BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035B08

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591921.1|  PREDICTED: uncharacterized protein LOC104088...    180   6e-52   Nicotiana tomentosiformis
ref|XP_004239953.1|  PREDICTED: uncharacterized protein LOC101260820    180   1e-51   Solanum lycopersicum
ref|XP_006355641.1|  PREDICTED: uncharacterized protein LOC102579...    179   2e-51   Solanum tuberosum [potatoes]
ref|XP_009776956.1|  PREDICTED: uncharacterized protein LOC104226...    178   4e-51   Nicotiana sylvestris
ref|XP_011076650.1|  PREDICTED: uncharacterized protein LOC105160850    169   1e-47   Sesamum indicum [beniseed]
ref|XP_010087539.1|  hypothetical protein L484_006944                   161   7e-45   
emb|CDP13970.1|  unnamed protein product                                162   9e-45   Coffea canephora [robusta coffee]
gb|EYU20061.1|  hypothetical protein MIMGU_mgv1a011365mg                161   2e-44   Erythranthe guttata [common monkey flower]
gb|KDO68854.1|  hypothetical protein CISIN_1g037714mg                   157   5e-44   Citrus sinensis [apfelsine]
ref|XP_006435816.1|  hypothetical protein CICLE_v10032369mg             159   1e-43   Citrus clementina [clementine]
gb|KFK36924.1|  hypothetical protein AALP_AA4G190300                    158   1e-43   Arabis alpina [alpine rockcress]
gb|KHG25155.1|  Autophagy-related 27                                    159   2e-43   Gossypium arboreum [tree cotton]
gb|KJB74366.1|  hypothetical protein B456_011G290500                    158   2e-43   Gossypium raimondii
ref|XP_008374955.1|  PREDICTED: uncharacterized protein LOC103438201    156   4e-43   
ref|XP_009345387.1|  PREDICTED: uncharacterized protein LOC103937190    157   5e-43   Pyrus x bretschneideri [bai li]
gb|KDP44701.1|  hypothetical protein JCGZ_01201                         157   5e-43   Jatropha curcas
ref|XP_008343653.1|  PREDICTED: uncharacterized protein LOC103406452    156   6e-43   
ref|XP_003600978.1|  hypothetical protein MTR_3g071640                  156   1e-42   Medicago truncatula
ref|XP_006847437.1|  hypothetical protein AMTR_s00153p00085570          156   1e-42   
ref|XP_008233813.1|  PREDICTED: uncharacterized protein LOC103332...    156   2e-42   Prunus mume [ume]
ref|XP_011003184.1|  PREDICTED: uncharacterized protein LOC105109...    154   2e-42   Populus euphratica
ref|XP_010067562.1|  PREDICTED: uncharacterized protein LOC104454422    155   3e-42   Eucalyptus grandis [rose gum]
ref|XP_008363771.1|  PREDICTED: uncharacterized protein LOC103427...    154   6e-42   
ref|XP_009416304.1|  PREDICTED: uncharacterized protein LOC103996952    153   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011003078.1|  PREDICTED: uncharacterized protein LOC105109...    153   2e-41   Populus euphratica
ref|XP_004148171.1|  PREDICTED: uncharacterized protein LOC101220308    153   2e-41   
ref|XP_007008866.1|  Leucine-rich repeat and IQ domain-containing...    150   4e-41   
ref|XP_002879864.1|  hypothetical protein ARALYDRAFT_903321             152   5e-41   Arabidopsis lyrata subsp. lyrata
ref|XP_009369218.1|  PREDICTED: uncharacterized protein LOC103958...    151   7e-41   Pyrus x bretschneideri [bai li]
ref|XP_006591393.1|  PREDICTED: uncharacterized protein LOC100809288    151   7e-41   
ref|XP_006294775.1|  hypothetical protein CARUB_v10023827mg             150   2e-40   Capsella rubella
gb|ACU20834.1|  unknown                                                 149   2e-40   Glycine max [soybeans]
ref|XP_007008865.1|  Leucine-rich repeat and IQ domain-containing...    150   2e-40   
ref|XP_007008868.1|  Leucine-rich repeat and IQ domain-containing...    150   2e-40   
ref|XP_007163579.1|  hypothetical protein PHAVU_001G246100g             150   2e-40   Phaseolus vulgaris [French bean]
ref|XP_007008869.1|  Leucine-rich repeat and IQ domain-containing...    150   2e-40   
ref|XP_006411289.1|  hypothetical protein EUTSA_v10017062mg             149   4e-40   Eutrema salsugineum [saltwater cress]
ref|XP_004307687.1|  PREDICTED: uncharacterized protein LOC101315282    149   5e-40   Fragaria vesca subsp. vesca
gb|AFK44428.1|  unknown                                                 148   6e-40   Lotus japonicus
ref|XP_010534619.1|  PREDICTED: uncharacterized protein LOC104810122    148   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_010505757.1|  PREDICTED: uncharacterized protein LOC104782...    148   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002520790.1|  conserved hypothetical protein                     146   2e-39   
ref|XP_010692932.1|  PREDICTED: uncharacterized protein LOC104905961    148   3e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008454838.1|  PREDICTED: uncharacterized protein LOC103495149    147   4e-39   Cucumis melo [Oriental melon]
ref|XP_010517449.1|  PREDICTED: uncharacterized protein LOC104792...    146   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010921016.1|  PREDICTED: uncharacterized protein LOC105044726    146   6e-39   Elaeis guineensis
ref|NP_181562.4|  uncharacterized protein                               146   7e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508881.1|  PREDICTED: uncharacterized protein LOC104785...    146   8e-39   Camelina sativa [gold-of-pleasure]
emb|CDY18864.1|  BnaC04g04860D                                          145   2e-38   Brassica napus [oilseed rape]
ref|XP_009143225.1|  PREDICTED: uncharacterized protein LOC103866...    144   4e-38   Brassica rapa
ref|XP_002273745.2|  PREDICTED: uncharacterized protein LOC100255420    144   4e-38   Vitis vinifera
