigata]
 gb|AIF73579.1| progesterone 5-beta-reductase [Digitalis ferruginea subsp. ferruginea]
Length=389

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AEW67079.1| putative progesterone 5-beta-reductase [Digitalis trojana]
Length=389

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AEW67078.1| putative progesterone 5-beta-reductase [Digitalis ferruginea 
subsp. schischkinii]
Length=389

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|EYU37597.1| hypothetical protein MIMGU_mgv11b006498mg [Erythranthe guttata]
Length=391

 Score =   298 bits (763),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 162/194 (84%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+    P KH+ VALIVGVTGIVGNSLAEILP +DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKIEEDE---PPQKHEGVALIVGVTGIVGNSLAEILPHSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            +YGVARRPRP WN+D+P+ YIQCDISD ED   KLS LTD+THVFYVTWAN+ TE ENCE
Sbjct  58   IYGVARRPRPTWNADNPVNYIQCDISDPEDTRVKLSPLTDITHVFYVTWANKSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV--AHDTPHHEDLPRLESP  615
             NGKML+N+L+AVIPNSP+LKHICLQTG+KHY G F+ FGK    HD P+ EDLPRL   
Sbjct  118  VNGKMLQNLLDAVIPNSPNLKHICLQTGRKHYIGPFESFGKNIPTHDPPYTEDLPRLNHI  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLEDILF EV
Sbjct  178  NFYYTLEDILFAEV  191



>gb|AAU95076.1| progesterone 5 beta reductase [Digitalis subalpina]
 gb|ABF48559.1| putative progesterone 5 beta reductase [Digitalis minor]
Length=389

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|ABB36651.1| progesterone 5beta-reductase [Isoplexis canariensis]
Length=389

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSHLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|ABB36652.1| progesterone 5beta-reductase [Isoplexis chalcantha]
Length=389

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSHLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_008236416.1| PREDICTED: LOW QUALITY PROTEIN: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like 
[Prunus mume]
Length=395

 Score =   297 bits (761),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA GAA+K+F+ +D   AP K+QSVAL+ GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAEGAAKKKFDPND---APAKYQSVALVAGVTGIVGNSLAEILPLPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN+DH +EYIQCD+SD    HS+LS LTDVTHVFYVTWA++PTE ENCE
Sbjct  58   VYGVARRARPEWNADHHIEYIQCDLSDPHQTHSELSQLTDVTHVFYVTWASKPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG M RN+L+AVIPN+P+L+HICLQTG+KHY G F+++GK   H+ P HEDLPRL  PN
Sbjct  118  ANGNMFRNLLDAVIPNAPNLQHICLQTGRKHYIGPFEMWGKFEPHEPPFHEDLPRLNVPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|AAU88204.1| progesterone 5-beta-reductase [Digitalis ferruginea]
Length=389

 Score =   297 bits (760),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+  EV
Sbjct  178  FYYDLEDIMLGEV  190



>ref|XP_011029002.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   297 bits (760),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+KR EED+   AP  +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKRSEEDE---APRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG ARR RP WN DHP+EYIQCDISD  +  SKLS L DVTH+FYVTWA++PTE ENCE
Sbjct  58   VYGAARRSRPNWNVDHPVEYIQCDISDTAETQSKLSKLADVTHIFYVTWASKPTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG K Y G F+++GK+ AHD P  EDLPRL +PN
Sbjct  118  INGLMFRNVLQAVIPNAPNLRHVCLQTGGKQYVGPFELYGKIEAHDPPFTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  178  FYYTLEDVMFEEV  190



>ref|XP_007136737.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
 gb|ESW08731.1| hypothetical protein PHAVU_009G070100g [Phaseolus vulgaris]
Length=389

 Score =   297 bits (760),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+    P   +SV L++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---PPRSFESVGLVIGVTGIVGNSLAEILPLHDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EY+QCD+SD  DA SKLSVLTDVTHVF+V+W NRPTE ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYVQCDVSDPADAESKLSVLTDVTHVFFVSWTNRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ LQTG KHY G+F+  GK+ +H+ P  EDLPRL++PN
Sbjct  118  VNGAMLQNVLRAVIPNAPNLRHVSLQTGTKHYLGSFESIGKIQSHEPPFTEDLPRLDTPN  177

Query  619  FYYTLEDILFDE  654
            FYY  EDILF+E
Sbjct  178  FYYNQEDILFEE  189



>ref|XP_011092523.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=389

 Score =   296 bits (759),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEEDD     + +QSVALI+GVTGIVG+SLAEILPLADTPGG WK
Sbjct  1    MSWWWAGAIGAAKKKFEEDD---TAVTYQSVALIIGVTGIVGSSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN D+ + YI+CDISD +D  +KLS LTD+TH+FYVTWAN+PTE ENC+
Sbjct  58   VYGVARRPRPNWNDDNRVNYIRCDISDPDDTRAKLSTLTDITHLFYVTWANKPTEAENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NGKML+NVL+AVIPN P LKHICLQTG+KHY G F+ +GK+  HD P+ EDLPRL   N
Sbjct  118  VNGKMLKNVLDAVIPNCPRLKHICLQTGRKHYMGPFESYGKIETHDPPYTEDLPRLSYMN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|AGT29344.1| putative progesterone 5-beta reductase 1_2 [Thymus serpyllum]
Length=389

 Score =   296 bits (759),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+ E DD   AP  +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKLEVDD---APPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS LTDVT++FYVTW N+ TE ENCE
Sbjct  58   VYGVARRPRPAWNEDHPVTYIRCDVSDSGDAKEKLSPLTDVTNIFYVTWTNKSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVL+A+IPN P+LKHICL TG+KHY G F+  GK+ +HD P  EDLPRL+  N
Sbjct  118  ANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFESIGKIQSHDPPFTEDLPRLDCLN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|KJB58604.1| hypothetical protein B456_009G217600 [Gossypium raimondii]
Length=391

 Score =   296 bits (759),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+   AP   +SV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---APKSLKSVGLIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN++HP++YIQCD+SD  D  SKLS LTDVTH+FYV+W NR +E ENCE
Sbjct  58   VYGVARRPRPNWNANHPIQYIQCDVSDPNDTESKLSQLTDVTHIFYVSWTNRTSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+HICLQTG KHY G F++ GK+  HD+P  EDLPRL +PN
Sbjct  118  INGSMLRNVLRSVIPNAPNLRHICLQTGVKHYLGPFELLGKIQLHDSPFTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+E+
Sbjct  178  FYYHQEDILFEEI  190



>gb|AEW67076.1| putative progesterone 5-beta-reductase [Digitalis cariensis]
Length=389

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS L DVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLADVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|ABB72433.1| progesterone 5-beta-reductase [Digitalis nervosa]
Length=389

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKSEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|ABK96780.1| unknown [Populus trichocarpa x Populus deltoides]
Length=390

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+KR EED+   AP  +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKRSEEDE---APRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN DHP+EYIQCDIS+  +  SKLS L DVTH+FYVTWA++PTE ENCE
Sbjct  58   VYGVARRSRPNWNEDHPVEYIQCDISNTAETQSKLSKLADVTHIFYVTWASKPTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG K Y G F ++GK+ AHD P  EDLPRL +PN
Sbjct  118  INGLMFRNVLQAVIPNAPNLRHVCLQTGGKQYVGPFDLYGKIEAHDPPFSEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  178  FYYTLEDVMFEEV  190



>gb|AHI88614.1| putative progesterone 5-beta-reductase [Hesperis matronalis]
Length=388

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 160/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLEEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCDISD E A SKLS L DVTHVFY TW NRP+E +NCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDISDAEGARSKLSPLADVTHVFYATWTNRPSERDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F   GK  HD P  EDLPRL+  NF
Sbjct  118  ANGSMLRNVLRAIVPHAPNLRHICLQTGTKHYLGPFDNLGKSHHDPPFTEDLPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDIL +E+
Sbjct  178  YYTLEDILLEEI  189



>emb|CAD87012.1| putative progesterone 5-beta-reductase [Digitalis obscura]
Length=389

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+  EV
Sbjct  178  FYYDLEDIMLKEV  190



>ref|XP_004152001.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 ref|XP_004163586.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cucumis 
sativus]
 gb|KGN58303.1| hypothetical protein Csa_3G610790 [Cucumis sativus]
Length=394

 Score =   296 bits (758),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 165/195 (85%), Gaps = 6/195 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+    P   +SVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---PPRSFESVALVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP+EYIQCD+SD +DA +KLS L DVTH+FYVTW NR TE+ENCE
Sbjct  58   VYGVARRPRPAWNADHPIEYIQCDVSDPQDAETKLSQLADVTHLFYVTWTNRTTEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQ-VFGKVA--HDTPHHEDLPRLES  612
            AN KMLRNVL +VIPN+P+L+HICLQTG KHY G+F+ +  K +  HD P  EDLPRLE 
Sbjct  118  ANVKMLRNVLRSVIPNAPNLRHICLQTGTKHYVGSFESIINKSSQRHDPPFTEDLPRLEC  177

Query  613  PNFYYTLEDILFDEV  657
            PNFYY  ED+L++E+
Sbjct  178  PNFYYKQEDLLWEEI  192



>ref|XP_006471792.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
Length=396

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K FEE++    P  +Q V L++GVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKK-FEENERPPQPQDYQHVGLLIGVTGIVGNSLAEILPRQDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SDE+D  +KL+ LTDVTH+FYVTWA+RPTE ENCE
Sbjct  60   VYGVARRPRPDWNTDHPIEYIQCDVSDEDDTQAKLTKLTDVTHIFYVTWASRPTEAENCE  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+H+CLQTG KHY G  + FGK+  HDTP  EDLPRL  PN
Sbjct  120  VNGAMLRNVLRSVIPNAPNLRHVCLQTGAKHYLGPSESFGKIRPHDTPFTEDLPRLNVPN  179

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  180  FYYTQEDILFEEV  192



>gb|AFZ41796.1| putative progesterone 5-beta-reductase [Sisymbrium officinale]
Length=388

 Score =   296 bits (757),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ ED  SKLS LTDVTHVFYVTW NR +E +NCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDVRSKLSPLTDVTHVFYVTWTNRSSESDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL AV+PN+P+L+H+CLQTG KHY G F    K  HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYIGPFSNLEKSHHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+E+
Sbjct  178  YYTLEDVLFEEI  189



>gb|AFZ42257.2| putative progesterone 5-beta-reductase [Thymus serpyllum]
Length=389

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ E DD   AP  +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEVDD---APPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS LTDVT++FYVTW N+ TE ENCE
Sbjct  58   VYGVARRPRPAWNEDHPITYIRCDVSDSGDAKEKLSPLTDVTNIFYVTWTNKSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVL+A+IPN P+LKHICL TG+KHY G F+  GK+ +HD P  EDLPRL+  N
Sbjct  118  ANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFESIGKIQSHDPPFTEDLPRLDCLN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>sp|Q6PQJ9.1|5BPOR_DIGLA RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR 
[Digitalis lanata]
 gb|AAS76634.1| progesterone 5-beta-reductase [Digitalis lanata]
 gb|AAS93804.1| progesterone 5-beta-reductase [Digitalis lanata]
Length=389

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR EEDD   A  KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRLEEDD---AQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_011088182.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Sesamum indicum]
Length=390

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 164/194 (85%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ EED+   AP KH+SVALI+GVTG+VGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKLEEDE---APQKHESVALIIGVTGLVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+W+ D+P+ YIQCD+ + +D  +KLS LTD+THVFY TW NRPTE ENCE
Sbjct  58   VYGVARRPRPSWSDDYPINYIQCDVLNRDDTQAKLSTLTDITHVFYATWTNRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH--DTPHHEDLPRLESP  615
            ANG+ML+NVL+AVIPN P+LKHIC+QTG+KHY G F+ FGK+    +TP+ ED+PRL   
Sbjct  118  ANGRMLQNVLDAVIPNCPNLKHICMQTGRKHYVGPFEAFGKLETQLETPYTEDMPRLNYI  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLEDIL  EV
Sbjct  178  NFYYTLEDILCKEV  191



>ref|XP_009354120.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   295 bits (755),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ +ED+ L  P   QSV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKLDEDEHLRGP---QSVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DH +EYIQCDISD +DA + LS LTDVTH+FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPNWNADHLVEYIQCDISDPDDAKANLSPLTDVTHIFYVTWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL++VIPN+P L HICLQTG KHY G F+ FGK+  HD P  EDLPRL++PN
Sbjct  118  VNGNMLRNVLDSVIPNAPKLSHICLQTGAKHYVGPFESFGKIQPHDPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF EV
Sbjct  178  FYYTQEDLLFAEV  190



>ref|XP_006433101.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
 gb|ESR46341.1| hypothetical protein CICLE_v10001374mg [Citrus clementina]
Length=399

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 162/195 (83%), Gaps = 3/195 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLK--HQSVALIVGVTGIVGNSLAEILPLADTPGGP  255
            MSWW AGAIGAA+K+FEE++    P    +Q V L++GVTGIVGNSLAEILP  DTPGGP
Sbjct  1    MSWWWAGAIGAAKKKFEENERQPQPQPQDYQHVGLVIGVTGIVGNSLAEILPRQDTPGGP  60

Query  256  WKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELEN  435
            WKVYGVARRPRP WN+DHP+EYIQCD+SD++D  +KLS LTDVTH+FYVTWA+RPTE EN
Sbjct  61   WKVYGVARRPRPDWNADHPIEYIQCDVSDQDDTQAKLSKLTDVTHIFYVTWASRPTEAEN  120

Query  436  CEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLES  612
            CE NG MLRNVL +VIPN+P+L+H+CLQTG KHY G F+ FGK+  HDTP  EDLPRL  
Sbjct  121  CEVNGAMLRNVLRSVIPNAPNLRHVCLQTGGKHYVGPFESFGKIRPHDTPFTEDLPRLNV  180

Query  613  PNFYYTLEDILFDEV  657
             NFYYT EDILF+EV
Sbjct  181  TNFYYTQEDILFEEV  195



>gb|ABA77559.1| progesterone 5-beta-reductase [Digitalis lutea]
Length=389

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +EDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDEDD---APTKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+ VIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDTVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AAS93803.1| progesterone 5-beta-reductase [Digitalis parviflora]
Length=389

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIG+A+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGSAKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+W+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPSWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN +M RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSQMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYSEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AJE29749.1| putative progesterone 5-beta-reductase [Cucurbita pepo]
Length=393

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 162/195 (83%), Gaps = 6/195 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            M WW AGAIGAA+K+FEED+    P   +SVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MRWWWAGAIGAAKKKFEEDEQ---PRSFESVALVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DH +EYIQCD+SD EDA +KLS LTDVTHVFYVTW N PTE+ENCE
Sbjct  58   VYGVARRPRPNWNADHLIEYIQCDVSDLEDAEAKLSKLTDVTHVFYVTWTNLPTEIENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVF---GKVAHDTPHHEDLPRLES  612
             NGKMLRNVL +VIPN+P+L+HICLQTG KHY G+F+         HD P  ED+PRL++
Sbjct  118  VNGKMLRNVLRSVIPNAPNLRHICLQTGTKHYIGSFENIIDNPTQRHDPPFTEDMPRLDT  177

Query  613  PNFYYTLEDILFDEV  657
            PNFYYT ED+LF+E+
Sbjct  178  PNFYYTQEDLLFEEI  192



>emb|CAC80137.1| progesterone 5-beta-reductase [Digitalis purpurea]
Length=389

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTWANRSTEPENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AIA58905.1| putative progesterone 5-beta-reductase [Malcolmia maritima]
Length=388

 Score =   295 bits (754),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F   G+  HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYVGPFSNLGRPHHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>ref|XP_003638459.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35787.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+F+ED+   AP   QSV LI+GVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKFDEDE---APPTFQSVGLIIGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDI+D  +  +KLSVLTDVTH+FYV+W+NRP+E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQCDITDPNETQTKLSVLTDVTHIFYVSWSNRPSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             N  MLRNVL AVIPN+P+L+H+ LQTG KHY G F + GK+ +H+ P  EDLPRL++PN
Sbjct  118  VNSAMLRNVLTAVIPNAPNLRHVSLQTGGKHYLGPFDLIGKINSHEPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E 
Sbjct  178  FYYTQEDILFEET  190



>gb|AAS93805.1| putative progesterone 5-beta-reductase [Digitalis purpurea]
Length=389

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTWANRSTEPENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|ABF51668.1| progesterone 5-beta-reductase [Digitalis minor var. minor]
Length=389

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANRPTE EN E
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRPTEPENRE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_006471787.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=399

 Score =   295 bits (754),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 162/195 (83%), Gaps = 3/195 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLK--HQSVALIVGVTGIVGNSLAEILPLADTPGGP  255
            MSWW AGAIGAA+K+FEE++    P    +Q V L++GVTGIVGNSLAEILP  DTPGGP
Sbjct  1    MSWWWAGAIGAAKKKFEENERQPQPQPQDYQHVGLVIGVTGIVGNSLAEILPRQDTPGGP  60

Query  256  WKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELEN  435
            WKVYGVARRPRP WN+DHP+EYIQCD+SD++D  +KL+ LTDVTH+FYVTWA+RPTE EN
Sbjct  61   WKVYGVARRPRPDWNTDHPIEYIQCDVSDQDDTQAKLTKLTDVTHIFYVTWASRPTEAEN  120

Query  436  CEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLES  612
            CE NG MLRNVL +VIPN+P+L+H+CLQTG KHY G F+ FGK+  HDTP  EDLPRL  
Sbjct  121  CEVNGAMLRNVLRSVIPNAPNLRHVCLQTGGKHYVGPFESFGKIRPHDTPFTEDLPRLNV  180

Query  613  PNFYYTLEDILFDEV  657
             NFYYT EDILF+EV
Sbjct  181  TNFYYTQEDILFEEV  195



>gb|AIF73578.1| progesterone 5-beta-reductase [Digitalis lanata]
Length=389

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR EEDD   A  KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRLEEDD---AQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGV+RR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVSRRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AHZ44508.1| putative progesterone 5 beta-reductase [Stellaria media]
Length=390

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 160/193 (83%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +EDDD   P  +QSV LIVGVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKIDEDDD--EPQSYQSVGLIVGVTGIVGNSLAEILPLADTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD +DA SKLS LTDVTH+FYVTW  + +E+ENC 
Sbjct  59   VYGVARRPRPEWNTDHPIQYIQCDVSDPDDALSKLSPLTDVTHIFYVTWTTKSSEIENCR  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  MLRNVL AVIPN+P+++H+CLQTG KHY G F  FGK+  H+ P  ED+PRL  PN
Sbjct  119  ANVSMLRNVLQAVIPNAPNIQHVCLQTGAKHYVGPFDSFGKIQPHEPPFTEDMPRLPVPN  178

Query  619  FYYTLEDILFDEV  657
            FYY LED LF+EV
Sbjct  179  FYYDLEDALFEEV  191



>gb|AFZ41791.1| putative progesterone 5-beta-reductase [Thymus vulgaris]
Length=389

 Score =   294 bits (752),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ E DD   AP  +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEVDD---APPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS LTDVT++FYVTW N+ TE ENCE
Sbjct  58   VYGVARRPRPAWNEDHPITYIRCDVSDSGDAEEKLSPLTDVTNIFYVTWTNKSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVL A+IPN P+LKH CL TG+KHY G F+  GK+ +HD P  EDLPRL+  N
Sbjct  118  ANGKMLKNVLEALIPNCPNLKHFCLLTGRKHYTGPFESIGKIQSHDPPFTEDLPRLDCLN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>gb|AEW67077.1| putative progesterone 5-beta-reductase [Digitalis lamarckii]
Length=389

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR EEDD   AP KH SVALIVGVTGI+GNSLAEILP ADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPRADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS L DVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSPLADVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_010277137.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Nelumbo 
nucifera]
Length=390

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED     P KHQSV L++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKPDEDV---GPPKHQSVGLVIGVTGIVGNSLAEILPLNDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+W+ D+P+EYIQCD+SD ++  +KLS LTDVTH+FYVTW NR +E  NCE
Sbjct  58   VYGVARRPRPSWHVDYPIEYIQCDVSDPDETLAKLSPLTDVTHLFYVTWTNRQSESANCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG MLRNVL AVIPN+P+L+HICLQTG+KHY G+F+  GK+  +D P+HEDLPRL++PN
Sbjct  118  INGAMLRNVLRAVIPNAPNLQHICLQTGRKHYIGSFESLGKIQTYDPPYHEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>ref|XP_006472269.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=397

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+FEED+   +   +QSV LIVGVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKFEEDEPARS---YQSVGLIVGVTGIVGNSLAEILPLHDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P WN+DH +EY+QCD+SD E+  + LS L DVTH+FYVTW NR TE ENC+
Sbjct  58   VYGVARRPKPNWNADHLVEYVQCDVSDPEETQAMLSQLIDVTHIFYVTWTNRSTEAENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG KHY G F+ FGK+  HD P  ED+PRL++PN
Sbjct  118  INGSMFRNVLRAVIPNAPNLRHVCLQTGTKHYLGPFEAFGKIKPHDPPFTEDMPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  178  FYYTLEDILFEEV  190



>ref|XP_009360365.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
 ref|XP_009360373.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Pyrus 
x bretschneideri]
Length=390

 Score =   294 bits (752),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 164/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ +ED+   AP   +SV L++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKADEDEQPRAP---ESVGLVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++DHP+EYIQCD+SD +DA +KLS LTDVTHVFYVTW++R TE+ENCE
Sbjct  58   VYGVARRPRPNWSADHPIEYIQCDVSDPDDAKTKLSPLTDVTHVFYVTWSSRSTEVENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+HICLQTG KHY G F+ FGK+  HD P  EDLPRL++PN
Sbjct  118  VNGNMLRNVLESVIPNAPNLRHICLQTGGKHYLGPFESFGKIQPHDPPFTEDLPRLDTPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF  V
Sbjct  178  FYYTQEDLLFAAV  190



>gb|AGT29342.1| putative progesterone 5-beta reductase [Barbarea vulgaris]
Length=388

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 163/192 (85%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRESEHENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+H+CLQTG KHY G F   G+  HD P  ED+PRL+  NF
Sbjct  118  ANGTMLRNVLQAIVPHAPNLRHVCLQTGTKHYVGPFDNHGRSRHDAPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+E+
Sbjct  178  YYTLEDVLFEEI  189



>ref|XP_007018551.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY15776.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=389

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEE +   AP+  QSV L+VGVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEGE---APISFQSVGLVVGVTGIVGNSLAEILPLTDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W+ DHP+EYIQCDISD +D  SKLS LTDVT++FYV+W NR +E ENCE
Sbjct  58   VYGVARRPRPNWSMDHPIEYIQCDISDPKDTESKLSPLTDVTYIFYVSWINRSSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+H+CLQTG K+Y G F++ GK+  HD P  EDLPRL +PN
Sbjct  118  INGSMLRNVLRSVIPNAPNLRHVCLQTGTKNYLGPFELLGKIQPHDPPFTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E 
Sbjct  178  FYYTQEDILFEET  190



>gb|AFZ42258.1| putative progesterone 5-beta-reductase [Nasturtium officinale]
Length=388

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 163/192 (85%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+     L ++SVALIVGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDEDE---PTLSYESVALIVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ +D  SKLS LTDVTHVFYVTW +R +E +NCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNADDTRSKLSPLTDVTHVFYVTWTSRESEHDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+H+CLQTG KHY G F  +G+  HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHVCLQTGTKHYVGPFDNYGRSRHDAPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+E+
Sbjct  178  YYTLEDVLFEEI  189



>gb|AEX31541.1| putative steroid 5beta-reductase [Armoracia rusticana]
Length=388

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 162/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDEDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD +DA SKLS LTDVTHVFYVTW +R +E +NCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSDADDARSKLSPLTDVTHVFYVTWTSRESEHDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++PDL+H+CLQTG KHY G F   G+  HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPDLRHVCLQTGTKHYIGPFDNNGRSRHDAPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+E+
Sbjct  178  YYTLEDVLFEEI  189



>gb|KDO81568.1| hypothetical protein CISIN_1g0159921mg [Citrus sinensis]
Length=396

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 162/193 (84%), Gaps = 5/193 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK FEED+   +   +QSVALIVGVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAARK-FEEDEPARS---YQSVALIVGVTGIVGNSLAEILPLPDTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P WN+DH +EY+QCD+SD E+  +KLS LTDVTH+FYVTW NR TE ENC+
Sbjct  57   VYGVARRPKPNWNADHLVEYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCK  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+P+L+H+CLQTG KHY G F+ FGK+  +D P  ED+PRL++PN
Sbjct  117  INGSMFRNVLRAVIPNAPNLRHVCLQTGTKHYLGPFEAFGKIKPYDPPFTEDMPRLDAPN  176

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  177  FYYTLEDILFEEV  189



>gb|ADG46027.1| putative progesterone 5-beta-reductase [Coffea arabica]
 gb|ADG56541.1| progesterone 5-beta-reductase [Plantago major]
Length=389

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR +ED+ L    KH SVALIVGVTGIVGNSLAEILPLADTP GPWK
Sbjct  1    MSWWWAGAIGAAKKRSDEDEALP---KHSSVALIVGVTGIVGNSLAEILPLADTPSGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN D+P+ YI+CDISD +D   KLS LTD+THVFYVTWANR TE+E CE
Sbjct  58   VYGVARRPRPAWNEDNPINYIRCDISDPKDTQEKLSPLTDITHVFYVTWANRSTEVERCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVL+ VIPN PDLKHI LQTG+KHY G F++ GK+  HD P  EDLPRL+  N
Sbjct  118  ANGKMLKNVLDVVIPNCPDLKHISLQTGRKHYVGPFELIGKIETHDPPFTEDLPRLKFDN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED+LF+EV
Sbjct  178  FYYTQEDLLFEEV  190



>ref|XP_006413460.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
 gb|ESQ54913.1| hypothetical protein EUTSA_v10025425mg [Eutrema salsugineum]
Length=390

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 163/194 (84%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD E+A SKLS LTDVTHVFYVTW NR +E ENC+
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSDAEEARSKLSRLTDVTHVFYVTWTNRSSETENCD  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA--HDTPHHEDLPRLESP  615
            ANG MLRNVL AV+PN+P+L+H+CLQTG KHY G F    K +  HD P  ED+PRL+  
Sbjct  118  ANGSMLRNVLRAVLPNAPNLRHVCLQTGTKHYIGPFDNLEKRSQRHDPPFTEDMPRLQIQ  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+LF+E+
Sbjct  178  NFYYTLEDVLFEEI  191



>gb|ABB36654.1| progesterone 5beta-reductase [Isoplexis sceptrum]
Length=389

 Score =   292 bits (748),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   A  KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---AQPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP W+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPVWHEDNPINYVQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>gb|AGL96526.1| putative progesterone 5-beta-reductase, partial [Brassica rapa 
subsp. pekinensis]
Length=390

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 161/194 (83%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+ED+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFDEDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SDEEDA SKLS L DVTHVFYVTW NR +E++NC+
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDEEDARSKLSSLKDVTHVFYVTWTNRSSEVDNCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA--HDTPHHEDLPRLESP  615
             NG MLRNVL AV+PN+P+L+H+CLQTG KHY G F   GK    H+ P  ED+PRL+  
Sbjct  118  VNGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYLGPFDSVGKDVDRHEAPFTEDMPRLKIE  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+L +E+
Sbjct  178  NFYYTLEDVLSEEI  191



>gb|AFW16645.1| putative progesterone 5beta-reductase [Bupleurum falcatum]
Length=388

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 161/192 (84%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GA+GAARK  ++++     LK++SVAL+VGVTGIVGNSLAEILP  DTPG PWK
Sbjct  1    MSWWWSGAVGAARKTIDQEN---VELKYESVALVVGVTGIVGNSLAEILPRTDTPGSPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG+ARRPRP W+++HP+EYIQCDIS+ E+  S+LS L DVTH+FYVTWA+RPTE ENCE
Sbjct  58   VYGIARRPRPQWDANHPVEYIQCDISNPEETESRLSHLKDVTHLFYVTWASRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             N +M RN+LN +IPN+P L+HICLQTGKKHY G+F  +G VAHD P+ EDLPRL +PNF
Sbjct  118  INSQMFRNLLNCIIPNAPKLQHICLQTGKKHYLGSFDSYGGVAHDPPYSEDLPRLNAPNF  177

Query  622  YYTLEDILFDEV  657
            YY LEDILF+EV
Sbjct  178  YYNLEDILFEEV  189



>ref|XP_011016706.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ E+D+   A   +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKKIEDDE---ASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN DHP+EYIQCDIS+  +  SKLS LTDVTHVFYVTWA++ TE ENCE
Sbjct  58   VYGVARRSRPNWNEDHPVEYIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG MLRNVL AVIPN+ +L+H+CLQTG KHY G F + GK+ AHD+P  EDLPRL  PN
Sbjct  118  INGLMLRNVLQAVIPNASNLRHVCLQTGGKHYAGPFALLGKIEAHDSPFTEDLPRLRFPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  178  FYYTLEDVMFEEV  190



>ref|XP_004289734.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=389

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F  DD+   P K+QSVAL++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFGPDDE---PPKYQSVALVLGVTGIVGNSLAEILPLPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P WN+DH ++YIQCD+SD E   ++LS LTDVTH+FYVTWA++P+E ENCE
Sbjct  58   VYGVARRPQPQWNADHHIQYIQCDLSDSEQTETELSQLTDVTHIFYVTWASKPSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANGKML NVLNAVIPN+P+L+HIC+QTG+K Y G F++FGK+  H+ P+ ED  RL+ PN
Sbjct  118  ANGKMLSNVLNAVIPNAPNLQHICMQTGRKQYVGPFEMFGKIEPHEPPYVEDTSRLDCPN  177

Query  619  FYYTLEDILFDEV  657
            FYY +EDILF+EV
Sbjct  178  FYYVMEDILFEEV  190



>emb|CDY08911.1| BnaC08g11410D [Brassica napus]
Length=390

 Score =   292 bits (747),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+ED+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDEDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SDEEDA SKLS L DVTHVFYVTW NR  E ENC+
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDEEDARSKLSPLRDVTHVFYVTWTNRSVESENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA--HDTPHHEDLPRLESP  615
             NG MLRNVL AV+PN+P+L+H+CLQTG KHY G F   GK    H+ P  ED+PRL+  
Sbjct  118  VNGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYLGPFDSVGKAVDRHEAPFTEDMPRLKVD  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+L +E+
Sbjct  178  NFYYTLEDVLSEEI  191



>ref|XP_002869731.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45990.1| hypothetical protein ARALYDRAFT_914168 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD EDA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDAEDARSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++PN+P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLRAIVPNAPNLRHVCLQTGTKHYVGPFSNLDGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT ED+LFDE+
Sbjct  178  YYTQEDVLFDEI  189



>ref|XP_003525919.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Glycine 
max]
Length=388

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEE++    P   QSV L++GVTGIVGNSLAEILPLADTP GPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEEE---PPRSFQSVGLVIGVTGIVGNSLAEILPLADTPAGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SD  DA +KLS LTDVTHVF+V+W NR TE ENCE
Sbjct  58   VYGVARRPRPPWNADHPVEYIQCDVSDPADAEAKLSALTDVTHVFFVSWTNRSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ LQTG KHY G F+  GK+ +H+ P  ED+PRL++PN
Sbjct  118  VNGAMLQNVLRAVIPNAPNLRHVSLQTGGKHYIGPFEFIGKIESHEPPFAEDMPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E 
Sbjct  178  FYYTQEDILFEET  190



>gb|ABA77557.1| progesterone 5-beta-reductase [Digitalis ciliata]
Length=389

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED    AP KH SVAL+VGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDG---APTKHSSVALLVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPA + D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPARHEDNPINYIQCDISDPDDSQAKLSPLTDVTHVFYVTWANRSTEQENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL +EV
Sbjct  178  FYYDLEDILLEEV  190



>ref|XP_003598452.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|AES68703.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=390

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ +ED+   AP   Q+VAL+VGVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKLDEDE---APRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDI+D  DA +KLSVLTDVTHVFYV WA+RPTE ENCE
Sbjct  58   VYGVARRPRPSWNADHPVEYIQCDITDPNDATTKLSVLTDVTHVFYVCWASRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG ML+N L AVIPN+P+L+H+ +QTG KHY G F+ FGK+  H+ P+ ED+PRL+  N
Sbjct  118  INGTMLKNALTAVIPNAPNLRHVSIQTGGKHYVGPFESFGKIKYHEPPYTEDMPRLDYHN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+E 
Sbjct  178  FYYTLEDVLFEET  190



>ref|XP_010673631.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   291 bits (744),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDA-PLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSWW AGAIGAA+K+ E+ DD+    + +QSVALIVGVTGIVGNSLAEILPL+DTPGGPW
Sbjct  1    MSWWWAGAIGAAKKKLEDSDDVSTTSINYQSVALIVGVTGIVGNSLAEILPLSDTPGGPW  60

Query  259  KVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENC  438
            KVYGVARRPRP WN++HP+EYIQCDISD++D   KLS LTDVT++FYV WAN  TE ENC
Sbjct  61   KVYGVARRPRPNWNAEHPIEYIQCDISDKDDVVLKLSPLTDVTNIFYVCWANCVTEAENC  120

Query  439  EANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH--DTPHHEDLPRLES  612
            + N  M +NVLNAV+PN+P+LKHICLQTG KHY GAF+ +GKV H  D P+ ED+PRLE 
Sbjct  121  KINSMMFQNVLNAVVPNAPNLKHICLQTGMKHYTGAFEYWGKVEHLLDPPYSEDMPRLEL  180

Query  613  PNFYYTLEDILFDEV  657
            PNFYY LEDIL+ +V
Sbjct  181  PNFYYDLEDILYAQV  195



>gb|AGM16376.1| putative progesterone 5-beta-reductase [Cakile maritima]
Length=389

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN+DHP++YIQCD+SD +D  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPAWNADHPIDYIQCDVSDADDVRSKLSPLTDVTHVFYVTWTNRSSESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL AV+PN+P+L+H+CLQTG KHY G F        HD P  ED+PRL   N
Sbjct  118  ANGNMLRNVLRAVVPNAPNLRHVCLQTGTKHYIGPFGGLETTKYHDPPFTEDMPRLRIEN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+E+
Sbjct  178  FYYTLEDVLFEEI  190



>gb|AAU88205.1| progesterone 5-beta-reductase [Digitalis thapsi]
Length=389

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+  +P+ YIQCDISD +D+ +KLS L DVTHVFYVTWANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEGNPINYIQCDISDPDDSLAKLSPLADVTHVFYVTWANRSTEPENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_008447374.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Cucumis 
melo]
Length=393

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 163/195 (84%), Gaps = 6/195 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FEED+    P   +SVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFEEDE---PPRSFESVALVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SD +DA +KLS L DVTH+FYVTW NR  E++NCE
Sbjct  58   VYGVARRPRPVWNADHPIEYIQCDVSDPQDAETKLSQLADVTHLFYVTWTNRTIEIDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQ-VFGKVA--HDTPHHEDLPRLES  612
            AN +MLRNVL +VIPN+P+L+HICLQTG KHY G+F+ V  K +  H+ P  EDLPRLE 
Sbjct  118  ANVEMLRNVLRSVIPNAPNLRHICLQTGTKHYVGSFESVINKSSQRHEPPFTEDLPRLEC  177

Query  613  PNFYYTLEDILFDEV  657
            PNFYY  ED+LF+E+
Sbjct  178  PNFYYKQEDLLFEEI  192



>gb|AAU88203.1| progesterone 5-beta-reductase [Digitalis purpurea subsp. heywoodii]
Length=389

 Score =   290 bits (741),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDD---APPKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ YIQCDISD +D+ +KLS LTDVTHVFYVT ANR TE ENCE
Sbjct  58   VYGVARRTRPAWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANRSTEPENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ ED+PRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDMPRLKYIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDI+ +EV
Sbjct  178  FYYDLEDIMLEEV  190



>ref|XP_003636813.1| Progesterone 5-beta-reductase [Medicago truncatula]
 ref|XP_003638462.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35786.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09150.1| progesterone 5-beta-reductase 2 [Medicago truncatula]
Length=390

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ +ED+   AP   Q+VAL+VGVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKLDEDE---APRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHP+EYIQCDI+D  DA +KLSVLTDVTHVFYV WA+RPTE ENCE
Sbjct  58   VYGVARRSRPSWNADHPVEYIQCDITDPNDATTKLSVLTDVTHVFYVCWASRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ +QTG KHY G F+ FGK+  H+ P+ ED+PRL+  N
Sbjct  118  INGAMLKNVLTAVIPNAPNLRHVSIQTGGKHYVGPFESFGKIKYHEPPYTEDMPRLDYHN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+E 
Sbjct  178  FYYTLEDVLFEET  190



>ref|XP_009109253.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY24831.1| BnaA08g14790D [Brassica napus]
Length=390

 Score =   290 bits (741),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 161/194 (83%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+ED+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDEDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SDEEDA SKLS L DVTHVFYVTW NR +E++NC+
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDEEDARSKLSPLKDVTHVFYVTWTNRSSEVDNCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA--HDTPHHEDLPRLESP  615
             NG MLRNVL AV+PN+P+L+H+CLQTG KHY G F   GK    H+ P  E++PRL+  
Sbjct  118  VNGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYLGPFDSVGKDVDRHEAPFTEEMPRLKIE  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+L +E+
Sbjct  178  NFYYTLEDVLSEEI  191