emb|CAN76264.1|  hypothetical protein VITISV_001854                     144   8e-38   Vitis vinifera
ref|XP_010264546.1|  PREDICTED: uncharacterized protein LOC104602...    143   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008804111.1|  PREDICTED: uncharacterized protein LOC103717...    142   2e-37   Phoenix dactylifera
ref|XP_002468020.1|  hypothetical protein SORBIDRAFT_01g038200          140   2e-37   
tpg|DAA44899.1|  TPA: hypothetical protein ZEAMMB73_360049              139   6e-37   
tpg|DAA44898.1|  TPA: hypothetical protein ZEAMMB73_360049              139   2e-36   
emb|CDX74798.1|  BnaA05g05440D                                          140   2e-36   
ref|XP_008647632.1|  PREDICTED: uncharacterized protein LOC100502...    139   5e-36   Zea mays [maize]
ref|NP_001183686.1|  uncharacterized protein LOC100502280 precursor     139   6e-36   Zea mays [maize]
ref|XP_008647628.1|  PREDICTED: uncharacterized protein LOC100502...    139   1e-35   Zea mays [maize]
gb|EEE58880.1|  hypothetical protein OsJ_10490                          136   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002311247.2|  hypothetical protein POPTR_0008s07320g             138   4e-35   
gb|EEC75047.1|  hypothetical protein OsI_11153                          135   4e-35   Oryza sativa Indica Group [Indian rice]
ref|NP_001049832.1|  Os03g0296700                                       135   6e-35   
ref|XP_004984880.1|  PREDICTED: uncharacterized protein LOC101783...    136   7e-35   
dbj|BAJ90180.1|  predicted protein                                      133   8e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003558130.1|  PREDICTED: uncharacterized protein LOC100823098    131   3e-33   Brachypodium distachyon [annual false brome]
gb|EMT00564.1|  hypothetical protein F775_08095                         130   5e-33   
ref|XP_006651281.1|  PREDICTED: uncharacterized protein LOC102717143    128   4e-31   Oryza brachyantha
gb|KHN04787.1|  hypothetical protein glysoja_031887                     124   1e-30   Glycine soja [wild soybean]
ref|XP_008233814.1|  PREDICTED: uncharacterized protein LOC103332...    118   2e-28   Prunus mume [ume]
ref|XP_008363772.1|  PREDICTED: uncharacterized protein LOC103427...    116   1e-27   
tpg|DAA44895.1|  TPA: hypothetical protein ZEAMMB73_360049              112   2e-27   
ref|XP_009369219.1|  PREDICTED: uncharacterized protein LOC103958...    112   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_010264547.1|  PREDICTED: uncharacterized protein LOC104602...    108   8e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006355642.1|  PREDICTED: uncharacterized protein LOC102579...    100   3e-22   Solanum tuberosum [potatoes]
ref|XP_009591922.1|  PREDICTED: uncharacterized protein LOC104088...  99.8    7e-22   Nicotiana tomentosiformis
ref|XP_009776957.1|  PREDICTED: uncharacterized protein LOC104226...  96.3    1e-20   Nicotiana sylvestris
gb|EPS65241.1|  hypothetical protein M569_09538                       88.6    7e-19   Genlisea aurea
ref|XP_007219770.1|  hypothetical protein PRUPE_ppa025595mg           85.5    6e-17   
gb|KJB74365.1|  hypothetical protein B456_011G290500                  83.2    6e-16   Gossypium raimondii
ref|XP_006411288.1|  hypothetical protein EUTSA_v10017062mg           83.2    6e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006294774.1|  hypothetical protein CARUB_v10023827mg           82.8    9e-16   Capsella rubella
ref|XP_001756445.1|  predicted protein                                84.3    1e-15   
ref|XP_010517450.1|  PREDICTED: uncharacterized protein LOC104792...  82.0    2e-15   Camelina sativa [gold-of-pleasure]
gb|AAX55150.1|  hypothetical protein At2g40316                        81.3    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508882.1|  PREDICTED: uncharacterized protein LOC104785...  81.3    3e-15   Camelina sativa [gold-of-pleasure]
gb|AAO86846.1|  hypothetical protein                                  81.3    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505758.1|  PREDICTED: uncharacterized protein LOC104782...  80.9    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_007008867.1|  Leucine-rich repeat and IQ domain-containing...  80.5    5e-15   
ref|XP_009143226.1|  PREDICTED: uncharacterized protein LOC103866...  80.5    6e-15   Brassica rapa
gb|ACR36424.1|  unknown                                               79.3    6e-15   Zea mays [maize]
gb|KEH34808.1|  autophagy-related protein                             79.0    1e-14   Medicago truncatula
ref|XP_008804113.1|  PREDICTED: uncharacterized protein LOC103717...  77.8    4e-14   Phoenix dactylifera
gb|KCW65716.1|  hypothetical protein EUGRSUZ_G03091                   75.1    4e-13   Eucalyptus grandis [rose gum]
gb|AAD25947.1|AF085279_20  hypothetical protein                       72.4    7e-13   Arabidopsis thaliana [mouse-ear cress]
gb|KHN31307.1|  hypothetical protein glysoja_022961                   67.4    8e-10   Glycine soja [wild soybean]
gb|EPS63394.1|  hypothetical protein M569_11391                       59.7    7e-08   Genlisea aurea
gb|KCW65717.1|  hypothetical protein EUGRSUZ_G03091                   59.7    9e-08   Eucalyptus grandis [rose gum]
ref|NP_001078029.1|  uncharacterized protein                          52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAY82253.1|  hypothetical protein At2g40316                        52.0    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264548.1|  PREDICTED: uncharacterized protein LOC104602...  51.6    1e-04   Nelumbo nucifera [Indian lotus]