>gb|EPS65468.1| progesterone 5-beta-reductase [Genlisea aurea]
Length=390

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +EDD   AP KHQSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDEDD---APPKHQSVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN D+P+ YIQCD+SD ED  +KLS L+DVTH+FY TWAN+ TE ENCE
Sbjct  58   VYGVARRPRPPWNEDNPITYIQCDVSDPEDTQAKLSPLSDVTHLFYATWANKSTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             N +M +NVL+ +IP+SP LKHICL TG+KHY G F+ FGK+  HD P  EDLPRL+  N
Sbjct  118  INSRMFQNVLDCIIPSSPSLKHICLVTGRKHYIGPFESFGKIEPHDPPFTEDLPRLDHIN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDILF++V
Sbjct  178  FYYDLEDILFEQV  190



>gb|AFZ41789.1| putative progesterone 5-beta-reductase [Raphanus sativus]
Length=390

 Score =   289 bits (740),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 161/194 (83%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+++ED+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKYDEDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SDEEDA SKLS L DVTHVFYVTW+NR +E++NC+
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDEEDARSKLSPLRDVTHVFYVTWSNRSSEVDNCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGK--VAHDTPHHEDLPRLESP  615
             NG MLRNVL AV+PN+P+L+H+CLQTG KHY G F   GK    H+ P  ED+PRL   
Sbjct  118  VNGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYLGPFDSLGKDVQRHEPPFTEDMPRLRVE  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+L +E+
Sbjct  178  NFYYTLEDVLSEEI  191



>gb|ABB36653.1| progesterone 5beta-reductase [Isoplexis isabelliana]
Length=389

 Score =   289 bits (739),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGA +K+ EEDD   AP KH SVALIVGVTGI+GNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGATKKKLEEDD---APSKHSSVALIVGVTGIIGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RPAW+ D+P+ Y+QCDISD +D+ +KLS LTDVTHVFYVTWANR TE EN E
Sbjct  58   VYGVARRTRPAWHEDNPINYVQCDISDPDDSQAKLSHLTDVTHVFYVTWANRSTEQENRE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            AN KM RNVL+AVIPN P+LKHI LQTG+KHY G F+ +GK+ +HD P+ EDLPRL+  N
Sbjct  118  ANSKMFRNVLDAVIPNCPNLKHISLQTGRKHYMGPFESYGKIESHDPPYTEDLPRLKYMN  177

Query  619  FYYTLEDILFDEV  657
             YY LEDI+ +EV
Sbjct  178  LYYDLEDIMLEEV  190



>ref|XP_006374846.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
 gb|ERP52643.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
Length=358

 Score =   288 bits (736),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ E  D   A   HQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKQSENGD---ASRGHQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDIS+  D  +KL+ LTDVTH+FYVTWA R TE EN E
Sbjct  58   VYGVARRPRPNWNLDHPVEYIQCDISNTADTQAKLAQLTDVTHIFYVTWALRFTEAENIE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  M RNVL AVIPN+P+LKH+CLQTG KHY G F++ GK+  HDTP+ EDLPRL++PN
Sbjct  118  ANNLMFRNVLQAVIPNAPNLKHVCLQTGLKHYVGPFELVGKIEPHDTPYTEDLPRLKAPN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL +EV
Sbjct  178  FYYDLEDILAEEV  190



>gb|AHZ44506.1| putative progesterone 5 beta-reductase [Iberis amara]
Length=389

 Score =   289 bits (739),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+++F++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKEKFDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW NR +E +NCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRSSEQDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL A+IPN+P+L+H+CLQTG KHY G F    K   HD P  ED+PRL+  N
Sbjct  118  ANGSMLRNVLGAIIPNAPNLRHVCLQTGTKHYVGPFDNLEKAQHHDPPFMEDMPRLQIQN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+ +
Sbjct  178  FYYTLEDILFEGI  190



>ref|XP_011088183.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Sesamum indicum]
Length=389

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 163/194 (84%), Gaps = 6/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GA +K+ EED+   AP KH+SVALI+GVTG+VGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGA-QKKLEEDE---APQKHESVALIIGVTGLVGNSLAEILPLSDTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+W+ D+P+ YIQCD+ + +D  +KLS LTD+THVFY TW NRPTE ENCE
Sbjct  57   VYGVARRPRPSWSDDYPINYIQCDVLNRDDTQAKLSTLTDITHVFYATWTNRPTEAENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH--DTPHHEDLPRLESP  615
            ANG+ML+NVL+AVIPN P+LKHIC+QTG+KHY G F+ FGK+    +TP+ ED+PRL   
Sbjct  117  ANGRMLQNVLDAVIPNCPNLKHICMQTGRKHYVGPFEAFGKLETQLETPYTEDMPRLNYI  176

Query  616  NFYYTLEDILFDEV  657
            NFYYTLEDIL  EV
Sbjct  177  NFYYTLEDILCKEV  190



>gb|AHI88613.1| putative steroid 5-beta-reductase [Sinapis arvensis]
Length=390

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 162/194 (84%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+ED+   +   ++SVALIVGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFDEDEPTPS---YESVALIVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW NR +E+ENC+
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDAKSKLSTLTDVTHVFYVTWTNRSSEVENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA--HDTPHHEDLPRLESP  615
             NG MLRNVL AV+PN+P+L+H+CLQT  KHY G F   GK    H+ P  E++PRL+  
Sbjct  118  VNGSMLRNVLRAVVPNAPNLRHVCLQTRTKHYLGPFDSVGKDVERHEAPFTEEMPRLQIE  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+L +E+
Sbjct  178  NFYYTLEDVLSEEI  191



>ref|XP_011017140.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ EED+   A   +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKKTEEDE---ASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN DHP+EYIQCDIS   +  SKLS LTDVTH+FYVTWA++ TE ENCE
Sbjct  58   VYGVARRSRPSWNEDHPVEYIQCDISSTVETQSKLSKLTDVTHIFYVTWASKSTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVIPN+ +L+H+CLQTG K Y G F++FGK+ AHD+P  EDLPR   PN
Sbjct  118  INGLMFRNVLQAVIPNAANLRHVCLQTGAKQYVGPFELFGKIEAHDSPFTEDLPRSRFPN  177

Query  619  FYYTLEDILFDEV  657
            FY+TLED++F+EV
Sbjct  178  FYHTLEDVMFEEV  190



>ref|NP_194153.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 sp|Q9STX2.1|VEP1_ARATH RecName: Full=3-oxo-Delta(4,5)-steroid 5-beta-reductase; AltName: 
Full=Delta(4)-3-oxosteroid 5-beta-reductase; AltName: Full=Delta-4,5-steroid 
5-beta-reductase; Short=At5beta-StR; AltName: 
Full=Progesterone 5-beta-reductase; Short=5beta-POR; 
AltName: Full=Protein VEIN PATTERNING 1 [Arabidopsis thaliana]
 emb|CAB45057.1| putative protein [Arabidopsis thaliana]
 emb|CAB79332.1| putative protein [Arabidopsis thaliana]
 gb|AAL32529.1| putative protein [Arabidopsis thaliana]
 gb|AAM64873.1| induced upon wounding stress [Arabidopsis thaliana]
 gb|AAP37838.1| At4g24220 [Arabidopsis thaliana]
 gb|ABU55811.1| progesterone 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84868.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=388

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+   +    +SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDEDEPSQS---FESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD ED  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A+IP +P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>gb|AFN22088.1| putative progesterone 5-beta-reductase [Draba aizoides]
Length=389

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+FE+D+   +    +SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFEDDEPSQS---FESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD +D  SKLS LTDVTHVFYVTW +  +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSDADDTKSKLSALTDVTHVFYVTWTSGDSESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL AV+PN+ +L+H+CLQTG KHY G F  F   + H+ P  ED+PRL++PN
Sbjct  118  ANGTMLRNVLRAVVPNAANLRHVCLQTGTKHYLGPFDTFVSGSHHEPPFTEDMPRLQTPN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+L +E+
Sbjct  178  FYYTLEDVLMEEI  190



>ref|XP_006387422.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
 gb|ERP46336.1| hypothetical protein POPTR_1058s00200g [Populus trichocarpa]
Length=391

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ E+D+   A   +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKKTEDDE---ASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN DHP+EYIQCDIS+  +  SKLS LTDVTHVFYVTWA++ TE ENCE
Sbjct  58   VYGVARRSRPNWNEDHPVEYIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGK--VAHDTPHHEDLPRLESP  615
             NG M RNVL AVIPN+ +L+H+CLQTG KHY G F + GK   AHD+P  EDLPRL  P
Sbjct  118  INGLMFRNVLQAVIPNASNLRHVCLQTGGKHYAGPFALLGKNIEAHDSPFTEDLPRLRFP  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED++F+EV
Sbjct  178  NFYYTLEDVMFEEV  191



>gb|AFW97632.1| putative progesterone 5-beta-reductase [Rosmarinus officinalis]
Length=389

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 158/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+    P  +QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKIDEDE---PPPNYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN DHP+ YI CD+SD +D  SKL+ LTD+T++FYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPSWNEDHPINYISCDVSDPDDVKSKLAPLTDITNIFYVTWTNRSTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANGKML+NVLN VIPN P+LKHICL TG+KHY G F    K+   D P  EDLPRL+ PN
Sbjct  118  ANGKMLKNVLNVVIPNCPNLKHICLLTGRKHYLGPFNSVWKIQVPDPPFTEDLPRLDCPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  178  FYYTQEDILFEEV  190



>ref|XP_011028990.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=390

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAARK+ E  D       HQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGALGAARKQSENGDTSRG---HQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDISD  +  +KLS LTDVTH+FYVTWA R TE EN +
Sbjct  58   VYGVARRPRPNWNLDHPVEYIQCDISDTAETQAKLSQLTDVTHIFYVTWALRFTEAENIQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  M RNVL AVIPN+P+LKH+CLQTG KHY G F++ GK+  HDTP+ EDLPRL +PN
Sbjct  118  ANNLMFRNVLQAVIPNAPNLKHVCLQTGLKHYVGPFELVGKIEPHDTPYTEDLPRLNAPN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL +EV
Sbjct  178  FYYDLEDILAEEV  190



>gb|ADG56544.1| progesterone 5-beta-reductase [Erysimum crepidifolium]
Length=389

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYLGPFSNLDGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>gb|AEO36948.1| progesterone 5beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   287 bits (734),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYLGPFSNLDGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>gb|AEZ01594.1| progesterone 5-beta-reductase [Erysimum cheiri]
Length=389

 Score =   286 bits (733),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ E+A SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYLGPFSNLNGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>ref|XP_006432523.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
 ref|XP_006471284.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 gb|ESR45763.1| hypothetical protein CICLE_v10001412mg [Citrus clementina]
Length=394

 Score =   286 bits (733),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AG IGAA+K+ EED     P  +Q+V LI+GVTGIVGNSLAEI+P +DTPGGPWK
Sbjct  1    MSWWWAGDIGAAKKKLEEDKQ--RPQDYQNVGLILGVTGIVGNSLAEIMPRSDTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN++ P+EYIQCDISD+E+  +KLS LTDVTH+FYVTWA+RPTE ENC+
Sbjct  59   VYGVARRPRPDWNANRPIEYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEAENCQ  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+L+HICLQTG KHY G F+  GK+ +H+ P+ EDLPRL  P 
Sbjct  119  INGAMFRNVLRSVIPNAPNLRHICLQTGGKHYVGPFECIGKIPSHEPPYTEDLPRLNVPL  178

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  179  FYYTQEDILFEEV  191



>emb|CDY03474.1| BnaC01g16080D [Brassica napus]
Length=389

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F++D+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDDDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD +D  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSDPDDVRSKLSPLTDVTHVFYVTWTNRSSEGENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL AV+PN+P+L+H+CLQTG KHY G F+       HD P  ED+PRL   N
Sbjct  118  ANGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYIGPFKDLETTRYHDPPFTEDMPRLGVEN  177

Query  619  FYYTLEDILFDEV  657
            FYY LED+LF+E+
Sbjct  178  FYYALEDVLFEEI  190



>gb|AFK42748.1| unknown [Medicago truncatula]
Length=390

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGA +K+ +ED+   AP   Q+VAL+VGVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGATKKKLDEDE---APRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHP+EYIQCDI+D  D  +KLSVLTDVTHVFYV WA+RPTE ENCE
Sbjct  58   VYGVARRSRPSWNADHPVEYIQCDITDPNDTTTKLSVLTDVTHVFYVCWASRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ +QTG KHY G F+ FGK+  H+ P+ ED+PRL+  N
Sbjct  118  INGAMLKNVLTAVIPNAPNLRHVSIQTGGKHYVGPFESFGKIKHHEPPYTEDMPRLDYHN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+E 
Sbjct  178  FYYTLEDVLFEET  190



>ref|XP_006374845.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
 gb|ERP52642.1| hypothetical protein POPTR_0014s01980g [Populus trichocarpa]
Length=357

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 159/193 (82%), Gaps = 5/193 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+    + ++ DA   HQSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAK----QSENGDASRGHQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDIS+  D  +KL+ LTDVTH+FYVTWA R TE EN E
Sbjct  57   VYGVARRPRPNWNLDHPVEYIQCDISNTADTQAKLAQLTDVTHIFYVTWALRFTEAENIE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  M RNVL AVIPN+P+LKH+CLQTG KHY G F++ GK+  HDTP+ EDLPRL++PN
Sbjct  117  ANNLMFRNVLQAVIPNAPNLKHVCLQTGLKHYVGPFELVGKIEPHDTPYTEDLPRLKAPN  176

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL +EV
Sbjct  177  FYYDLEDILAEEV  189



>gb|AFK45113.1| unknown [Medicago truncatula]
Length=390

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 162/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ +ED+   AP   Q+VAL+VGVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKLDEDE---APRSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP+WN+DHP+EYIQCDI+D  DA +KLSVLTDVTHVF V WA+RPTE ENCE
Sbjct  58   VYGVARRSRPSWNADHPVEYIQCDITDPNDATTKLSVLTDVTHVFCVCWASRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ +QTG KHY G F+ FGK+  H+ P+ ED+PRL+  N
Sbjct  118  INGAMLKNVLTAVIPNAPNLRHVSIQTGGKHYVGPFESFGKIKYHEPPYTEDMPRLDYHN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+E 
Sbjct  178  FYYTLEDVLFEET  190



>gb|AGT29341.1| putative progesterone 5-beta reductase [Cardamine pratensis]
Length=388

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 160/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+    DD +    ++SVALIVGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKL---DDYEPTQSYESVALIVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+E+DA SKLS LTDVTHVFYVTW +R +E +NCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNEDDARSKLSPLTDVTHVFYVTWTSRESEHDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+H+CLQT  KHY G F   G+  H  P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLRAIVPHAPNLRHVCLQTRTKHYIGPFDNHGRSRHGAPFTEDMPRLQIHNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+E+
Sbjct  178  YYTLEDVLFEEI  189



>ref|XP_010448593.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Camelina 
sativa]
Length=388

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 160/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ +DA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNADDARSKLSPLTDVTHVFYVTWTNRESETENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL AV+P++P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLRAVVPHAPNLRHVCLQTGTKHYLGPFTNVDGPHHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT ED+LF+E+
Sbjct  178  YYTQEDVLFEEI  189



>ref|XP_006283899.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
 gb|EOA16797.1| hypothetical protein CARUB_v10005016mg [Capsella rubella]
Length=388

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD +DA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPNWNADHPIDYIQCDVSDADDARSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGAMLRNVLRAIVPHAPNLRHVCLQTGTKHYVGPFSNRDGPHHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT ED+LF+E+
Sbjct  178  YYTQEDVLFEEI  189



>ref|XP_009137807.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Brassica 
rapa]
 emb|CDY34267.1| BnaA01g13700D [Brassica napus]
Length=390

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F++D+       ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFDDDEPTQT---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD +D  SKLS LTDVTHVFYVTW NR TE ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSDPDDVRSKLSPLTDVTHVFYVTWTNRSTERENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG MLRNVL AV+P++P+L+H+CLQTG KHY G F+       HD P  ED+PRL   N
Sbjct  118  ANGTMLRNVLRAVVPHAPNLRHVCLQTGTKHYIGPFKDLETTKYHDPPFTEDMPRLGVEN  177

Query  619  FYYTLEDILFDEV  657
            FYY LED+LF+E+
Sbjct  178  FYYALEDVLFEEI  190



>ref|XP_007223050.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
 gb|EMJ24249.1| hypothetical protein PRUPE_ppa006944mg [Prunus persica]
Length=389

 Score =   285 bits (730),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ + DD  +AP   +SV L++GVTG+VGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKHKYDDH-EAPRSFKSVGLVIGVTGLVGNSLAEILPLHDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W+ DH +EYIQCDISD  DA +KLS LTDVTH+FYVTW +R TE +NCE
Sbjct  60   VYGVARRPRPDWSVDHTVEYIQCDISDPIDAQTKLSQLTDVTHIFYVTWTSRSTEADNCE  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            ANG +LRNVL++VIPN+P+L H+CLQTG KHY G  + +GKVA HDTP  EDLPRL  P 
Sbjct  120  ANGALLRNVLSSVIPNAPNLSHVCLQTGTKHYDGPLEAYGKVAPHDTPSTEDLPRLNVPL  179

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+EV
Sbjct  180  FYYTLEDVLFEEV  192



>gb|AEZ01593.1| progesterone 5-beta-reductase [Erysimum odoratum]
Length=389

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 159/192 (83%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPSQS---YESVALVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYG ARRPRP+WN+DHP++YIQCD+S+ E+A SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGAARRPRPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYLGPFSNLDGPHHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>ref|XP_006374842.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
 gb|ERP52639.1| hypothetical protein POPTR_0014s01950g [Populus trichocarpa]
Length=391

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 156/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MS W AGA+G  RK+F +DD+  A   ++SVAL+VGVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSCWWAGALGNNRKKFYDDDE--ASRDYKSVALVVGVTGIVGNSLAEILPLADTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVAR  RP WN D+P+EYIQCDISD     SKLS+LTDVTH+FYVTWANR TE ENC+
Sbjct  59   VYGVARGKRPNWNEDNPVEYIQCDISDRNQTQSKLSLLTDVTHIFYVTWANRETESENCK  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL AVI N+ +L+HICLQTG KHY G FQ FGK+ AHD P  EDLPRLE PN
Sbjct  119  INGLMFRNVLEAVILNAHNLRHICLQTGTKHYVGPFQFFGKIEAHDPPFTEDLPRLEFPN  178

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF EV
Sbjct  179  FYYTLEDILFQEV  191



>gb|ADG56545.1| progesterone 5-beta-reductase [Erysimum rhaeticum]
Length=389

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ EDA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEDARSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESPN  618
            ANG M+RNVL A++P++P+L+HICLQTG KHY G F  + G   HD P  ED+PRL+  N
Sbjct  118  ANGSMIRNVLQAIVPHAPNLRHICLQTGTKHYVGPFSNLGGGPRHDPPFTEDMPRLQIQN  177