>ref|XP_009591921.1| PREDICTED: uncharacterized protein LOC104088879 isoform X1 [Nicotiana 
tomentosiformis]
Length=283

 Score =   180 bits (457),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 111/142 (78%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  SF+QNNKLYNY+LT+PI NFPHG+LSEDGFY+VA NGTV+WFQLC+ M+FNHDPP C
Sbjct  33   CQLSFEQNNKLYNYSLTAPIRNFPHGILSEDGFYKVAVNGTVLWFQLCDAMIFNHDPPTC  92

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL ++IIGGYPVC TLG  S+T   LID   PLKGI  K  + 
Sbjct  93   IDCRDCGGNSRCGMGCSALVANIIGGYPVCTTLGYSSSTFFELIDKKDPLKGITAKMSYR  152

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSLAVS+VCD +   GP
Sbjct  153  GPKLNCSLAVSIVCDTNGVQGP  174



>ref|XP_004239953.1| PREDICTED: uncharacterized protein LOC101260820 [Solanum lycopersicum]
Length=283

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF+Q+NKLYNY+LT PI NFPHG+LSEDGFY+VA NGTV+WFQLC+ M+FNHDPP C
Sbjct  31   CQFSFEQDNKLYNYSLTKPIRNFPHGILSEDGFYKVAVNGTVLWFQLCDAMIFNHDPPTC  90

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            ++C DCGG SRCGMGCSAL ++IIGGYPVC TLG  S+T   LID   PLKGI  K ++ 
Sbjct  91   VECGDCGGISRCGMGCSALVANIIGGYPVCTTLGYSSSTFFELIDKTDPLKGITAKLFNR  150

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
               +NCSLAVS+VCD +   GP
Sbjct  151  GSKSNCSLAVSIVCDTNGVQGP  172



>ref|XP_006355641.1| PREDICTED: uncharacterized protein LOC102579236 isoform X1 [Solanum 
tuberosum]
Length=283

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  SF+Q NKLYNY+LT+PI NFPHG+LSEDGFY+VA NGTV+WFQLC+ M+FNHDPP C
Sbjct  33   CQLSFEQGNKLYNYSLTNPIRNFPHGILSEDGFYKVAVNGTVLWFQLCDAMIFNHDPPTC  92

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            ++C DCGG SRCGMGCSAL ++IIGGYPVC TLG  S+TS  LID   PLKGI  K  + 
Sbjct  93   VECGDCGGISRCGMGCSALVANIIGGYPVCTTLGYSSSTSFELIDKTDPLKGITAKLSNR  152

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
               +NCSLAVSVVCD +   GP
Sbjct  153  GSKSNCSLAVSVVCDTNGVQGP  174



>ref|XP_009776956.1| PREDICTED: uncharacterized protein LOC104226625 isoform X1 [Nicotiana 
sylvestris]
Length=283

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  SF+QNNKLYNY+LT+PI NFPHG+LSEDGFY+VAANGTV+WFQLC+ M+FNHDPP C
Sbjct  33   CQLSFEQNNKLYNYSLTTPIRNFPHGILSEDGFYKVAANGTVLWFQLCDAMIFNHDPPTC  92

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL ++ +GGYPVC TLG  S+T   LID   PLKGI  K  + 
Sbjct  93   IDCKDCGGNSRCGMGCSALVANTVGGYPVCTTLGYSSSTIFELIDKKDPLKGITAKMSYR  152

Query  597  ALNTNCSLAVSVVCD  641
                NCSLAVS+VCD
Sbjct  153  GPKLNCSLAVSIVCD  167



>ref|XP_011076650.1| PREDICTED: uncharacterized protein LOC105160850 [Sesamum indicum]
Length=284

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF+ +NK+Y+Y+L SP+  FPHG+LSEDGFY+VAANGTV+WFQLC +M+FNHDPPMC
Sbjct  34   CELSFKDSNKVYHYSLVSPLRKFPHGILSEDGFYKVAANGTVLWFQLCGSMIFNHDPPMC  93

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL S+ + GYPVC T+G+PS+T I + D  SP  G++VK  HT
Sbjct  94   VDCKDCGGSSRCGMGCSALVSNNVEGYPVCTTIGQPSSTVIDVHDRKSPHTGVIVKMTHT  153

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSL+VSV+C+ +   GP
Sbjct  154  GSKRNCSLSVSVICNSNGVQGP  175



>ref|XP_010087539.1| hypothetical protein L484_006944 [Morus notabilis]
 gb|EXB29270.1| hypothetical protein L484_006944 [Morus notabilis]
Length=257

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            CD+S    NKLYN+NL SP+ NFPHGVLSEDGFY+V  N TV+WFQLC+ M FNHDPP C
Sbjct  35   CDFSITDRNKLYNFNLASPLRNFPHGVLSEDGFYKVEENETVLWFQLCDVMGFNHDPPKC  94

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG S CGM CSAL ++ IGGYPVC T+GR  + SI++ID  +P  G++VK  ++
Sbjct  95   VDCPDCGGPSHCGMNCSALVANNIGGYPVCTTIGRAKSISINIIDKENPPMGVIVKMSNS  154

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSL VSV+CD +   GP
Sbjct  155  GQAHNCSLTVSVICDANGVQGP  176



>emb|CDP13970.1| unnamed protein product [Coffea canephora]
Length=293

 Score =   162 bits (410),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S++ +N+LYNY+L SP+  FPHGVLSEDGFY+VA N TV+W QLC+ MLFNHDPP C
Sbjct  43   CEFSYRDHNRLYNYSLASPLRKFPHGVLSEDGFYKVAVNETVLWIQLCDVMLFNHDPPTC  102

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG SRCGMGCSAL ++II GYP+C ++GR S+T + LIDN  P  G+VVK  ++
Sbjct  103  IDCMDCGGPSRCGMGCSALVANIIQGYPICNSVGRLSSTIVYLIDNKKPHMGVVVKMSNS  162

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCS++VSV+CD +   GP
Sbjct  163  QPKLNCSVSVSVICDYNGVEGP  184



>gb|EYU20061.1| hypothetical protein MIMGU_mgv1a011365mg [Erythranthe guttata]
Length=284

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S +  NK+Y Y+L SP+ NFPHG+LSEDGFY+VAANG+ +WFQLC +M+FNHDPP C
Sbjct  34   CELSVKDKNKVYYYSLKSPLRNFPHGILSEDGFYKVAANGSKLWFQLCGSMIFNHDPPTC  93

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL S+ I GYPVC TLG+PS+TSI ++D   P  GI+VK  ++
Sbjct  94   VDCKDCGGSSRCGMGCSALISNRIEGYPVCTTLGQPSSTSIDVLDIKDPRMGIIVKMTNS  153

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSL+VSV+C+ +   GP
Sbjct  154  GPKRNCSLSVSVICNSNGVQGP  175



>gb|KDO68854.1| hypothetical protein CISIN_1g037714mg, partial [Citrus sinensis]
Length=204

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S   N+ +YNY+LTSP+  +PHGVLSEDGFY+VA N TV+WFQLC+ M+FNHDPP+C
Sbjct  25   CELSLVHNDNVYNYSLTSPLDKYPHGVLSEDGFYKVAVNQTVLWFQLCDGMIFNHDPPVC  84

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG S CG+GCSAL    IGGYPVC +LG  S+T+I++ D N P  G++VK  H+
Sbjct  85   VDCLDCGGPSHCGLGCSALVEKSIGGYPVCTSLGHVSSTNITIRDKNHPNNGVIVKMTHS  144

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                +CSL+VSV+CD +   GP
Sbjct  145  GPKYSCSLSVSVICDLNGLQGP  166



>ref|XP_006435816.1| hypothetical protein CICLE_v10032369mg [Citrus clementina]
 ref|XP_006486247.1| PREDICTED: uncharacterized protein LOC102610808 [Citrus sinensis]
 gb|ESR49056.1| hypothetical protein CICLE_v10032369mg [Citrus clementina]
Length=275

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S   N+ +YNY+LTSP+  +PHGVLSEDGFY+VA N TV+WFQLC+ M+FNHDPP+C
Sbjct  25   CELSLMHNDNVYNYSLTSPLDKYPHGVLSEDGFYKVAVNQTVLWFQLCDGMIFNHDPPLC  84

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG S CG+GCSAL    IGGYPVC +LG  S+T+I++ D N P  G++VK  H+
Sbjct  85   VDCLDCGGPSHCGLGCSALVEKSIGGYPVCTSLGHVSSTNITIRDKNHPNNGVIVKMTHS  144

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                +CSL+VSV+CD +   GP
Sbjct  145  GPKYSCSLSVSVICDSNGLQGP  166