Query  619  FYYTLEDILFDEV  657
            FYYT ED LF+E+
Sbjct  178  FYYTQEDTLFEEI  190



>emb|CAA68126.1| unnamed protein product [Arabidopsis thaliana]
Length=386

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 154/192 (80%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            M WW AGAIGAA+K+ +ED+   +    +SVALI+GVT IVGNSLAEILPL+DTPGGPWK
Sbjct  1    MRWWWAGAIGAAKKKLDEDEPSQS---FESVALIIGVTAIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD ED  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A+IP +P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>ref|XP_007222999.1| hypothetical protein PRUPE_ppa006780mg [Prunus persica]
 gb|EMJ24198.1| hypothetical protein PRUPE_ppa006780mg [Prunus persica]
Length=395

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 157/193 (81%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ E   D  AP  +QSVAL++G+TGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKLE-GADTTAPEGYQSVALVIGLTGIVGNSLAEILPLHDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP W+ DHP++YIQCDISD ED  +KLS LTDVTH+FYVTW +R  E+ENCE
Sbjct  60   VYGVARRARPDWSVDHPVDYIQCDISDPEDTQAKLSELTDVTHIFYVTWTSRANEIENCE  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANG M RN+L  VIP +P+L+H+ LQTG KHY G F+  GK+ AHD P  EDLPRL+ PN
Sbjct  120  ANGAMFRNLLRVVIPVAPNLRHVSLQTGTKHYLGPFECIGKIKAHDPPFTEDLPRLDVPN  179

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  180  FYYTLEDILFEEV  192



>ref|XP_006284965.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
 gb|EOA17863.1| hypothetical protein CARUB_v10006268mg [Capsella rubella]
Length=388

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD E+  SK+S LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPNWNADHPIDYIQCDVSDAEETRSKISTLTDVTHVFYVTWTNRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+H+CLQTG KHY G F       H+ P  ED+PRL+  NF
Sbjct  118  ANGAMLRNVLRAIVPHAPNLRHVCLQTGTKHYVGPFSNLDGPHHEPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT ED+LF+E+
Sbjct  178  YYTQEDVLFEEI  189



>gb|ADG56543.1| progesterone 5-beta-reductase [Erysimum x marshallii]
Length=389

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 157/192 (82%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+    DD +    ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKL---DDDEPSRSYESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ E+A SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYLGPFSNLDGPHHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>ref|XP_002518657.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43582.1| conserved hypothetical protein [Ricinus communis]
Length=391

 Score =   284 bits (727),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 157/193 (81%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+KR E+DD      K+QSVALI+GVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKRVEDDD---PQPKYQSVALIIGVTGIVGNSLAEILPLADTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W +DH +EYIQCD+S+EE    KLS L D TH+F+V WA+ PTE ENC 
Sbjct  58   VYGVARRPRPIWQADHLIEYIQCDVSNEEQTLEKLSTLKDTTHIFFVAWASEPTEAENCI  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG MLRNVL AVIPN+ +L+H+CLQTG+KHY G+F+   K+ +H++P HEDLPRL   N
Sbjct  118  VNGTMLRNVLRAVIPNAENLQHVCLQTGRKHYVGSFESIWKIPSHESPFHEDLPRLNDIN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LFDE 
Sbjct  178  FYYTLEDVLFDET  190



>ref|XP_004501803.1| PREDICTED: uncharacterized protein LOC101510608 [Cicer arietinum]
Length=805

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 165/193 (85%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ +E+++   P   Q+VAL++GVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKLDEEEE---PRSFQNVALVIGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAWN DHP+EYIQCDI+D  DA SKLSVLTDVTH+FYV WA+RPTE ENCE
Sbjct  58   VYGVARRPRPAWNEDHPVEYIQCDITDSNDAESKLSVLTDVTHIFYVCWASRPTEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG ML+NVL AVIPN+P+L+H+ LQTG KHY G+F+ FGK+  H+ P+ ED+PRL++ N
Sbjct  118  INGTMLKNVLRAVIPNAPNLRHVSLQTGGKHYVGSFESFGKIKPHEPPYTEDMPRLDTRN  177

Query  619  FYYTLEDILFDEV  657
            FYYTLED+LF+E 
Sbjct  178  FYYTLEDVLFEET  190


 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 162/203 (80%), Gaps = 4/203 (2%)
 Frame = +1

Query  52   IIFSLQIIPKMSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILP  231
            I     I   MSWW +GAIGAA+K+ EED+   AP  + SV LIVGVTGIVGNSLAEILP
Sbjct  407  ITLHFSISANMSWWWSGAIGAAKKKLEEDE---APRIYHSVGLIVGVTGIVGNSLAEILP  463

Query  232  LADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWA  411
            L DTPGG WKVYGVARRPRP+WN+DHP+EYIQCDI+D  +  SKLSVLTDVTH+FYV+W 
Sbjct  464  LPDTPGGRWKVYGVARRPRPSWNADHPIEYIQCDITDPNETQSKLSVLTDVTHIFYVSWT  523

Query  412  NRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHH  588
             RPTE ENCE NG MLRNVL AVIPN+P+L+H+ LQTG KHY G F + GKV +H+ P  
Sbjct  524  KRPTEAENCEVNGAMLRNVLRAVIPNAPNLRHVSLQTGGKHYVGPFDLIGKVNSHEPPFT  583

Query  589  EDLPRLESPNFYYTLEDILFDEV  657
            EDLPRL++PNFYYT EDILF+E 
Sbjct  584  EDLPRLDAPNFYYTQEDILFEET  606



>gb|AEO36945.1| progesterone 5beta-reductase [Erysimum albescens]
Length=390

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ E+A SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESPN  618
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F  + G   HD P  ED+PRL+  N
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYVGPFSNLGGGPRHDPPFTEDMPRLQIQN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E+
Sbjct  178  FYYTQEDILFEEI  190



>gb|AEO36946.1| progesterone 5beta-reductase [Erysimum scoparium]
Length=390

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ E+A SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESPN  618
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F  + G   HD P  ED+PRL+  N
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYVGPFSNLGGGPRHDPPFTEDMPRLQIQN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E+
Sbjct  178  FYYTQEDILFEEI  190



>emb|CAN63254.1| hypothetical protein VITISV_028488 [Vitis vinifera]
Length=1000

 Score =   298 bits (763),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 4/181 (2%)
 Frame = +1

Query  115  ARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPA  294
             +K+F+EDD   AP   QSV L++GVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRP 
Sbjct  622  VQKKFDEDD---APRGFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPD  678

Query  295  WNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLN  474
            WN+DHP+EYIQCDISD EDA +KLS LTDVTHVFYVTW NR TE+ENCEANG MLRNVL 
Sbjct  679  WNADHPVEYIQCDISDSEDALAKLSPLTDVTHVFYVTWTNRATEIENCEANGTMLRNVLR  738

Query  475  AVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPNFYYTLEDILFD  651
            A+IPN+P+L+HICLQTG KHY G F+ FGK+  HD P+HEDLPRL++PNFYYTLEDILF+
Sbjct  739  ALIPNAPNLRHICLQTGGKHYIGPFEAFGKIKPHDPPYHEDLPRLDAPNFYYTLEDILFE  798

Query  652  E  654
            E
Sbjct  799  E  799



>ref|XP_003636810.1| Progesterone 5-beta-reductase [Medicago truncatula]
Length=809

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 163/193 (84%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+F+ED+   AP   QSV LI+GVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKFDEDE---APPTFQSVGLIIGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCDI+D  +  +KLSVLTDVTH+FYV+W+NRP+E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQCDITDPNETQTKLSVLTDVTHIFYVSWSNRPSEAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             N  MLRNVL AVIPN+P+L+H+ LQTG KHY G F + GK+ +H+ P  EDLPRL++PN
Sbjct  118  VNSAMLRNVLTAVIPNAPNLRHVSLQTGGKHYLGPFDLIGKINSHEPPFTEDLPRLDAPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E 
Sbjct  178  FYYTQEDILFEET  190


 Score =   270 bits (690),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 155/192 (81%), Gaps = 4/192 (2%)
 Frame = +1

Query  85   SWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKV  264
            +WW +GAIGAA+K+ +ED+   AP   Q+VAL+VGVTGIVGNSLAEILPLADTPGG WKV
Sbjct  422  NWWWSGAIGAAKKKLDEDE---APQSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWKV  478

Query  265  YGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA  444
            YGVARRPRP+WN+DHP+EYIQ DI++  D  +K S+LTDVTH+FYV+W +RPTE +NCE 
Sbjct  479  YGVARRPRPSWNADHPIEYIQRDITNSNDTQTKFSILTDVTHIFYVSWTSRPTEEDNCEV  538

Query  445  NGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPNF  621
            NG ML NVL AVIPN+P+L H+ LQTG KHY G F +  K+ +H+    EDLPRL+ PNF
Sbjct  539  NGVMLLNVLRAVIPNAPNLCHVSLQTGGKHYLGPFALIDKINSHEPSFTEDLPRLDIPNF  598

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E 
Sbjct  599  YYTQEDILFEET  610



>ref|XP_009360311.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Pyrus x bretschneideri]
Length=389

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 156/193 (81%), Gaps = 5/193 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GA+ A +K+ E  D  +     QSV L++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWSGAVAATKKKSEAADTSEP----QSVGLVIGVTGIVGNSLAEILPLHDTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++DHP++YIQCDISD ED  +KLS LTDVTH+FYVTW +R TELENCE
Sbjct  57   VYGVARRPRPNWSADHPVDYIQCDISDPEDVQTKLSGLTDVTHIFYVTWTSRATELENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANG M RNVL+ VIP +P+L+HI LQTG KHY G F+  GK+ AHD P  EDLPRL+ PN
Sbjct  117  ANGAMFRNVLSVVIPAAPNLRHISLQTGTKHYIGPFECIGKIPAHDPPFTEDLPRLDVPN  176

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  177  FYYTLEDILFEEV  189



>ref|NP_001078438.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
 gb|AEE84869.1| 3-oxo-Delta(4,5)-steroid 5-beta-reductase [Arabidopsis thaliana]
Length=387

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 155/192 (81%), Gaps = 4/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K  +ED+   +    +SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKK-LDEDEPSQS---FESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD ED  SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  57   VYGVARRPRPTWNADHPIDYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A+IP +P+L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  117  ANGSMLRNVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQIQNF  176

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  177  YYTQEDILFEEI  188



>gb|ADG56542.1| progesterone 5-beta-reductase [Erysimum capitatum var. purshii]
Length=389

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP P+WN+DHP++YIQCD+S+ E+A SKLS LTDVTHVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPVPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVTHVFYVTWTKRESESENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYLGPFSNLDGPRHDPPFTEDMPRLQIQNF  177

Query  622  YYTLEDILFDEV  657
            YYT EDILF+E+
Sbjct  178  YYTQEDILFEEI  189



>gb|AHZ44505.1| putative progesterone 5 beta-reductase [Erophila verna]
Length=387

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 6/193 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ E+D+   +    +SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLEDDEPSQS---FESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCD+SD ED  SKLSVL+DVTHVFYVTW    +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQCDVSDAEDCKSKLSVLSDVTHVFYVTWTKGASEKENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESPN  618
            ANG ML+NVL +V+P + +L+H+CLQTG KHY G F  V G   H+ P  ED+PRLE+PN
Sbjct  118  ANGNMLKNVLRSVVPYAVNLRHVCLQTGTKHYVGPFDNVSG--THEPPFTEDMPRLEAPN  175

Query  619  FYYTLEDILFDEV  657
            FYYTLEDIL +E+
Sbjct  176  FYYTLEDILMEEI  188



>gb|AGN74845.1| putative enone 5-beta-reductase [Lepidium sativum]
Length=392

 Score =   282 bits (721),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKIDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD EDA SKLS LTDVTHVFYVTW NR +E +N E
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDAEDARSKLSPLTDVTHVFYVTWTNRESESKNVE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANG MLRNVL A++P++ +L+H+CLQTG KHY G F       HD P  ED+PRL+  NF
Sbjct  118  ANGSMLRNVLQAIVPHARNLRHVCLQTGTKHYLGPFDNLEGPHHDPPFTEDMPRLQIHNF  177

Query  622  YYTLEDILFDEV  657
            YYTLEDILF+E+
Sbjct  178  YYTLEDILFEEI  189



>ref|XP_010521424.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=389

 Score =   281 bits (720),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+    P  +QSV LI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDEP--PPRSYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P+WN+DHP++YIQCD+SD +D   KLS LTDVTH+F+V W NR +E ENCE
Sbjct  59   VYGVARRPQPSWNADHPIDYIQCDVSDTDDVRCKLSPLTDVTHIFFVAWTNRGSEPENCE  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             N  MLRNVL A++P++P+L+H+CLQTG KHY G F   G   HD P  EDLPRL   NF
Sbjct  119  TNAGMLRNVLRAIVPHAPNLRHVCLQTGAKHYIGPFANRGGSYHDPPFTEDLPRLPIQNF  178

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+EV
Sbjct  179  YYTLEDVLFEEV  190



>gb|AIW09145.1| progesterone 5-beta-reductase 3 [Catharanthus roseus]
Length=394

 Score =   281 bits (720),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 159/192 (83%), Gaps = 5/192 (3%)
 Frame = +1

Query  88   WWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVY  267
            WW  GAIGAA+K+ + DD    P KHQSV LI+GVTG+VGNSLAEILPL+DTPGGPWKVY
Sbjct  6    WWAGGAIGAAKKKLQVDD---GPPKHQSVGLILGVTGLVGNSLAEILPLSDTPGGPWKVY  62

Query  268  GVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTW--ANRPTELENCE  441
            GVARR RP W++DHP+EYIQCD+S+ E+  SKLS LTDVTH+FYVT   AN+ T+ ENC+
Sbjct  63   GVARRSRPTWHADHPIEYIQCDLSNPEETESKLSNLTDVTHIFYVTCVTANKYTDAENCD  122

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            ANGKM RNVLNA+IPN P+L+HICLQTG KHYFG   V   V H++P +EDLPRL+ PNF
Sbjct  123  ANGKMFRNVLNAIIPNCPNLQHICLQTGLKHYFGRSLVGNFVCHESPCYEDLPRLDVPNF  182

Query  622  YYTLEDILFDEV  657
            YYTLEDIL++EV
Sbjct  183  YYTLEDILYEEV  194



>ref|XP_006471285.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=393

 Score =   281 bits (720),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 158/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AG IGAA+K    ++D   P  +Q+V LI+GVTGIVGNSLAEI+P +DTPGGPWK
Sbjct  1    MSWWWAGDIGAAKKL---EEDKQRPQDYQNVGLILGVTGIVGNSLAEIMPRSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN++ P+EYIQCDISD+E+  +KLS LTDVTH+FYVTWA+RPTE ENC+
Sbjct  58   VYGVARRPRPDWNANRPIEYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEAENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+L+HICLQTG KHY G F+  GK+ +H+ P+ EDLPRL  P 
Sbjct  118  INGAMFRNVLRSVIPNAPNLRHICLQTGGKHYVGPFECIGKIPSHEPPYTEDLPRLNVPL  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+EV
Sbjct  178  FYYTQEDILFEEV  190



>gb|AEO36947.1| progesterone 5beta-reductase [Erysimum caboverdeanum]
Length=390

 Score =   281 bits (718),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKLDDDEPSQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ E+A SKLS LTDV HVFYVTW  R +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNAEEARSKLSPLTDVIHVFYVTWTKRESECENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAF-QVFGKVAHDTPHHEDLPRLESPN  618
            ANG MLRNVL A++P++P+L+HICLQTG KHY G F  + G   HD P  ED+PRL   N
Sbjct  118  ANGSMLRNVLQAIVPHAPNLRHICLQTGTKHYVGPFSNLGGGPRHDPPFTEDMPRLHIQN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E+
Sbjct  178  FYYTQEDILFEEI  190



>gb|AAO63776.1| unknown [Populus tremuloides]
Length=391

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 159/194 (82%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ E+D+   A   + SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKKTEDDE---ASRGYPSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDIS+  +  SKLS LTDVTHVFYVTWA++ TE ENCE
Sbjct  58   VYGVARRPRPNWNEDHPVEYIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRL-ESP  615
             NG M RNVL AVIPN+ +L+H+CLQTG K Y G F + GK+ AHD P  EDLPRL + P
Sbjct  118  INGLMFRNVLQAVIPNAANLRHVCLQTGGKQYVGPFALLGKIEAHDPPFTEDLPRLNDFP  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED++++EV
Sbjct  178  NFYYTLEDVMYEEV  191



>gb|AHZ44509.1| putative progesterone 5 beta-reductase [Thlaspi arvense]
Length=389

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 159/193 (82%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F+ED+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFDEDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVAR PRP+WN+DHP++YIQCD+SD ED+ SKLS LTDVTHVFYVTW N  +E + CE
Sbjct  58   VYGVARHPRPSWNADHPIDYIQCDVSDAEDSRSKLSPLTDVTHVFYVTWTNGSSERDICE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH-DTPHHEDLPRLESPN  618
            ANG MLRNVL A++PN+P+L+H+CLQTG KHY G F    K    D P  ED+PRL+  N
Sbjct  118  ANGSMLRNVLRAIVPNAPNLRHVCLQTGTKHYIGPFDSLEKTDRPDPPFTEDMPRLKIQN  177

Query  619  FYYTLEDILFDEV  657
            FY+TLEDILF+E+
Sbjct  178  FYHTLEDILFEEI  190



>ref|XP_009360316.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Pyrus x bretschneideri]
Length=388

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 155/193 (80%), Gaps = 6/193 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GA+ A +K   E  D   P   QSV L++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWSGAVAATKK--SEAADTSEP---QSVGLVIGVTGIVGNSLAEILPLHDTPGGPWK  55

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++DHP++YIQCDISD ED  +KLS LTDVTH+FYVTW +R TELENCE
Sbjct  56   VYGVARRPRPNWSADHPVDYIQCDISDPEDVQTKLSGLTDVTHIFYVTWTSRATELENCE  115

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANG M RNVL+ VIP +P+L+HI LQTG KHY G F+  GK+ AHD P  EDLPRL+ PN
Sbjct  116  ANGAMFRNVLSVVIPAAPNLRHISLQTGTKHYIGPFECIGKIPAHDPPFTEDLPRLDVPN  175

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  176  FYYTLEDILFEEV  188



>gb|AHZ44507.1| putative progesterone 5 beta-reductase [Isatis tinctoria]
Length=390