>gb|KFK36924.1| hypothetical protein AALP_AA4G190300 [Arabis alpina]
Length=276

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF + NK++++NL SPI NFPHGVLSEDGFYRV AN TV+WFQLC+ ++FNHDPP C
Sbjct  25   CEFSFNRRNKVFDFNLASPIRNFPHGVLSEDGFYRVEANNTVLWFQLCDVLIFNHDPPRC  84

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC +LG  S+T + ++D   P KG++VK    
Sbjct  85   VGCEDCGGSSHCGTSCSALVSENVRGYDVCISLGHASSTKVDMLDKEDPGKGVIVKMSSG  144

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
            ++N NCSL+VSV+C  +   GP
Sbjct  145  SMNQNCSLSVSVICQKNKVDGP  166



>gb|KHG25155.1| Autophagy-related 27 [Gossypium arboreum]
Length=279

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NKLYN++L SP+  FPHG+LSEDGFY+VA N TV+WFQLC  MLFNHDPP C
Sbjct  29   CEHSFNDGNKLYNFSLASPLPKFPHGILSEDGFYKVAGNETVLWFQLCGGMLFNHDPPRC  88

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C +CGG SRCG  CSALA+   GGY VC+TLG  S+T++S++D  +P KG++V+   +
Sbjct  89   AQCSECGGPSRCGTECSALAARNAGGYQVCSTLGHASSTNVSILDKQNPFKGVIVRMSSS  148

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              + +CSL+VS++CD + A GP
Sbjct  149  GKDPSCSLSVSIICDSNGAQGP  170



>gb|KJB74366.1| hypothetical protein B456_011G290500 [Gossypium raimondii]
Length=279

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NKLYN++L SP+  FPHG+LSEDGFY+VA N TV+WFQLC  MLFNHDPP C
Sbjct  29   CEHSFNDGNKLYNFSLASPLPKFPHGILSEDGFYKVAGNETVLWFQLCGGMLFNHDPPRC  88

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             +C +CGG SRCG  CSALA+   GGY VC+TLG  S+T++S++D  +P KG++V+   +
Sbjct  89   AECSECGGPSRCGTECSALAARNAGGYHVCSTLGHASSTNVSILDKQNPFKGVIVRMSSS  148

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              + +CSL+VS++CD + A GP
Sbjct  149  GKDPSCSLSVSILCDSNGAQGP  170



>ref|XP_008374955.1| PREDICTED: uncharacterized protein LOC103438201 [Malus domestica]
Length=246

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF  +NKLYNY L SPI  FPHGV SEDGFY+VAAN TV+WFQLC+ M+FNHDPP C
Sbjct  28   CHFSFVDDNKLYNYTLESPIPFFPHGVQSEDGFYKVAANETVLWFQLCDGMIFNHDPPRC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL ++ I GY VC T+GR S+  +++ID  +P  G++VK   +
Sbjct  88   VDCRDCGGASRCGMGCSALVANNIEGYDVCTTIGRASSIDMNIIDRKNPNTGVIVKMSSS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  148  GLKFNCSLSVSVICDPNRVQGP  169



>ref|XP_009345387.1| PREDICTED: uncharacterized protein LOC103937190 [Pyrus x bretschneideri]
Length=278

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF  +NKLYNY L SPI  FPHGV SEDGFY+VAAN TV+WFQLC  M+FNHDPP C
Sbjct  28   CHFSFVDDNKLYNYTLDSPIPFFPHGVQSEDGFYKVAANETVLWFQLCNGMIFNHDPPRC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGC AL ++ IGGY VC T+GR S+  +++ID  +P  G++VK   +
Sbjct  88   VDCRDCGGASRCGMGCIALVANNIGGYYVCTTIGRASSIDMNIIDRKNPNTGVIVKMSSS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  148  GLKFNCSLSVSVICDPNRVQGP  169



>gb|KDP44701.1| hypothetical protein JCGZ_01201 [Jatropha curcas]
Length=287

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 6/147 (4%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            CD SF   NKLYN++L SP+ NFPHGVLSEDGFY+VAAN +V+WFQLC+ M+FNHDPP C
Sbjct  32   CDLSFVDGNKLYNFSLASPLPNFPHGVLSEDGFYKVAANESVLWFQLCDGMIFNHDPPTC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG  RCGM CSAL +   GGY VC+T+G  S+TS S+ID   P KGI+VK  + 
Sbjct  92   VDCLDCGGPLRCGMKCSALVAKNKGGYDVCSTIGHVSSTSTSVIDKQKPHKGIIVKMSNI  151

Query  597  AL-----NTNCSLAVSVVCD-DAATGP  659
                   N +CSL+VS++CD + A GP
Sbjct  152  VKMPNGSNQSCSLSVSILCDSNGAKGP  178



>ref|XP_008343653.1| PREDICTED: uncharacterized protein LOC103406452 [Malus domestica]
Length=262

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF  +NKLYNY L SPI  FPHGV SEDGFY+VAAN TV+WFQLC+ M+FNHDPP C
Sbjct  28   CHFSFVDDNKLYNYTLXSPIPFFPHGVQSEDGFYKVAANETVLWFQLCDGMIFNHDPPRC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL ++ I GY VC T+GR S+  +++ID  +P  G++VK   +
Sbjct  88   VDCRDCGGASRCGMGCSALVANNIEGYDVCTTIGRASSIDMNIIDRKNPNTGVIVKMSSS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  148  GLKFNCSLSVSVICDPNRVQGP  169