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 163/194 (84%), Gaps = 5/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWGAGAIGAAKKKFDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCD+SD++D  SKLS LTDVTHVFYVTWANR +E +NCE
Sbjct  58   VYGVARRPRPTWNADHPIDYIQCDVSDDDDVRSKLSTLTDVTHVFYVTWANRSSESDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA--HDTPHHEDLPRLESP  615
            ANG MLRNVL AV+PN+P+L+H+CLQTG KHY G F    K    HD P  ED+PRL+  
Sbjct  118  ANGSMLRNVLRAVVPNAPNLRHVCLQTGTKHYIGPFDAVDKSVQRHDPPFTEDMPRLQIQ  177

Query  616  NFYYTLEDILFDEV  657
            NFYYTLED+LF+E+
Sbjct  178  NFYYTLEDVLFEEI  191



>gb|AFZ41790.1| putative progesterone 5-beta-reductase [Spinacia oleracea]
Length=398

 Score =   279 bits (714),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPL--KHQSVALIVGVTGIVGNSLAEILPLADTPGGP  255
            MSWW +GAIGAA+K+ E+ D+  +     +QSVALIVGVTGIVGNSLAEILPL+DTPGGP
Sbjct  1    MSWWWSGAIGAAKKKLEDSDEGSSSSSRNYQSVALIVGVTGIVGNSLAEILPLSDTPGGP  60

Query  256  WKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELEN  435
            WK+YGVARRPRP WNSDHP+EYIQCDISDE DA SKLS LTD+T++FYV W NR +E EN
Sbjct  61   WKIYGVARRPRPDWNSDHPIEYIQCDISDENDAVSKLSPLTDITNIFYVCWGNRDSEAEN  120

Query  436  CEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA----HDTPHHEDLPR  603
             E N KM RNVLN+ IPNSP+LKHICLQTG KHY G F+ +GK      HD P +ED+PR
Sbjct  121  RELNSKMFRNVLNSTIPNSPNLKHICLQTGMKHYIGPFESWGKKIDHQHHDPPFNEDMPR  180

Query  604  LESPNFYYTLEDILFDEV  657
            L+ PNFYY LEDILF E+
Sbjct  181  LDIPNFYYDLEDILFAEI  198



>ref|XP_006386483.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
 gb|ERP64280.1| hypothetical protein POPTR_0002s12150g [Populus trichocarpa]
Length=390

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ EED+   A   +QSVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKKKTEEDE---ASRGYQSVALILGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARR RP WN DHP+EYIQCDIS+  +  SKLS LTDVTHVFYVTWA++ TE ENCE
Sbjct  58   VYGVARRSRPNWNEDHPVEYIQCDISNTAETQSKLSKLTDVTHVFYVTWASKSTEEENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGK--VAHDTPHHEDLPRLESP  615
             NG M RNVL AVIPN+ +L+H+CLQTG  HY G F + GK   AHD+P  EDLPRL  P
Sbjct  118  INGLMFRNVLQAVIPNAANLRHVCLQTG-LHYAGPFALLGKNIEAHDSPFTEDLPRLRFP  176

Query  616  NFYYTLEDILFDEV  657
            NFYY LED++F+EV
Sbjct  177  NFYYPLEDVMFEEV  190



>ref|XP_002272271.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Vitis 
vinifera]
Length=389

 Score =   278 bits (712),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 158/193 (82%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+++ +ED+    P  +Q V LIVGVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWSGAIGAAKRKLQEDEA--HPTNYQGVGLIVGVTGIVGNSLAEILPLRDTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+PAWN+D+ +EYIQCD+ D E+  SKLS LTDVTH+FYVTWAN  +E ENC 
Sbjct  59   VYGVARRPQPAWNADNCVEYIQCDVFDPEETSSKLSKLTDVTHIFYVTWANMGSEAENCR  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL+AVIPN+P+L+HICLQTG+KHY G F+  GK+  HD P+HE++PRL+  N
Sbjct  119  VNGDMFRNVLSAVIPNAPNLQHICLQTGRKHYIGPFEALGKIEPHDPPYHEEMPRLDVEN  178

Query  619  FYYTLEDILFDEV  657
            FY+  EDILF+EV
Sbjct  179  FYHVQEDILFEEV  191



>gb|KJB29426.1| hypothetical protein B456_005G100200 [Gossypium raimondii]
Length=394

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 157/195 (81%), Gaps = 6/195 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EED+    P   QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLEEDE---TPKSFQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W+++H +EYIQCD+SD +D  SKLS LTDVTH+FYV+W NR TE +NCE
Sbjct  58   VYGVARRPRPHWHAEHRIEYIQCDVSDPKDTESKLSQLTDVTHIFYVSWVNRTTETDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVF--GKVA-HDTPHHEDLPRLES  612
             NG MLRNVL+ +I N+P+L+HICLQTG KHY G+F+    GK+  HD P  EDLPRL +
Sbjct  118  INGSMLRNVLHTLILNAPNLRHICLQTGAKHYVGSFEYITSGKIEPHDPPFTEDLPRLNT  177

Query  613  PNFYYTLEDILFDEV  657
            PNF+Y  EDIL  E+
Sbjct  178  PNFFYVQEDILLQEI  192



>ref|XP_010530504.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Tarenaya 
hassleriana]
Length=388

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 155/192 (81%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+F ED+    P  ++SV LI+GVTG+VGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKFVEDEH---PRSYESVGLIIGVTGMVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQCD+SD  DA SKLS LTDVTH+F+VTW NR +E E+C+
Sbjct  58   VYGVARRPRPSWNTDHPVEYIQCDVSDAIDAQSKLSPLTDVTHIFFVTWTNRRSESESCD  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
            +N  MLRNVL A++P++P+L+H+CLQTG KHY       G   HD P  EDLPRL   NF
Sbjct  118  SNAAMLRNVLRAIVPHAPNLQHVCLQTGTKHYIAPLDNLGGPHHDPPFTEDLPRLPVQNF  177

Query  622  YYTLEDILFDEV  657
            YY LED+LF+EV
Sbjct  178  YYALEDVLFEEV  189



>ref|XP_006432526.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006471281.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006471282.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
 gb|ESR45766.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
Length=393

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 152/190 (80%), Gaps = 3/190 (2%)
 Frame = +1

Query  88   WWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVY  267
            WW A AI A +K+ +ED     P  +Q V LI+GVTGIVGNSLAEILP +DTPGGPWKVY
Sbjct  4    WWWASAIDAPKKKLDEDK---RPRDYQLVGLILGVTGIVGNSLAEILPRSDTPGGPWKVY  60

Query  268  GVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEAN  447
            GVARRPRP WN++HP+EYIQCDISD+E+  +KLS LTDVTH+FYVTWA+RPTE+ENC+ N
Sbjct  61   GVARRPRPDWNANHPIEYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEVENCQIN  120

Query  448  GKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNFYY  627
            G M RNVL ++IPN+P+L+HICLQTG KHY G F   GK+ +D P  EDLPRL  P FYY
Sbjct  121  GSMFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLFYY  180

Query  628  TLEDILFDEV  657
              EDILF+EV
Sbjct  181  NQEDILFEEV  190



>ref|XP_006495338.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like, partial 
[Citrus sinensis]
Length=231

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AG+IGAA+ + EED  L     +Q+V L+VGVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWRWAGSIGAAKNKLEEDARLQ---DYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            +YGVARRPRP WN+ +P++YIQCD+SD +D  +KLS L DVTH+FYVTWA+RPTE ENC+
Sbjct  58   IYGVARRPRPNWNAKYPIDYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+L+HICLQTG KHY G F+  GK+ +HD P  EDLPRL  P 
Sbjct  118  INGAMFRNVLRSVIPNAPNLRHICLQTGGKHYVGPFECIGKIPSHDPPFTEDLPRLNVPL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_008220361.1| PREDICTED: uncharacterized protein LOC103320460 [Prunus mume]
Length=830

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAA+K+ E   D  AP  +QSVAL++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAVGAAKKKLE-GADASAPEGYQSVALVIGVTGIVGNSLAEILPLHDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W+ DHP++YIQCDISD ED  +KLS LTDVTH+FYVTW +R  E+ENCE
Sbjct  60   VYGVARRPRPDWSVDHPVDYIQCDISDPEDTKAKLSELTDVTHIFYVTWTSRANEIENCE  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANG M RN+L  VIP +P+L+H+ LQTG KHY G F+  GK+ AHD P  EDLPRL+ PN
Sbjct  120  ANGAMFRNLLRVVIPVAPNLRHVSLQTGTKHYLGPFECIGKIKAHDPPFTEDLPRLDVPN  179

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  180  FYYTLEDILFEEV  192


 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = +1

Query  79   KMSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            +MSWW A A+  A+K+++   D  AP   +SV L++GVTGIVGNSLAEILP  DTPGGPW
Sbjct  436  RMSWWWARAVADAKKKYQ-GVDTSAPQGQRSVGLVIGVTGIVGNSLAEILPRPDTPGGPW  494

Query  259  KVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENC  438
            KVYGVARRPRP WN+DHP++YIQCDISD ED  +KLS LTDVTH+FYV+WAN+ +E+ENC
Sbjct  495  KVYGVARRPRPNWNADHPVDYIQCDISDPEDTKAKLSKLTDVTHIFYVSWANKASEVENC  554

Query  439  EANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESP  615
            EANG ML NVL  VIP +P+++H+ LQTG KHY G F+ FGK+ AHD P  EDLPRL+ P
Sbjct  555  EANGAMLCNVLGVVIPVAPNIRHVSLQTGTKHYIGPFESFGKIKAHDPPFTEDLPRLDVP  614

Query  616  NFYYTLEDILFDE  654
            NFYYT EDILFDE
Sbjct  615  NFYYTQEDILFDE  627



>ref|XP_007223008.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
 gb|EMJ24207.1| hypothetical protein PRUPE_ppa006816mg [Prunus persica]
Length=394

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 2/192 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW A A+  A+K+++   D  AP   +SV L++GVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWARAVADAKKKYQ-GVDTSAPQGQRSVGLVIGVTGIVGNSLAEILPRPDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++YIQCDISD ED  +KLS LTDVTH+FYV+WA++ TE+ENCE
Sbjct  60   VYGVARRPRPKWNADHPVDYIQCDISDPEDTKAKLSKLTDVTHLFYVSWAHKATEVENCE  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANG MLRNVL  VIP +P+++H+ LQTG KHY G F+ FGK+ AHD P  EDLPRL+  N
Sbjct  120  ANGAMLRNVLGVVIPVAPNIRHVSLQTGTKHYIGPFESFGKIKAHDPPFTEDLPRLDVSN  179

Query  619  FYYTLEDILFDE  654
            FYYT EDILFDE
Sbjct  180  FYYTQEDILFDE  191



>ref|XP_006432522.1| hypothetical protein CICLE_v100016291mg, partial [Citrus clementina]
 gb|ESR45762.1| hypothetical protein CICLE_v100016291mg, partial [Citrus clementina]
Length=231

 Score =   271 bits (692),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AG+IGAA+ + EED     P  +Q+V L+VGVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWRWAGSIGAAKNKLEEDA---RPQDYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            V+GVARRPRP WN+ +P++YIQCDISD +D  +KLS LTDVTH+FYVTWA+RPTE ENC+
Sbjct  58   VHGVARRPRPNWNARYPIDYIQCDISDRDDTQAKLSKLTDVTHIFYVTWASRPTEAENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+++HICLQTG KHY G F+  GK+ +HD P  EDLPRL  P 
Sbjct  118  INGAMFRNVLRSVIPNAPNVRHICLQTGGKHYVGPFECIGKIPSHDPPFTEDLPRLNVPL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_006847874.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
 gb|ERN09455.1| hypothetical protein AMTR_s00029p00093020 [Amborella trichopoda]
Length=389

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 159/191 (83%), Gaps = 4/191 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ +ED+    P+K+QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKNDEDE---GPVKYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGV RRP P W+ DHP+EYIQCDI + E+  +KLS LTD+THVFYVTWA+R +E ENC+
Sbjct  58   VYGVGRRPCPKWSEDHPIEYIQCDILNLEETTAKLSPLTDITHVFYVTWADRISEAENCD  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M RNVL+A++PN+P+L+HICLQTG+KHY G F+  G V  H+ P+ ED+PRL   N
Sbjct  118  VNGHMFRNVLDALLPNAPNLQHICLQTGRKHYLGPFEAIGHVKPHEPPYQEDVPRLPCLN  177

Query  619  FYYTLEDILFD  651
            FY+TLEDILF+
Sbjct  178  FYHTLEDILFE  188



>gb|AIW09146.1| progesterone 5-beta-reductase 4 [Catharanthus roseus]
Length=390

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +1

Query  118  RKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAW  297
            RKRF ED+   AP   QSVALIVGVTGIVGNSLAEILPL+DTPGGPWKVYGVARRPRPAW
Sbjct  13   RKRFNEDE---APKNFQSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAW  69

Query  298  NSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNA  477
            N+DHP+EYIQCD+ + ++  +K+S LTDVTH+F+ TWANRPTE + CE NG M +NV+NA
Sbjct  70   NADHPVEYIQCDVYNSDETQAKISPLTDVTHIFWTTWANRPTEAQCCEVNGTMFQNVVNA  129

Query  478  VIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPNFYYTLEDILFD  651
            ++PN+P+L HIC+QTG KHY G F+ FGKV  HDTP  ED+PRL++PNFYYTLEDI FD
Sbjct  130  LLPNAPNLSHICIQTGHKHYIGPFEAFGKVKPHDTPFIEDVPRLDAPNFYYTLEDIAFD  188



>ref|XP_004300685.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Fragaria 
vesca subsp. vesca]
Length=391

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GA +KR + +D    P    SV L++GVTGIVGNSLAEILPL DTPGGPWK
Sbjct  1    MSWWWAGAVGAHKKRLDGEDA--GPRTPVSVGLVIGVTGIVGNSLAEILPLPDTPGGPWK  58

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP++Y+QCD+S   D  +KL+ LTDVTH+FYVTW ++ TE ENCE
Sbjct  59   VYGVARRPRPNWNADHPVDYVQCDVSKPNDVKAKLAPLTDVTHIFYVTWTSKATESENCE  118

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  MLRNVLNA+IPN+P+LKHICLQTG  HY G F  +GK+  HD+P  ED+PRL   N
Sbjct  119  ANAAMLRNVLNAMIPNAPNLKHICLQTGGNHYLGPFDTWGKIQPHDSPFKEDMPRLNVQN  178

Query  619  FYYTLEDILFDEV  657
            FYYT+ED++F EV
Sbjct  179  FYYTMEDLMFKEV  191



>ref|XP_008351978.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=392

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 153/193 (79%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW A A+ AA+K+ +ED   + P   +SV L++G+TGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWASAVEAAKKKHQEDR-YEPPSIPKSVGLVIGITGIVGNSLAEILPLSDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DH ++YIQCDISD +D   KLS L+DVTH+FYVTW NR TE ENCE
Sbjct  60   VYGVARRPRPHWNADHAVDYIQCDISDPDDTQKKLSKLSDVTHIFYVTWTNRSTENENCE  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  MLRNVL  VI N+P+L+H+CLQTG K Y G F+ FGK+  HD P  EDLPRL +PN
Sbjct  120  ANAAMLRNVLRIVISNAPNLRHVCLQTGTKQYIGPFETFGKIDHHDPPCSEDLPRLNAPN  179

Query  619  FYYTLEDILFDEV  657
            FYY LED+L +EV
Sbjct  180  FYYALEDVLLEEV  192



>ref|XP_003638458.1| Progesterone 5-beta-reductase [Medicago truncatula]
 gb|KEH35788.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
 gb|AIW09149.1| progesterone 5-beta-reductase 1 [Medicago truncatula]
Length=389

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 156/193 (81%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGAA+K+ +ED+   AP   Q+VAL+VGVTGIVGNSLAEILPLADTPGG WK
Sbjct  1    MSWWWSGAIGAAKKKLDEDE---APQSFQNVALVVGVTGIVGNSLAEILPLADTPGGRWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP+EYIQ DI++  D  +K S+LTDVTH+FYV+W +RPTE +NCE
Sbjct  58   VYGVARRPRPSWNADHPIEYIQRDITNSNDTQTKFSILTDVTHIFYVSWTSRPTEEDNCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG ML NVL AVIPN+P+L H+ LQTG KHY G F +  K+ +H+    EDLPRL+ PN
Sbjct  118  VNGVMLLNVLRAVIPNAPNLCHVSLQTGGKHYLGPFALIDKINSHEPSFTEDLPRLDIPN  177

Query  619  FYYTLEDILFDEV  657
            FYYT EDILF+E 
Sbjct  178  FYYTQEDILFEET  190



>gb|KDO81569.1| hypothetical protein CISIN_1g0159921mg, partial [Citrus sinensis]
Length=384

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 4/180 (2%)
 Frame = +1

Query  121  KRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWN  300
            K+FEED+   +   +QSVALIVGVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P WN
Sbjct  1    KKFEEDEPARS---YQSVALIVGVTGIVGNSLAEILPLPDTPGGPWKVYGVARRPKPNWN  57

Query  301  SDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAV  480
            +DH +EY+QCD+SD E+  +KLS LTDVTH+FYVTW NR TE ENC+ NG M RNVL AV
Sbjct  58   ADHLVEYVQCDVSDPEETQAKLSQLTDVTHIFYVTWTNRSTEAENCKINGSMFRNVLRAV  117

Query  481  IPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            IPN+P+L+H+CLQTG KHY G F+ FGK+  +D P  ED+PRL++PNFYYTLEDILF+EV
Sbjct  118  IPNAPNLRHVCLQTGTKHYLGPFEAFGKIKPYDPPFTEDMPRLDAPNFYYTLEDILFEEV  177



>ref|XP_008367783.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Malus 
domestica]
Length=362

 Score =   273 bits (698),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 153/193 (79%), Gaps = 2/193 (1%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MS W AG   AA K+ E   D  +   HQSVAL+VGVTGIVGNSL+EILPL DTPGGPWK
Sbjct  1    MSXWWAGVASAATKKLE-GVDASSSRGHQSVALVVGVTGIVGNSLSEILPLPDTPGGPWK  59

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP++YIQCD+S+ ED   KLS LTDVTH+FYVTW +  TE+ENC+
Sbjct  60   VYGVARRPRPNWNVDHPVDYIQCDVSBAEDTKIKLSQLTDVTHIFYVTWXSXATEVENCQ  119

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
            ANG MLRNVL+A+IP +P+L H+ LQTG KHY G F+  GK+ AHD P  EDLPRL+ PN
Sbjct  120  ANGAMLRNVLHAIIPVAPNLCHVSLQTGAKHYIGPFESIGKIKAHDPPFTEDLPRLDVPN  179

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF+EV
Sbjct  180  FYYTLEDILFEEV  192



>ref|XP_006495229.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 154/193 (80%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AG+IGAA+ + EED  L     +Q+V L+VGVTGIVGNSLAEILP +DTPGGPWK
Sbjct  1    MSWRWAGSIGAAKNKLEEDARLQ---DYQNVGLVVGVTGIVGNSLAEILPRSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            +YGVARRPRP WN+ +P++YIQCD+SD +D  +KLS L DVTH+FYVTWA+RPTE ENC+
Sbjct  58   IYGVARRPRPNWNAKYPIDYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+L+HICLQTG KHY G F+  GK+ +HD P  EDLPRL  P 
Sbjct  118  INGAMFRNVLRSVIPNAPNLRHICLQTGGKHYVGPFECIGKIPSHDPPFTEDLPRLNVPL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_011022580.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Populus 
euphratica]
Length=389

 Score =   273 bits (699),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 8/192 (4%)
 Frame = +1

Query  88   WWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVY  267
            WW +GA  AA+K   ED+   A    QSVALIVGVTGIVGNSLAEILPL+DTPGGPWKV+
Sbjct  4    WWWSGATDAAKK---EDE---ATRGCQSVALIVGVTGIVGNSLAEILPLSDTPGGPWKVH  57

Query  268  GVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEAN  447
            GVARR RP WN DHP+EYIQCDI+D     SKLS LTDVTH+FYVTWA++ TE+ENCE N
Sbjct  58   GVARRSRPNWNEDHPVEYIQCDIADTAQTQSKLSKLTDVTHIFYVTWASKDTEVENCEIN  117

Query  448  GKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRL-ESPNF  621
            G M RNVL AVIPN+P+L+H+CLQTG KHY G FQ+FGK+ AHD P  EDLPRL + PNF
Sbjct  118  GLMFRNVLQAVIPNAPNLRHVCLQTGGKHYLGPFQLFGKIEAHDPPFTEDLPRLNDFPNF  177

Query  622  YYTLEDILFDEV  657
            YYTLED++++EV
Sbjct  178  YYTLEDVMYEEV  189



>gb|AFW16644.1| putative progesterone 5beta-reductase [Passiflora incarnata]
Length=389

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 151/192 (79%), Gaps = 5/192 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW +GAIGA R      +  D P   +SVAL+VGVTGIVGNSLAEILPLADTPGGPWK
Sbjct  1    MSWWWSGAIGAVRN----SEQNDGPRSFESVALVVGVTGIVGNSLAEILPLADTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRP+P WN+DHP+EYIQCDI+D  D  +KLS L DVTH+FYVTWANR +E ENC 
Sbjct  57   VYGVARRPQPDWNADHPVEYIQCDIADSNDVQTKLSKLVDVTHIFYVTWANRSSEAENCR  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             N  MLRN+L A+IPN+P+L+HICLQTG KHY G F++  ++  HD P  ED PRL +PN
Sbjct  117  VNSLMLRNLLEALIPNAPNLRHICLQTGTKHYVGPFELVLQLETHDPPFTEDTPRLNAPN  176

Query  619  FYYTLEDILFDE  654
            FYYTLEDIL +E
Sbjct  177  FYYTLEDILLEE  188



>ref|XP_011017141.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Populus euphratica]
Length=390

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 153/193 (79%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MS W AGAIG A+++ E  +       HQSVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSRWWAGAIGGAKQQSENGNAFRG---HQSVALVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDIS+  +  +KLS LTDVTH+FYVTWA R TE EN E
Sbjct  58   VYGVARRPRPNWNLDHPVEYIQCDISNTAETQAKLSQLTDVTHIFYVTWALRFTEAENIE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  M RNVL AVIPN+ +LKH+CLQTG KHY G F++ GK+  HDTP+ EDLPRL +PN
Sbjct  118  ANNLMFRNVLQAVIPNALNLKHVCLQTGLKHYVGPFELVGKIEPHDTPYTEDLPRLSAPN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL  EV
Sbjct  178  FYYDLEDILAGEV  190



>ref|XP_006432524.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006432525.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 ref|XP_006471283.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X3 [Citrus sinensis]
 gb|ESR45764.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
 gb|ESR45765.1| hypothetical protein CICLE_v10001422mg [Citrus clementina]
Length=392

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW   +   A K+ +ED     P  +Q V LI+GVTGIVGNSLAEILP +DTPGGPWK
Sbjct  1    MSWWWWASAIDAPKKLDEDK---RPRDYQLVGLILGVTGIVGNSLAEILPRSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN++HP+EYIQCDISD+E+  +KLS LTDVTH+FYVTWA+RPTE+ENC+
Sbjct  58   VYGVARRPRPDWNANHPIEYIQCDISDQEETQAKLSKLTDVTHIFYVTWASRPTEVENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHHEDLPRLESPNF  621
             NG M RNVL ++IPN+P+L+HICLQTG KHY G F   GK+ +D P  EDLPRL  P F
Sbjct  118  INGSMFRNVLRSIIPNAPNLRHICLQTGGKHYLGPFDCIGKIPYDPPFTEDLPRLNIPLF  177

Query  622  YYTLEDILFDEV  657
            YY  EDILF+EV
Sbjct  178  YYNQEDILFEEV  189



>ref|XP_006471280.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AG+IGAA+ + EED     P  +Q+V L+VGVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWRWAGSIGAAKNKLEEDAR---PQDYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            V+GVARRPRP WN+ +P++YIQCDISD +D  +KLS LTDVTH+FYVTWA+RPTE ENC+
Sbjct  58   VHGVARRPRPNWNARYPIDYIQCDISDRDDTQAKLSKLTDVTHIFYVTWASRPTEAENCK  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+++HICLQTG KHY G F+  GK+ +HD P  EDLPRL  P 
Sbjct  118  INGAMFRNVLRSVIPNAPNVRHICLQTGGKHYVGPFECIGKIPSHDPPFTEDLPRLNVPL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_007042587.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
 gb|EOX98418.1| Progesterone 5-beta-reductase, putative isoform 2 [Theobroma 
cacao]
Length=390

 Score =   271 bits (693),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 152/193 (79%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+ EE D    P K++SVAL++G+TGIVG+SLAEILP +D PGGPWK
Sbjct  1    MSWWWAGAIGAARKKLEEHDK---PSKYKSVALVIGITGIVGSSLAEILPFSDIPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRPAW +  P++YIQC+IS+EE+   KLS L DVTH+FYV WA + +E ENC 
Sbjct  58   VYGVARRPRPAWTNALPIDYIQCNISNEEETQEKLSKLKDVTHIFYVAWAKKSSEAENCM  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL AVIPN+P LKH+CLQTG++HY G F   GKV  HD P  EDLPRL   N
Sbjct  118  VNGTMLRNVLKAVIPNAPKLKHVCLQTGRRHYTGPFDSVGKVQPHDPPFREDLPRLPVLN  177

Query  619  FYYTLEDILFDEV  657
            F YTLED+LF+EV
Sbjct  178  FCYTLEDVLFEEV  190



>ref|XP_011017142.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Populus euphratica]
Length=389

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 154/193 (80%), Gaps = 5/193 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MS W AGAIG A+    + ++ +A   HQSVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSRWWAGAIGGAK----QSENGNAFRGHQSVALVIGVTGIVGNSLAEILPLSDTPGGPWK  56

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDIS+  +  +KLS LTDVTH+FYVTWA R TE EN E
Sbjct  57   VYGVARRPRPNWNLDHPVEYIQCDISNTAETQAKLSQLTDVTHIFYVTWALRFTEAENIE  116

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  M RNVL AVIPN+ +LKH+CLQTG KHY G F++ GK+  HDTP+ EDLPRL +PN
Sbjct  117  ANNLMFRNVLQAVIPNALNLKHVCLQTGLKHYVGPFELVGKIEPHDTPYTEDLPRLSAPN  176

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL  EV
Sbjct  177  FYYDLEDILAGEV  189



>ref|XP_011069776.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=387

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 155/191 (81%), Gaps = 7/191 (4%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW  GA+GAA ++ EE+         Q+VALIVGVTGIVGNSLAEILP+++TPGGPWK
Sbjct  1    MSWWWKGALGAALRKPEENSG------PQNVALIVGVTGIVGNSLAEILPVSETPGGPWK  54

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+SD +   +KLS LTDVTH+F+VTW NRPTE E C+
Sbjct  55   VYGVARRPRPSWNADHPVQYIQCDVSDAKQTQAKLSPLTDVTHIFWVTWGNRPTESECCD  114

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG M +NVL+A++PN P+L HIC+QTG KHY G F+ FGK+  H+TP  ED+PRL++PN
Sbjct  115  LNGAMFQNVLDAIMPNCPNLTHICVQTGHKHYIGPFEAFGKIKPHETPFVEDVPRLDAPN  174

Query  619  FYYTLEDILFD  651
            FYYTLED+  D
Sbjct  175  FYYTLEDVALD  185



>ref|XP_006432505.1| hypothetical protein CICLE_v10001414mg [Citrus clementina]
 gb|ESR45745.1| hypothetical protein CICLE_v10001414mg [Citrus clementina]
Length=393

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AG+IGAA+ + EED  L     +Q+V L+VGVTGIVGNSLAEILP +DTPGGPWK
Sbjct  1    MSWRWAGSIGAAKNKLEEDARLQ---DYQNVGLVVGVTGIVGNSLAEILPRSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            +YGVARRPRP WN+ +P++YIQCD+SD +D  +KLS L DVTH+FYVTWA+RPTE ENC+
Sbjct  58   IYGVARRPRPNWNAKYPIDYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+L+HICLQTG KHY G F+  GK+ +HD P  EDLPRL    
Sbjct  118  INGAMFRNVLRSVIPNAPNLRHICLQTGGKHYVGPFECIGKIPSHDPPFTEDLPRLNVSL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_006433601.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
 gb|ESR46841.1| hypothetical protein CICLE_v10001445mg [Citrus clementina]
Length=390

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 153/196 (78%), Gaps = 11/196 (6%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAARK+  EDD+       ++V L++GVTGI+GNSLA+ILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAARKKLGEDDE-------RNVGLVIGVTGILGNSLADILPRPDTPGGPWK  53

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
             YGVARRPRP WN+DHP+EYIQCD+SD E   +KLS LTDVTH+FY TWA+RPTE+ENC+
Sbjct  54   AYGVARRPRPDWNADHPIEYIQCDVSDPEQTQTKLSQLTDVTHIFYTTWASRPTEVENCQ  113

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH----DTPHHEDLPRLE  609
             NG MLRNVL++VIP +P+L+HICL TG KHY G F+V  +       + P  EDLPRL 
Sbjct  114  INGAMLRNVLHSVIPTAPNLRHICLVTGAKHYLGPFEVATRRMKSHPLEPPFTEDLPRLN  173

Query  610  SPNFYYTLEDILFDEV  657
             PNFYYT EDILF+EV
Sbjct  174  MPNFYYTQEDILFEEV  189



>ref|XP_006450012.1| hypothetical protein CICLE_v10013989mg [Citrus clementina]
 gb|ESR63252.1| hypothetical protein CICLE_v10013989mg [Citrus clementina]
Length=393

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 152/193 (79%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AG+IGAA+ + EED  L     +Q+V L+VGVTGIVGNSLAEILP  DTPGGPWK
Sbjct  1    MSWRWAGSIGAAKNKLEEDARLQ---DYQNVGLVVGVTGIVGNSLAEILPRPDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            +YGVARRPRP WN+ +P++YIQCD+SD +D  +KLS L DVTH+FYVTWA+RPTE ENC+
Sbjct  58   IYGVARRPRPNWNAKYPIDYIQCDVSDPDDTQAKLSKLADVTHIFYVTWASRPTEAENCQ  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RNVL +VIPN+P+L+HICLQTG KHY G F+  GK+ +HD P  EDLPRL    
Sbjct  118  INGAMFRNVLRSVIPNAPNLRHICLQTGGKHYVGPFECIGKIPSHDPPFTEDLPRLNVSL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_006472267.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Citrus sinensis]
Length=390

 Score =   269 bits (687),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 154/196 (79%), Gaps = 11/196 (6%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+  EDD+       ++V L++GVTGI+GNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLGEDDE-------RNVGLVIGVTGILGNSLAEILPRPDTPGGPWK  53

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SD +   +KLS LTDVTH+FY TWA+ PTE+ENC+
Sbjct  54   VYGVARRPRPHWNADHPIEYIQCDVSDPQQTQTKLSQLTDVTHIFYTTWASSPTEVENCQ  113

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH----DTPHHEDLPRLE  609
             NG MLRNVL++VIP++P+L+HICL TG KHY G F+V  +       + P  EDLPRL 
Sbjct  114  INGAMLRNVLHSVIPSAPNLRHICLVTGAKHYLGPFEVATRRMKSHPLEPPFTEDLPRLN  173

Query  610  SPNFYYTLEDILFDEV  657
             PNFYYT EDILF+EV
Sbjct  174  MPNFYYTQEDILFEEV  189



>ref|XP_002304533.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
 gb|ABK95799.1| unknown [Populus trichocarpa]
 gb|EEE79512.1| hypothetical protein POPTR_0003s13440g [Populus trichocarpa]
Length=389

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 157/195 (81%), Gaps = 9/195 (5%)
 Frame = +1

Query  82   MSW-WRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSW W +GA  AA+K   ED+   A    QSVALI+GVTGIVGNSLAEILPL+DTPGGPW
Sbjct  1    MSWCWWSGATDAAKK---EDE---ATRGCQSVALIIGVTGIVGNSLAEILPLSDTPGGPW  54

Query  259  KVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENC  438
            KV+GVARR RP WN DHP+EYIQCDI+D     SKLS LTDVTH+FYVTWA++ TE+ENC
Sbjct  55   KVHGVARRSRPNWNQDHPVEYIQCDIADTAQTQSKLSKLTDVTHIFYVTWASKDTEVENC  114

Query  439  EANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRL-ES  612
            E NG M RNVL AVIPN+P+L+H+CLQTG KHY G F++ GK+ AHD P  EDLPRL + 
Sbjct  115  EINGLMFRNVLQAVIPNAPNLRHVCLQTGGKHYLGPFELLGKIEAHDPPFTEDLPRLNDF  174

Query  613  PNFYYTLEDILFDEV  657
            PNFYYTLED++++EV
Sbjct  175  PNFYYTLEDVMYEEV  189



>ref|XP_006432519.1| hypothetical protein CICLE_v10001420mg [Citrus clementina]
 gb|ESR45759.1| hypothetical protein CICLE_v10001420mg [Citrus clementina]
Length=393

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW R GAIGAA+K+ EE    + P  +Q+V L+VGVTGIVGN LAEILP +DTPGGPWK
Sbjct  1    MSWCRTGAIGAAKKKLEE---YEQPWDYQNVGLVVGVTGIVGNCLAEILPRSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++ +P+EYIQCDISD ++  SKLS LT++TH+FY+TWA RP + ENCE
Sbjct  58   VYGVARRPRPDWSAAYPIEYIQCDISDPDETRSKLSKLTNITHIFYMTWAGRPAQAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             N  M RNVL +VIPN+P+L+H+CLQTG KHY G F+  GK+ +HD P  EDLPRL    
Sbjct  118  INSAMFRNVLRSVIPNAPNLRHVCLQTGSKHYLGPFECIGKIPSHDPPFTEDLPRLNVQL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_002302422.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
 gb|EEE81695.2| hypothetical protein POPTR_0002s12170g [Populus trichocarpa]
Length=390

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/193 (68%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MS W A AIG A+++ E  +       H SVAL++GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSRWWACAIGGAKQQSENGNAFRG---HHSVALVIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN DHP+EYIQCDIS+  +  +KLS LTDVTH+FYVTWA R TE EN E
Sbjct  58   VYGVARRPRPNWNLDHPVEYIQCDISNTAETQAKLSQLTDVTHIFYVTWALRFTEAENIE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
            AN  M RNVL AVIPN+ +LKH+CLQTG KHY G F++ GK+  HDTP+ EDLPRL +PN
Sbjct  118  ANNLMFRNVLQAVIPNALNLKHVCLQTGLKHYVGPFELVGKIEPHDTPYTEDLPRLSAPN  177

Query  619  FYYTLEDILFDEV  657
            FYY LEDIL  EV
Sbjct  178  FYYDLEDILAGEV  190



>emb|CDP01226.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   266 bits (679),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 151/191 (79%), Gaps = 6/191 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGA+GAAR      +   A    QSVAL+ GVTGI+GNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAVGAARA-----NGATASKNFQSVALVAGVTGIIGNSLAEILPLSDTPGGPWK  55

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+W+ DHP++YIQCD+ + +DA +KLS LTD+TH+F+VTWANRP+E E  +
Sbjct  56   VYGVARRPRPSWSLDHPVQYIQCDVLNADDARAKLSPLTDITHIFWVTWANRPSEAECIQ  115

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             N  M  NVLNAV+PN+P+L HICLQTG KHY G F+  GK+  H+TP  ED+PRL  PN
Sbjct  116  VNDAMFLNVLNAVVPNAPNLTHICLQTGHKHYIGPFESLGKIKPHETPFVEDVPRLPVPN  175

Query  619  FYYTLEDILFD  651
            FYY+LEDILF+
Sbjct  176  FYYSLEDILFE  186



>ref|XP_006471279.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Citrus 
sinensis]
Length=393

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW  AGAIGAA+K+ EE    + P  +Q+V L+VGVTGIVGN LAEILP +DTPGGPWK
Sbjct  1    MSWCGAGAIGAAKKKLEE---YEQPWDYQNVGLVVGVTGIVGNCLAEILPRSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W++ +P+EYIQCDISD ++  SKLS LT++TH+FY+TWA RP + ENCE
Sbjct  58   VYGVARRPRPDWSAAYPIEYIQCDISDPDETRSKLSKLTNITHIFYMTWAGRPAQAENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             N  M RNVL +VIPN+P+L+H+CLQTG KHY G F+  GK+ +HD P  EDLPRL    
Sbjct  118  INSAMFRNVLRSVIPNAPNLRHVCLQTGSKHYLGPFECIGKIPSHDPPFTEDLPRLNVQL  177

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+EV
Sbjct  178  FYYNQEDILFEEV  190



>ref|XP_003589112.1| hypothetical protein MTR_1g018610 [Medicago truncatula]
 gb|AES59363.1| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=423

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 159/209 (76%), Gaps = 12/209 (6%)
 Frame = +1

Query  43   QDTIIFSLQIIPKMSWWRAGAIG---AARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNS  213
            Q  I++S     KM+WW A A G       +F+E     AP   Q+VALI+GVTGIVGNS
Sbjct  24   QAYIVYSEN---KMNWWLARATGDHPGKITKFKE-----APRNVQNVALIIGVTGIVGNS  75

Query  214  LAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHV  393
            LAEILPL DTP GPWKVYGVARRPRP WN D+P+ YIQCD+S++ D   KLS LTDVTH+
Sbjct  76   LAEILPLKDTPVGPWKVYGVARRPRPMWNVDNPVHYIQCDVSNQNDVELKLSPLTDVTHI  135