>ref|XP_003600978.1| hypothetical protein MTR_3g071640 [Medicago truncatula]
 gb|AES71229.1| autophagy-related protein [Medicago truncatula]
Length=284

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF+  NKLYNY L+SPI NFPHG+LSEDGFY+V+ N T +WFQLC+ M+FNHDPP C
Sbjct  34   CKFSFRDGNKLYNYTLSSPIRNFPHGILSEDGFYKVSVNQTTLWFQLCDGMIFNHDPPTC  93

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG +RCGM C AL S+ IGGY VCA +GR     I +ID  +P  G+ VK   +
Sbjct  94   ADCWDCGGPTRCGMECGALVSNNIGGYHVCAAIGRGPKIDIDVIDKKNPHVGVTVKMSSS  153

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
            +L  NCSLAVSV+C+ +   GP
Sbjct  154  SLKYNCSLAVSVLCNVNGVQGP  175



>ref|XP_006847437.1| hypothetical protein AMTR_s00153p00085570 [Amborella trichopoda]
 gb|ERN09018.1| hypothetical protein AMTR_s00153p00085570 [Amborella trichopoda]
Length=279

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S    NKLYN++L SPI N+PHGVLSEDGFY VA NGT++WFQLC+ MLFNH+PP C
Sbjct  29   CEFSMLDQNKLYNFSLASPIKNYPHGVLSEDGFYVVALNGTILWFQLCDRMLFNHNPPRC  88

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C  C G   CG  CSAL +  I GY VC  +GR S + I+L+D   P KG++V+   +
Sbjct  89   FRCEGCDGSLYCGARCSALVAENIAGYHVCRAIGRASNSVITLLDRKDPHKGVIVRMTAS  148

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
            + N+NCSL+VSVVCD + A GP
Sbjct  149  SYNSNCSLSVSVVCDTNRALGP  170



>ref|XP_008233813.1| PREDICTED: uncharacterized protein LOC103332832 isoform X1 [Prunus 
mume]
Length=279

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +S   +NKLY+Y+L SPI  FPHG+ SEDGFY+VAAN TV+WFQLC+ M+FNHDPP C
Sbjct  28   CHFSVIDDNKLYDYSLGSPIPLFPHGIQSEDGFYKVAANETVLWFQLCDGMIFNHDPPRC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DCGG SRCGMGCSAL ++ IGGY VC+T+GR S+  I++ID  +P  G++VK  ++
Sbjct  88   VDCWDCGGPSRCGMGCSALVANNIGGYDVCSTIGRASSIDINIIDKKNPNSGVIVKMSNS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  148  GLKRNCSLSVSVICDPNRVQGP  169



>ref|XP_011003184.1| PREDICTED: uncharacterized protein LOC105109879 isoform X2 [Populus 
euphratica]
Length=215

 Score =   154 bits (388),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF   +K+Y +NL SP+ NFPHGVLSEDGFY+VA N TV+WFQLC+ M+FNHD P C
Sbjct  34   CELSFVVRDKVYRFNLVSPLPNFPHGVLSEDGFYKVAVNETVLWFQLCDGMIFNHDAPRC  93

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG SRCG+ CSAL +  I GY VC T+G+ ++TS ++IDN +P KG++VK   +
Sbjct  94   VDCLDCGGASRCGLECSALMARNIEGYDVCTTIGKVTSTSTNIIDNQNPHKGVIVKMTSS  153

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSL+VSV+CD +   GP
Sbjct  154  GSKHNCSLSVSVICDSNRVNGP  175



>ref|XP_010067562.1| PREDICTED: uncharacterized protein LOC104454422 [Eucalyptus grandis]
 gb|KCW65715.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=282

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF   ++LYNY+L SPI  FPHGVLSEDGFY+VAAN TV+WFQLC  M+FNHDPP C
Sbjct  32   CELSFPDRDRLYNYSLASPIPKFPHGVLSEDGFYKVAANDTVLWFQLCGVMIFNHDPPRC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC +CGG S CGM CSAL    +GGYPVC T+GR ++T +++ID   P  G+ VK    
Sbjct  92   VDCSNCGGPSHCGMECSALVIDDVGGYPVCKTIGRATSTYVNVIDEKKPHSGVTVKMISD  151

Query  597  ALNTNCSLAVSVVCD  641
               +NCSL+VS+VCD
Sbjct  152  GGKSNCSLSVSIVCD  166



>ref|XP_008363771.1| PREDICTED: uncharacterized protein LOC103427491 isoform X1 [Malus 
domestica]
Length=278

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +S   ++KLYNY L SPI  FPHGV SEDGFY+VAAN TV+WFQLC  M+FNHDPP C
Sbjct  28   CHFSVVDDDKLYNYTLDSPIPFFPHGVQSEDGFYKVAANETVLWFQLCNGMIFNHDPPRC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DC G S C MG SAL S+ IGGY VC T+GR S+  +++ID  +P  G++VK   +
Sbjct  88   VDCWDCVGASCCDMGSSALVSNNIGGYDVCTTIGRASSMDMNIIDRKNPNTGVIVKMSSS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  148  GLKFNCSLSVSVICDPNRVQGP  169