Query  394  FYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-  570
            FYV+W +RPTE +NCE NG MLRNVL A+IPN+P+L H+ LQTG KHY G F++ GK+  
Sbjct  136  FYVSWTSRPTEAQNCEVNGAMLRNVLQALIPNAPNLSHVSLQTGAKHYVGPFEIIGKIKP  195

Query  571  HDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            H++P  ED+PRL++PNFYYTLEDILF+EV
Sbjct  196  HESPFTEDVPRLDTPNFYYTLEDILFEEV  224



>ref|XP_010939097.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Elaeis 
guineensis]
Length=461

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 155/198 (78%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLD-APLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSWW AGAIGAARK+F+ED     A  K  SV L++GVTGIVGNSLAEILPLADTPGGPW
Sbjct  62   MSWWWAGAIGAARKKFDEDSGGGGAAAKFPSVGLVIGVTGIVGNSLAEILPLADTPGGPW  121

Query  259  KVYGVARRPRPAWNSDH----PMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTE  426
            KVYGV+RRP P+  +       +E++QCDISD EDA +KLS LTDVTH+FYV W NR TE
Sbjct  122  KVYGVSRRPHPSSLASQTEGLAIEHVQCDISDREDALAKLSPLTDVTHIFYVAWVNRSTE  181

Query  427  LENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPR  603
             EN E N  MLRNVL AVIPN+P+L+H+CLQTG+KHY G+F+  GKV  H+ P  EDLPR
Sbjct  182  AENREINSAMLRNVLTAVIPNAPNLQHVCLQTGRKHYLGSFESLGKVKGHEPPFVEDLPR  241

Query  604  LESPNFYYTLEDILFDEV  657
            L+ PNFYY LEDILF+EV
Sbjct  242  LDCPNFYYDLEDILFEEV  259



>ref|XP_006472268.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Citrus sinensis]
Length=389

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 153/196 (78%), Gaps = 12/196 (6%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K  E+D+        ++V L++GVTGI+GNSLAEILP  DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKLGEDDE--------RNVGLVIGVTGILGNSLAEILPRPDTPGGPWK  52

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP WN+DHP+EYIQCD+SD +   +KLS LTDVTH+FY TWA+ PTE+ENC+
Sbjct  53   VYGVARRPRPHWNADHPIEYIQCDVSDPQQTQTKLSQLTDVTHIFYTTWASSPTEVENCQ  112

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAH----DTPHHEDLPRLE  609
             NG MLRNVL++VIP++P+L+HICL TG KHY G F+V  +       + P  EDLPRL 
Sbjct  113  INGAMLRNVLHSVIPSAPNLRHICLVTGAKHYLGPFEVATRRMKSHPLEPPFTEDLPRLN  172

Query  610  SPNFYYTLEDILFDEV  657
             PNFYYT EDILF+EV
Sbjct  173  MPNFYYTQEDILFEEV  188



>ref|XP_008790041.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Phoenix 
dactylifera]
Length=400

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 155/198 (78%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPL-KHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSWW AGAIGAA+K+ +ED    A   K QSV L++GVTGIVGNSLAEILPL+DTPGGPW
Sbjct  1    MSWWWAGAIGAAKKKIDEDSGGGATAPKFQSVGLVIGVTGIVGNSLAEILPLSDTPGGPW  60

Query  259  KVYGVARRPRP----AWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTE  426
            KVYGV+RRPR     + N    +E+IQCD+SD +DA +KLS LTDVTHVFYV W NR  E
Sbjct  61   KVYGVSRRPRSVSFGSLNEGLAVEHIQCDVSDPDDAFAKLSPLTDVTHVFYVAWVNRIVE  120

Query  427  LENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPR  603
             EN E N  MLRNVL AV+PN+P+L+HICLQTG+KHY G+F+  GKV AH+ P  EDLPR
Sbjct  121  AENREVNSAMLRNVLAAVLPNAPNLQHICLQTGRKHYLGSFESIGKVKAHEPPFREDLPR  180

Query  604  LESPNFYYTLEDILFDEV  657
            L+ PNFYY LEDILF+EV
Sbjct  181  LDCPNFYYDLEDILFEEV  198



>ref|XP_008790634.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Phoenix 
dactylifera]
Length=400

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 152/198 (77%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEED-DDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPW  258
            MSWW AGAIGAARK+ +ED     A  K QSV L++GVTGIVGNSLAEILPLADTPGGPW
Sbjct  1    MSWWWAGAIGAARKKLDEDFGGGGAAPKFQSVGLVIGVTGIVGNSLAEILPLADTPGGPW  60

Query  259  KVYGVARRPR----PAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTE  426
            KVYGV+RRPR    P+      +E++QCDISD EDA +KLS LTD+TH+FYV W NR TE
Sbjct  61   KVYGVSRRPRSSTFPSQTEGLAIEHVQCDISDREDALAKLSPLTDITHIFYVAWVNRSTE  120

Query  427  LENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPR  603
             EN E N  M RNVL AVIPN+ +L+HICLQTG+KHY G+F+  GKV  H+ P  EDLPR
Sbjct  121  AENREVNSAMFRNVLAAVIPNASNLQHICLQTGRKHYVGSFESMGKVKTHEPPFVEDLPR  180

Query  604  LESPNFYYTLEDILFDEV  657
            L  PNFYY LEDILF+EV
Sbjct  181  LSCPNFYYDLEDILFEEV  198



>gb|KJB32255.1| hypothetical protein B456_005G233200 [Gossypium raimondii]
Length=393

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/195 (66%), Positives = 149/195 (76%), Gaps = 6/195 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EE D      K++SVAL++G+TGIVGNSLAEI+P +  PGGPWK
Sbjct  1    MSWWWAGAIGAAKKKMEEHDKQS---KYKSVALVIGITGIVGNSLAEIIPFSGIPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVAR+PRPA  S  P+EYIQCD+ DEE+ + KLS L DVTHVFYV W  R TE ENC 
Sbjct  58   VYGVARQPRPASTSHLPIEYIQCDVLDEEETYDKLSKLNDVTHVFYVAWDKRSTEDENCV  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV---AHDTPHHEDLPRLES  612
             NG MLRNVL AVIPNSP LKHICLQTG++HY G   ++GK     HD P  EDLPRL+S
Sbjct  118  INGTMLRNVLKAVIPNSPKLKHICLQTGRRHYTGPIDLYGKYHVQPHDPPFREDLPRLKS  177

Query  613  PNFYYTLEDILFDEV  657
             NF YTLED+L +EV
Sbjct  178  SNFCYTLEDVLLEEV  192



>pdb|2V6F|A Chain A, Structure Of Progesterone 5beta-Reductase From Digitalis 
Lanata
 pdb|2V6G|A Chain A, Structure Of Progesterone 5beta-reductase From Digitalis 
Lanata In Complex With Nadp
Length=364

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +1

Query  166  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDE  345
             SVALIVGVTGI+GNSLAEILPLADTPGGPWKVYGVARR RPAW+ D+P+ Y+QCDISD 
Sbjct  1    SSVALIVGVTGIIGNSLAEILPLADTPGGPWKVYGVARRTRPAWHEDNPINYVQCDISDP  60

Query  346  EDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG  525
            +D+ +KLS LTDVTHVFYVTWANR TE ENCEAN KM RNVL+AVIPN P+LKHI LQTG
Sbjct  61   DDSQAKLSPLTDVTHVFYVTWANRSTEQENCEANSKMFRNVLDAVIPNCPNLKHISLQTG  120

Query  526  KKHYFGAFQVFGKV-AHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            +KHY G F+ +GK+ +HD P+ EDLPRL+  NFYY LEDI+ +EV
Sbjct  121  RKHYMGPFESYGKIESHDPPYTEDLPRLKYMNFYYDLEDIMLEEV  165



>ref|XP_007042586.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98417.1| Progesterone 5-beta-reductase, putative isoform 1 [Theobroma 
cacao]
Length=407

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 152/210 (72%), Gaps = 21/210 (10%)
 Frame = +1

Query  82   MSWWRAGAIGAAR-----------------KRFEEDDDLDAPLKHQSVALIVGVTGIVGN  210
            MSWW AGAIGAAR                 K+ EE D    P K++SVAL++G+TGIVG+
Sbjct  1    MSWWWAGAIGAARLSLCLNKLSFSFGQILQKKLEEHDK---PSKYKSVALVIGITGIVGS  57

Query  211  SLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTH  390
            SLAEILP +D PGGPWKVYGVARRPRPAW +  P++YIQC+IS+EE+   KLS L DVTH
Sbjct  58   SLAEILPFSDIPGGPWKVYGVARRPRPAWTNALPIDYIQCNISNEEETQEKLSKLKDVTH  117

Query  391  VFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA  570
            +FYV WA + +E ENC  NG MLRNVL AVIPN+P LKH+CLQTG++HY G F   GKV 
Sbjct  118  IFYVAWAKKSSEAENCMVNGTMLRNVLKAVIPNAPKLKHVCLQTGRRHYTGPFDSVGKVQ  177

Query  571  -HDTPHHEDLPRLESPNFYYTLEDILFDEV  657
             HD P  EDLPRL   NF YTLED+LF+EV
Sbjct  178  PHDPPFREDLPRLPVLNFCYTLEDVLFEEV  207



>gb|KHN21407.1| Hypothetical protein glysoja_042470 [Glycine soja]
Length=305

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +1

Query  166  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDE  345
            QSVAL++GVTGIVGNSLA+ILPL++TPGGPWKVYGVARR +P+WN+ + + YIQCDISD+
Sbjct  9    QSVALVLGVTGIVGNSLAQILPLSNTPGGPWKVYGVARRTQPSWNALNTVHYIQCDISDQ  68

Query  346  EDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG  525
             DA SKLS LTDVTHVFYV WA RPTE +NC+ NG MLRNVL AVIPN+P+L+H+ LQTG
Sbjct  69   NDAESKLSSLTDVTHVFYVCWARRPTEAQNCQVNGAMLRNVLRAVIPNAPNLRHVSLQTG  128

Query  526  KKHYFGAFQVFGK--VAHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
             KHY G F++ GK  VAHD P  EDLPRL++PNFYYT EDILF+EV
Sbjct  129  TKHYLGPFELLGKIEVAHDPPFTEDLPRLDAPNFYYTQEDILFEEV  174



>gb|ABD33275.2| progesterone 5-beta-reductase, putative [Medicago truncatula]
Length=387

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (80%), Gaps = 1/187 (1%)
 Frame = +1

Query  100  GAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVAR  279
            G I ++ +  +     +AP   Q+VALI+GVTGIVGNSLAEILPL DTP GPWKVYGVAR
Sbjct  2    GIILSSNRYIQITKFKEAPRNVQNVALIIGVTGIVGNSLAEILPLKDTPVGPWKVYGVAR  61

Query  280  RPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKML  459
            RPRP WN D+P+ YIQCD+S++ D   KLS LTDVTH+FYV+W +RPTE +NCE NG ML
Sbjct  62   RPRPMWNVDNPVHYIQCDVSNQNDVELKLSPLTDVTHIFYVSWTSRPTEAQNCEVNGAML  121

Query  460  RNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPNFYYTLE  636
            RNVL A+IPN+P+L H+ LQTG KHY G F++ GK+  H++P  ED+PRL++PNFYYTLE
Sbjct  122  RNVLQALIPNAPNLSHVSLQTGAKHYVGPFEIIGKIKPHESPFTEDVPRLDTPNFYYTLE  181

Query  637  DILFDEV  657
            DILF+EV
Sbjct  182  DILFEEV  188



>ref|XP_004499012.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Cicer 
arietinum]
Length=389

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 151/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  82   MSWWRAGAIGAARK--RFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGP  255
            M+WW A A G   K  + EE     AP   ++VALI+GVTGIVGNSLAEILPL DTPGGP
Sbjct  1    MNWWWARAAGDTGKITKLEE-----APQSFKNVALIIGVTGIVGNSLAEILPLNDTPGGP  55

Query  256  WKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELEN  435
            WKVYGVARRPRP WN+++P+ YIQCD+S++ D   KLS LTDVTH+FYV+W +RPTE +N
Sbjct  56   WKVYGVARRPRPTWNANNPVHYIQCDVSNQNDVELKLSPLTDVTHIFYVSWTSRPTEAQN  115

Query  436  CEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLES  612
             + NG MLRNVL A+IPN+P+L+HI LQTG KHY G+F+  GK+  HD+P  EDLPRL+ 
Sbjct  116  SDVNGSMLRNVLRALIPNAPNLRHISLQTGAKHYVGSFETIGKIKGHDSPFTEDLPRLDI  175

Query  613  PNFYYTLEDILFDEV  657
             NFYYT EDILF EV
Sbjct  176  LNFYYTQEDILFQEV  190



>ref|XP_011088173.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like [Sesamum 
indicum]
Length=373

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = +1

Query  166  QSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDE  345
            +SVALI+GVTG+VGNSLAEILPL+DTPGGPWKVYGVARRPRP+W+ D+P+ YIQCD+ + 
Sbjct  9    ESVALIIGVTGLVGNSLAEILPLSDTPGGPWKVYGVARRPRPSWSDDYPINYIQCDVLNR  68

Query  346  EDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTG  525
            +D  +KLS LTD THVFY TW NRPTE ENCEANG+ML+NVL+AVIPN P+LKHIC+QTG
Sbjct  69   DDTQAKLSTLTDNTHVFYATWTNRPTEAENCEANGRMLQNVLDAVIPNCPNLKHICMQTG  128

Query  526  KKHYFGAFQVFGKVAH--DTPHHEDLPRLESPNFYYTLEDILFDEV  657
            +KHY G F+ FGK+    +TP+ ED+PRL   NFYYTLEDIL  EV
Sbjct  129  RKHYVGPFEAFGKLETQLETPYTEDMPRLNYINFYYTLEDILCKEV  174



>gb|ABD93571.1| developmental process IMP [Solanum lycopersicum]
Length=167

 Score =   250 bits (639),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  229  PLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTW  408
            PLAD PGGPWKVYGVARR RP+WN+DHP+EY+QCDIS+ ED  SKLSVLTDVTHVFYVTW
Sbjct  4    PLADXPGGPWKVYGVARRARPSWNADHPIEYVQCDISNPEDTQSKLSVLTDVTHVFYVTW  63

Query  409  ANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVAHDTPHH  588
            ANR TE+ENCE NGKM RNVLN +IPN P+L+HICLQTG+KHY G F+++GKV+HD P H
Sbjct  64   ANRSTEVENCEINGKMFRNVLNVIIPNCPNLRHICLQTGRKHYLGPFELYGKVSHDPPFH  123

Query  589  EDLPRLESPNFYYTLEDILFDEV  657
            EDLPRL++PNFYY LEDILF EV
Sbjct  124  EDLPRLDAPNFYYVLEDILFKEV  146



>ref|XP_007226426.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
 gb|EMJ27625.1| hypothetical protein PRUPE_ppa023813mg, partial [Prunus persica]
Length=379

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  136  DDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPM  315
            ++D +AP   +SV L++GVTGIVGNSLA ILP +DTPGGPWKVYGVARRPRP WNSD+PM
Sbjct  4    EEDHEAPHTPKSVGLVIGVTGIVGNSLARILPQSDTPGGPWKVYGVARRPRPHWNSDYPM  63

Query  316  EYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSP  495
            EYIQCDISD +D  SKLS LTDVTH+FYVTWA+R TE +NCEAN  M+RNVL  VI N+P
Sbjct  64   EYIQCDISDPKDTVSKLSRLTDVTHIFYVTWASRSTEPQNCEANAAMIRNVLRVVITNAP  123

Query  496  DLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            +L H+CLQTG +HYFG ++  GKV   + P  EDLPRL +PNFYY LED+LF+EV
Sbjct  124  NLCHVCLQTGTRHYFGPYESLGKVEPQEPPCLEDLPRLNAPNFYYALEDVLFEEV  178



>gb|AHI88616.2| progesterone 5-beta-reductase [Capsella bursa-pastoris]
Length=386

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 148/192 (77%), Gaps = 8/192 (4%)
 Frame = +1

Query  85   SWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKV  264
             WW AGAIGAA+K+ EED+    P  +QSV LI+GVTGIVGNSLAEILPL+DTPGGPWKV
Sbjct  3    GWWGAGAIGAAKKKLEEDEP--PPRSYQSVGLIIGVTGIVGNSLAEILPLSDTPGGPWKV  60

Query  265  YGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA  444
            YGVARRP+P+WN+DHP++YIQCD+SD +D   KLS LTDVTH+F+V W NR +E ENCE 
Sbjct  61   YGVARRPQPSWNADHPIDYIQCDVSDTDDVRCKLSPLTDVTHIFFVAWTNRGSEPENCET  120

Query  445  NGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFG-AFQVFGKVAHDTPHHEDLPRLESPNF  621
            N  MLRNVL A++P++P+L+     TG KHY G  F   G   HD P  EDLPRL   NF
Sbjct  121  NAGMLRNVLRAIVPHAPNLR-----TGGKHYIGPTFANRGGSYHDPPFTEDLPRLPIQNF  175

Query  622  YYTLEDILFDEV  657
            YYTLED+LF+EV
Sbjct  176  YYTLEDVLFEEV  187



>gb|AES59361.2| 3-oxo-delta(4,5)-steroid 5-beta-reductase-like protein [Medicago 
truncatula]
Length=394

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 3/195 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEE--DDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGP  255
            M+WW A A G  +  +     +  +AP   Q+VALI+GVTGIVGNSLAEILPL DTPGGP
Sbjct  1    MNWWLAKASGTGKASYLSIITEFKEAPGSFQNVALIIGVTGIVGNSLAEILPLDDTPGGP  60

Query  256  WKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELEN  435
            WKVYGVARRP+P WN+D  + YIQCD+SD++D   KLS LTDVTH+FYV+W + PTE +N
Sbjct  61   WKVYGVARRPQPTWNADKYVHYIQCDVSDQKDVELKLSPLTDVTHIFYVSWTSMPTEAQN  120

Query  436  CEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLES  612
            CE NG MLRNVL A+IPN+ +L H+ LQTG KHY G+F+  GK+ AH++P  ED+PRL +
Sbjct  121  CEVNGSMLRNVLRALIPNTLNLCHVSLQTGTKHYLGSFETIGKIKAHESPFTEDVPRLVT  180

Query  613  PNFYYTLEDILFDEV  657
            PNFYYT EDIL +EV
Sbjct  181  PNFYYTQEDILLEEV  195



>ref|XP_010905260.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X2 [Elaeis guineensis]
Length=397

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 156/202 (77%), Gaps = 12/202 (6%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLD----APLKHQSVALIVGVTGIVGNSLAEILPLADTPG  249
            MSWW AGAIGAA+K+ +ED        AP K QSV L++GVTGIVGNSLAEILPL+DTPG
Sbjct  1    MSWWWAGAIGAAKKKIDEDSGGGGGGGAP-KFQSVGLVIGVTGIVGNSLAEILPLSDTPG  59

Query  250  GPWKVYGVARRP-----RPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWAN  414
            GPWKVYGV+RRP     RP       +E+IQCD+SD +DA +KLS LTDVTHVFYV WAN
Sbjct  60   GPWKVYGVSRRPLSVSFRPL-TEGLAVEHIQCDVSDPDDALAKLSPLTDVTHVFYVAWAN  118

Query  415  RPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHE  591
            R  E EN E N  +LRNVL AV+PN+P+L+H+CLQTG+KHY G+F+  GKV AH+ P  E
Sbjct  119  RIVEAENREVNSALLRNVLAAVLPNAPNLQHVCLQTGRKHYLGSFESLGKVKAHEPPFRE  178

Query  592  DLPRLESPNFYYTLEDILFDEV  657
            DLPRL+ PNFYY LEDILF+E+
Sbjct  179  DLPRLDCPNFYYDLEDILFEEM  200



>ref|XP_006420622.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
 gb|ESR33862.1| hypothetical protein CICLE_v10006945mg, partial [Citrus clementina]
Length=385

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 141/178 (79%), Gaps = 5/178 (3%)
 Frame = +1

Query  139  DDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPME  318
            D+ +    +Q V LIVGVTGIVGNSLAEILP  +TPGGPWKVYGVARRPRPAWN+DHP++
Sbjct  7    DEGEPSRDNQHVGLIVGVTGIVGNSLAEILPQPNTPGGPWKVYGVARRPRPAWNADHPIQ  66

Query  319  YIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPD  498
            YIQCD+SD ++  +KLS LTDVTH+FYVTWA+RPTELENC  NG MLRNVL +V+PN+P+
Sbjct  67   YIQCDVSDADETQAKLSKLTDVTHIFYVTWASRPTELENCHVNGAMLRNVLRSVMPNAPN  126

Query  499  LKHICLQTGKKHYFGAFQVFGKVA-----HDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            L+H+CLQTG KHY G F  F         HD P+ EDLPRL  PNFYY  EDILF+EV
Sbjct  127  LRHVCLQTGGKHYLGPFDYFVDTQLPHHPHDPPYTEDLPRLNVPNFYYDQEDILFEEV  184



>ref|XP_010905259.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like isoform 
X1 [Elaeis guineensis]
Length=425

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 156/202 (77%), Gaps = 12/202 (6%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLD----APLKHQSVALIVGVTGIVGNSLAEILPLADTPG  249
            MSWW AGAIGAA+K+ +ED        AP K QSV L++GVTGIVGNSLAEILPL+DTPG
Sbjct  1    MSWWWAGAIGAAKKKIDEDSGGGGGGGAP-KFQSVGLVIGVTGIVGNSLAEILPLSDTPG  59

Query  250  GPWKVYGVARRP-----RPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWAN  414
            GPWKVYGV+RRP     RP       +E+IQCD+SD +DA +KLS LTDVTHVFYV WAN
Sbjct  60   GPWKVYGVSRRPLSVSFRPL-TEGLAVEHIQCDVSDPDDALAKLSPLTDVTHVFYVAWAN  118

Query  415  RPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHE  591
            R  E EN E N  +LRNVL AV+PN+P+L+H+CLQTG+KHY G+F+  GKV AH+ P  E
Sbjct  119  RIVEAENREVNSALLRNVLAAVLPNAPNLQHVCLQTGRKHYLGSFESLGKVKAHEPPFRE  178

Query  592  DLPRLESPNFYYTLEDILFDEV  657
            DLPRL+ PNFYY LEDILF+E+
Sbjct  179  DLPRLDCPNFYYDLEDILFEEM  200



>ref|XP_006432518.1| hypothetical protein CICLE_v10003867mg [Citrus clementina]
 gb|ESR45758.1| hypothetical protein CICLE_v10003867mg [Citrus clementina]
Length=344

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 146/193 (76%), Gaps = 17/193 (9%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSW+ AGAIGAA+                +V L++GVTGIVGNSLAEIL  +DTP GPWK
Sbjct  1    MSWFWAGAIGAAK----------------NVGLVIGVTGIVGNSLAEILLRSDTPVGPWK  44

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVAR PRP WN D+P+EYIQCD+SD+ED  +KLS LTD+TH+FYVTWA+R TE ENC+
Sbjct  45   VYGVARHPRPNWNDDYPVEYIQCDVSDQEDTQAKLSKLTDITHIFYVTWASRRTEAENCQ  104

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M  NVL++VIPN+P+L+HICLQTG KHY G F+  GK+ +HD P  EDLPRL    
Sbjct  105  INGAMFHNVLSSVIPNAPNLRHICLQTGGKHYVGPFEFVGKIPSHDPPFTEDLPRLNVTL  164

Query  619  FYYTLEDILFDEV  657
            FYYTLEDILF E+
Sbjct  165  FYYTLEDILFKEI  177



>ref|XP_010497523.1| PREDICTED: 3-oxo-Delta(4,5)-steroid 5-beta-reductase-like, partial 
[Camelina sativa]
Length=152

 Score =   246 bits (629),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ ++D+   +   ++SVALI+GVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWAGAIGAAKKKLDDDEPTQS---YESVALIIGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP+WN+DHP++YIQCD+S+ +DA SKLS LTDVTHVFYVTW NR +E ENCE
Sbjct  58   VYGVARRPRPSWNADHPIDYIQCDVSNADDARSKLSPLTDVTHVFYVTWTNRESETENCE  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFG  543
            ANG MLRNVL AV+P++P+L+H+CLQTG KHY G
Sbjct  118  ANGSMLRNVLRAVVPHAPNLRHVCLQTGTKHYLG  151



>gb|KJB83175.1| hypothetical protein B456_013G233500 [Gossypium raimondii]
Length=376

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 147/193 (76%), Gaps = 17/193 (9%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW A AIGAA+K+FEED+    P   +SV L++GVTG+VGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWWADAIGAAKKKFEEDE---TPKSFKSVGLVIGVTGMVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVA             +YIQCD+S+  D  SKLS LTDVTH+FYV+W  R +E ENCE
Sbjct  58   VYGVA-------------QYIQCDVSNPNDTKSKLSQLTDVTHIFYVSWTMRTSEAENCE  104

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG MLRNVL +VIPN+P+L+HICLQTG KHY G+F++FGK+  HD P  EDLPRL + N
Sbjct  105  TNGSMLRNVLRSVIPNAPNLRHICLQTGSKHYLGSFELFGKIQLHDPPFTEDLPRLNALN  164

Query  619  FYYTLEDILFDEV  657
            FYY  EDILF+E+
Sbjct  165  FYYHQEDILFEEI  177



>gb|KHG08322.1| Uncharacterized protein F383_14595 [Gossypium arboreum]
Length=393

 Score =   254 bits (649),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 146/195 (75%), Gaps = 6/195 (3%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAIGAA+K+ EE D      K++SVAL++G+TGIVGNSLAEILP +  PGGPWK
Sbjct  1    MSWWWAGAIGAAKKKMEEHDKQS---KYKSVALVIGITGIVGNSLAEILPFSGIPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVAR+PR A  S  P+EYIQCD+ DEE+ + KLS L DVTHVFYV W  R TE ENC 
Sbjct  58   VYGVARQPRRASTSHLPIEYIQCDVLDEEETYDKLSKLNDVTHVFYVAWDKRSTEDENCV  117

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV---AHDTPHHEDLPRLES  612
             NG MLRNVL AVIPNS  LKHICLQTG++HY G   ++GK     HD P  EDL RL+S
Sbjct  118  INGTMLRNVLKAVIPNSRKLKHICLQTGRRHYTGPIDLYGKYHVQPHDPPFREDLQRLKS  177

Query  613  PNFYYTLEDILFDEV  657
             NF YTLED+L +EV
Sbjct  178  SNFCYTLEDVLLEEV  192



>ref|XP_010099074.1| hypothetical protein L484_011508 [Morus notabilis]
 gb|EXB76663.1| hypothetical protein L484_011508 [Morus notabilis]
Length=378

 Score =   250 bits (639),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 148/193 (77%), Gaps = 16/193 (8%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AGAI AA+K+ E D    AP ++QSVAL+VGVTGIVGNSLAEILPL+DTPGGPWK
Sbjct  1    MSWWLAGAIRAAKKKREYDY---APSEYQSVALVVGVTGIVGNSLAEILPLSDTPGGPWK  57

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
                        N+DHP+ YIQCD+SD +     LS LTDVTH+FYVTW+++PTE ENC 
Sbjct  58   ------------NADHPITYIQCDVSDPQQTKDHLSKLTDVTHIFYVTWSSQPTEAENCS  105

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-HDTPHHEDLPRLESPN  618
             NG ML NVL AVIP++P+L+HICLQTG+KHY G F++ GKV  H+ P HEDLPRL++PN
Sbjct  106  VNGAMLGNVLEAVIPHAPNLQHICLQTGRKHYIGPFELLGKVEPHEPPFHEDLPRLDAPN  165

Query  619  FYYTLEDILFDEV  657
            FYY  EDIL +EV
Sbjct  166  FYYVQEDILVEEV  178



>ref|XP_006489807.1| PREDICTED: uncharacterized protein LOC102610524 [Citrus sinensis]
Length=826

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 146/196 (74%), Gaps = 18/196 (9%)
 Frame = +1

Query  124  RFEEDDDLDAPL-------------KHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKV  264
            RFEED  L + +              +Q V LIVGVTGIVGNSLAEILP  +TPGGPWKV
Sbjct  430  RFEEDSALCSSVLVQNKLDEGEPSRDNQHVGLIVGVTGIVGNSLAEILPQPNTPGGPWKV  489

Query  265  YGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEA  444
            YGVARRPRPAWN+DHP++YIQCD+SD ++  +KLS LTDVTH+FYVTWA+RPTELENC  
Sbjct  490  YGVARRPRPAWNADHPIQYIQCDVSDADETQAKLSKLTDVTHIFYVTWASRPTELENCHV  549

Query  445  NGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKVA-----HDTPHHEDLPRLE  609
            NG MLRNVL +VIPN+P+L+H CLQTG KHY G F  F +       HD P+ EDLPRL 
Sbjct  550  NGAMLRNVLRSVIPNAPNLRHFCLQTGGKHYLGPFDYFVETQLPHHPHDPPYTEDLPRLN  609

Query  610  SPNFYYTLEDILFDEV  657
             PNFYY  EDILF+EV
Sbjct  610  VPNFYYDQEDILFEEV  625



>gb|ABD33273.2| VEP1 , putative [Medicago truncatula]
Length=407

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  148  DAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQ  327
            +AP   Q+VALI+GVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P WN+D  + YIQ
Sbjct  38   EAPGSFQNVALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYVHYIQ  97

Query  328  CDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKH  507
            CD+SD++D   KLS LTDVTH+FYV+W + PTE +NCE NG MLRNVL A+IPN+ +L H
Sbjct  98   CDVSDQKDVELKLSPLTDVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLNLCH  157

Query  508  ICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            + LQTG KHY G+F+  GK+ AH++P  ED+PRL +PNFYYT EDIL +EV
Sbjct  158  VSLQTGTKHYLGSFETIGKIKAHESPFTEDVPRLVTPNFYYTQEDILLEEV  208



>gb|AHC23071.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +1

Query  196  GIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVL  375
            GIVGNSLAEILPL+DTPGGPWKVYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS L
Sbjct  1    GIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPITYIRCDVSDSGDAEEKLSPL  60

Query  376  TDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQV  555
            TDVT++FYVTW N+ TE ENCEANGKML+NVL+A+IPN P+LKHICL TG+KHY G F+ 
Sbjct  61   TDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFES  120

Query  556  FGKV-AHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
             GK+ +HD P  EDLPRL+  NFYYTLEDILF+EV
Sbjct  121  IGKIQSHDPPFTEDLPRLDCLNFYYTLEDILFEEV  155



>ref|XP_003589110.1| hypothetical protein MTR_1g018590 [Medicago truncatula]
Length=399

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +1

Query  148  DAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQ  327
            +AP   Q+VALI+GVTGIVGNSLAEILPL DTPGGPWKVYGVARRP+P WN+D  + YIQ
Sbjct  28   EAPGSFQNVALIIGVTGIVGNSLAEILPLDDTPGGPWKVYGVARRPQPTWNADKYVHYIQ  87

Query  328  CDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKH  507
            CD+SD++D   KLS LTDVTH+FYV+W + PTE +NCE NG MLRNVL A+IPN+ +L H
Sbjct  88   CDVSDQKDVELKLSPLTDVTHIFYVSWTSMPTEAQNCEVNGSMLRNVLRALIPNTLNLCH  147

Query  508  ICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
            + LQTG KHY G+F+  GK+ AH++P  ED+PRL +PNFYYT EDIL +EV
Sbjct  148  VSLQTGTKHYLGSFETIGKIKAHESPFTEDVPRLVTPNFYYTQEDILLEEV  198



>ref|XP_006432520.1| hypothetical protein CICLE_v10003925mg [Citrus clementina]
 gb|ESR45760.1| hypothetical protein CICLE_v10003925mg [Citrus clementina]
Length=419

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 146/198 (74%), Gaps = 6/198 (3%)
 Frame = +1

Query  82   MSWW-----RAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTP  246
            MSWW      A    +  K   + ++ +    +QSV L+VGVTGIVGNSLAEILP  DTP
Sbjct  1    MSWWWAGAIGAAKAKSYSKFINKLEEYEQTRDYQSVGLVVGVTGIVGNSLAEILPRPDTP  60

Query  247  GGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTE  426
            GGPWKVYGVARRPRP WN+ +P+EY+QCD+SD+ED  +KLS LTDVTH+FYVTW  R TE
Sbjct  61   GGPWKVYGVARRPRPNWNAAYPVEYLQCDVSDQEDTQAKLSKLTDVTHIFYVTWDGRRTE  120

Query  427  LENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPR  603
             ENC+ NG ML NVL +VIPN+P+L+HICLQTG K+Y G  +  GK+ +HD P  EDLP 
Sbjct  121  AENCQINGAMLHNVLRSVIPNAPNLRHICLQTGGKYYMGPLEFIGKIPSHDPPFTEDLPS  180

Query  604  LESPNFYYTLEDILFDEV  657
            L    FYYTLEDILF+EV
Sbjct  181  LNISLFYYTLEDILFEEV  198



>gb|AHC23070.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +1

Query  196  GIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVL  375
            GIVGNSLAEILPL+DTPGGPWKVYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS L
Sbjct  1    GIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPITYIRCDVSDSVDAKEKLSPL  60

Query  376  TDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQV  555
            TDVT++FYVTW N+ TE ENCEANGKML+NVL+A+IPN P+LKHICL TG+KHY G F+ 
Sbjct  61   TDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFES  120

Query  556  FGKV-AHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
             GK+ +HD P  EDLPRL+  NFYYTLEDILF+EV
Sbjct  121  IGKIQSHDPPFTEDLPRLDCLNFYYTLEDILFEEV  155



>gb|AHC23069.1| putative progesterone 5beta-reductase, partial [Thymus x citriodorus]
Length=354

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +1

Query  196  GIVGNSLAEILPLADTPGGPWKVYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVL  375
            GIVGNSLAEILPL+DTPGGPWKVYGVARRPRPAWN DHP+ YI+CD+SD  DA  KLS L
Sbjct  1    GIVGNSLAEILPLSDTPGGPWKVYGVARRPRPAWNEDHPITYIRCDVSDSVDAKEKLSPL  60

Query  376  TDVTHVFYVTWANRPTELENCEANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQV  555
            TDVT++FYVTW N+ TE ENCEANGKML+NVL+A+IPN P+LKHICL TG+KHY G F+ 
Sbjct  61   TDVTNIFYVTWTNKSTEAENCEANGKMLKNVLDALIPNCPNLKHICLLTGRKHYTGPFES  120

Query  556  FGKV-AHDTPHHEDLPRLESPNFYYTLEDILFDEV  657
             GK+ +HD P  EDLPRL+  NFYYTLEDILF+EV
Sbjct  121  IGKIQSHDPPFTEDLPRLDCLNFYYTLEDILFEEV  155



>ref|XP_006374843.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
 gb|ERP52640.1| hypothetical protein POPTR_0014s01960g [Populus trichocarpa]
Length=388

 Score =   248 bits (632),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 145/193 (75%), Gaps = 7/193 (4%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AG + AA K+              SVALIVGVTGIVGNSLAEILP +DTPGGPWK
Sbjct  1    MSWWWAGDLSAAWKKPAVQGG------QGSVALIVGVTGIVGNSLAEILPRSDTPGGPWK  54

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W+ + P+EYIQCDISD   A SKLS LTDVTH+FYVTWA+R  E ENC+
Sbjct  55   VYGVARRPRPNWHENCPVEYIQCDISDSALAKSKLSHLTDVTHIFYVTWASRSNEAENCK  114

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RN+L AV+P + +L+H+CLQTG K+Y G F+ F    +HD P+ EDLPRL+  N
Sbjct  115  INGLMFRNLLQAVVPIATNLRHVCLQTGTKNYIGPFESFYNFESHDPPYSEDLPRLKVDN  174

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  175  FYYTLEDVMFEEV  187



>ref|XP_006387765.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
 gb|ERP46679.1| hypothetical protein POPTR_0602s00210g [Populus trichocarpa]
Length=388

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 145/193 (75%), Gaps = 7/193 (4%)
 Frame = +1

Query  82   MSWWRAGAIGAARKRFEEDDDLDAPLKHQSVALIVGVTGIVGNSLAEILPLADTPGGPWK  261
            MSWW AG + AA K+              SVALIVGVTGIVGNSLAEILP +DTPGGPWK
Sbjct  1    MSWWWAGDLSAAWKKPAVQGG------QGSVALIVGVTGIVGNSLAEILPRSDTPGGPWK  54

Query  262  VYGVARRPRPAWNSDHPMEYIQCDISDEEDAHSKLSVLTDVTHVFYVTWANRPTELENCE  441
            VYGVARRPRP W+ + P+EYIQCDISD   A SKLS LTDVTH+FYVTWA+R  E ENC+
Sbjct  55   VYGVARRPRPNWHENCPVEYIQCDISDSALAKSKLSHLTDVTHIFYVTWASRSNEAENCK  114

Query  442  ANGKMLRNVLNAVIPNSPDLKHICLQTGKKHYFGAFQVFGKV-AHDTPHHEDLPRLESPN  618
             NG M RN+L AV+P + +L+H+CLQTG K+Y G F+ F    +HD P+ EDLPRL+  N
Sbjct  115  INGLMFRNLLQAVVPIATNLRHVCLQTGTKNYIGPFESFYNFESHDPPYSEDLPRLKVDN  174

Query  619  FYYTLEDILFDEV  657
            FYYTLED++F+EV
Sbjct  175  FYYTLEDVMFEEV  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500