>ref|XP_009416304.1| PREDICTED: uncharacterized protein LOC103996952 [Musa acuminata 
subsp. malaccensis]
Length=278

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S + ++ LYNY+L SP   FPHGVLSEDGFY+V  N T +WFQLC+ M+FNHDPP C
Sbjct  31   CELSVRHSDVLYNYSLASPTDKFPHGVLSEDGFYKVTVNETSLWFQLCDQMIFNHDPPRC  90

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG SRCG  C+AL ++ +GGY VC T+GR S  +++LID NSP KG+VVKT   
Sbjct  91   YDCQDCGGPSRCGTMCNALVANSVGGYFVCTTIGRASNLNVALIDQNSPQKGVVVKTSSI  150

Query  597  ALNTNCSLAVSVVCD  641
                NCSL+VSV CD
Sbjct  151  GPKVNCSLSVSVFCD  165



>ref|XP_011003078.1| PREDICTED: uncharacterized protein LOC105109879 isoform X1 [Populus 
euphratica]
Length=283

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF   +K+Y +NL SP+ NFPHGVLSEDGFY+VA N TV+WFQLC+ M+FNHD P C
Sbjct  34   CELSFVVRDKVYRFNLVSPLPNFPHGVLSEDGFYKVAVNETVLWFQLCDGMIFNHDAPRC  93

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG SRCG+ CSAL +  I GY VC T+G+ ++TS ++IDN +P KG++VK   +
Sbjct  94   VDCLDCGGASRCGLECSALMARNIEGYDVCTTIGKVTSTSTNIIDNQNPHKGVIVKMTSS  153

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSL+VSV+CD +   GP
Sbjct  154  GSKHNCSLSVSVICDSNRVNGP  175



>ref|XP_004148171.1| PREDICTED: uncharacterized protein LOC101220308 [Cucumis sativus]
 gb|KGN50697.1| hypothetical protein Csa_5G217160 [Cucumis sativus]
Length=281

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+YS   N K+YN+NL SP S FPHGVLSEDGFYRVA N TV+WFQLC+ M+FNHDPPMC
Sbjct  31   CEYSLVNNGKMYNFNLASPTSKFPHGVLSEDGFYRVAVNNTVVWFQLCDGMIFNHDPPMC  90

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+ CGG S CGMGC AL ++ I GY VC T+G    T+IS+ID  +P +G+ VK  + 
Sbjct  91   IDCLGCGGPSHCGMGCGALVANKIEGYDVCTTIGLVQNTNISIIDIKNPDRGVAVKMSNI  150

Query  597  ALNTNCSLAVSVVC-DDAATGP  659
                 CSL+VSV+C  D   GP
Sbjct  151  DTKVKCSLSVSVICTTDGIQGP  172



>ref|XP_007008866.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 2 [Theobroma cacao]
 gb|EOY17676.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 2 [Theobroma cacao]
Length=214

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF + NKLYN++L SP+  FP+GVLSEDGFY+V  N +V+WFQLC+ MLFNHDPP C
Sbjct  32   CELSFVERNKLYNFSLASPLPRFPYGVLSEDGFYKVVMNESVLWFQLCDGMLFNHDPPRC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            ++C+DCGG SRCGM CSAL +    GY VC T+G  S+T++S+ID  +P KG++V+   +
Sbjct  92   VECLDCGGPSRCGMECSALVAKNALGYQVCTTIGHVSSTNVSVIDEQNPYKGVIVRMSSS  151

Query  597  ALNTNCSLAVSVVCDDAAT-GP  659
                NCSL+VS++CD     GP
Sbjct  152  GKGRNCSLSVSIICDSTGVQGP  173



>ref|XP_002879864.1| hypothetical protein ARALYDRAFT_903321 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56123.1| hypothetical protein ARALYDRAFT_903321 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   152 bits (383),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NK++++NL S I NFPHGVLSEDGFYRV AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFSFTGRNKVFDFNLASSIRNFPHGVLSEDGFYRVEANSTVLWFQLCDVLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC +LG  S+T + +ID   P KG++VK    
Sbjct  86   VGCEDCGGPSHCGTSCSALVSENVRGYDVCTSLGHASSTKVDIIDKEDPGKGVIVKMSGG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              N NCSL+VSV+C  +   GP
Sbjct  146  DRNQNCSLSVSVICQKNKVDGP  167



>ref|XP_009369218.1| PREDICTED: uncharacterized protein LOC103958653 isoform X1 [Pyrus 
x bretschneideri]
Length=278

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +S   ++KLYN+ L SPI  FPHGV SEDGFY+VAAN TV+WFQLC+ M+FNHDPP C
Sbjct  28   CHFSVVDDDKLYNFTLDSPIPFFPHGVQSEDGFYKVAANETVLWFQLCDGMIFNHDPPRC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC DC G S C MG SAL S+ IGGY VC T+GR S+ ++++ID  +   G++VK   +
Sbjct  88   VDCWDCVGASCCDMGSSALVSNNIGGYDVCTTIGRASSMNMNIIDRKNANTGVIVKMSSS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  148  GLKFNCSLSVSVICDPNRVQGP  169



>ref|XP_006591393.1| PREDICTED: uncharacterized protein LOC100809288 [Glycine max]
Length=278

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF    KLYNY L+SPI NFPHG+LSEDGFY+VA N T +WFQLC+ M+FNHDPP+C
Sbjct  28   CQFSFLDGKKLYNYTLSSPIRNFPHGILSEDGFYKVAVNDTTLWFQLCDGMIFNHDPPIC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG  RCGM C+AL ++ +GGY VC  +GR     + +ID  +P  G++VK  ++
Sbjct  88   ADCWDCGGPKRCGMECNALVANNVGGYHVCTAIGRGQKIDVDIIDKKNPHTGVIVKMSNS  147

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSLAVSV+C+ +   GP
Sbjct  148  GPKYNCSLAVSVLCNLNGVQGP  169



>ref|XP_006294775.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
 gb|EOA27673.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
Length=276

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NK++N+NL S I NFPHGVLSEDGFY+V AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFSFTGRNKVFNFNLASSIRNFPHGVLSEDGFYKVEANSTVLWFQLCDVLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C +CGG S CG  CSAL S  + GY VC++LG  S+T + +ID   P KG++VK  + 
Sbjct  86   VGCENCGGPSHCGTSCSALVSENLRGYDVCSSLGNSSSTKVDIIDKEDPGKGVIVKMSNG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              N NCSL+VSV+C  +   GP
Sbjct  146  NRNQNCSLSVSVICQKNKVDGP  167



>gb|ACU20834.1| unknown [Glycine max]
Length=243

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF   N LYNY L+SPI NFPHG+LSEDGFY+VA N T +WFQLC+ M+FNHDPP+C
Sbjct  32   CQFSFLDGNTLYNYTLSSPIRNFPHGILSEDGFYKVAVNDTTLWFQLCDGMIFNHDPPIC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG   CGM C+AL ++ +GGY VC  +GR     + +ID  +P  G++VK  ++
Sbjct  92   ADCWDCGGPKHCGMKCNALVANNVGGYHVCTAIGRGPKIDVDIIDKKNPHTGVIVKMSNS  151

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSLAVSV+C+ +   GP
Sbjct  152  GPKYNCSLAVSVLCNLNGVQGP  173



>ref|XP_007008865.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 1 [Theobroma cacao]
 gb|EOY17675.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 1 [Theobroma cacao]
Length=282

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF + NKLYN++L SP+  FP+GVLSEDGFY+V  N +V+WFQLC+ MLFNHDPP C
Sbjct  32   CELSFVERNKLYNFSLASPLPRFPYGVLSEDGFYKVVMNESVLWFQLCDGMLFNHDPPRC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            ++C+DCGG SRCGM CSAL +    GY VC T+G  S+T++S+ID  +P KG++V+   +
Sbjct  92   VECLDCGGPSRCGMECSALVAKNALGYQVCTTIGHVSSTNVSVIDEQNPYKGVIVRMSSS  151

Query  597  ALNTNCSLAVSVVCDDAAT-GP  659
                NCSL+VS++CD     GP
Sbjct  152  GKGRNCSLSVSIICDSTGVQGP  173



>ref|XP_007008868.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 4 [Theobroma cacao]
 gb|EOY17678.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 4 [Theobroma cacao]
Length=274

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF + NKLYN++L SP+  FP+GVLSEDGFY+V  N +V+WFQLC+ MLFNHDPP C
Sbjct  32   CELSFVERNKLYNFSLASPLPRFPYGVLSEDGFYKVVMNESVLWFQLCDGMLFNHDPPRC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            ++C+DCGG SRCGM CSAL +    GY VC T+G  S+T++S+ID  +P KG++V+   +
Sbjct  92   VECLDCGGPSRCGMECSALVAKNALGYQVCTTIGHVSSTNVSVIDEQNPYKGVIVRMSSS  151

Query  597  ALNTNCSLAVSVVCDDAAT-GP  659
                NCSL+VS++CD     GP
Sbjct  152  GKGRNCSLSVSIICDSTGVQGP  173



>ref|XP_007163579.1| hypothetical protein PHAVU_001G246100g [Phaseolus vulgaris]
 gb|ESW35573.1| hypothetical protein PHAVU_001G246100g [Phaseolus vulgaris]
Length=290

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 102/142 (72%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF   + LYNY L+SPI NFPHG+LSEDGFY+VA N T +WFQLC+ M+FNHDPP+C
Sbjct  40   CRFSFLDGDHLYNYTLSSPIRNFPHGILSEDGFYKVAVNETTLWFQLCDGMVFNHDPPVC  99

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG +RCG  C+AL ++ +GGY VC TLGR     + +ID  +P  G++VK  ++
Sbjct  100  ADCWDCGGPNRCGTQCNALVANKVGGYHVCTTLGRGPKIDVDIIDKKNPHTGVIVKMSNS  159

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSLAVSV+C+ +   GP
Sbjct  160  GPKFNCSLAVSVLCNLNGVQGP  181



>ref|XP_007008869.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 ref|XP_007008870.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 gb|EOY17679.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
 gb|EOY17680.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 5 [Theobroma cacao]
Length=284

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF + NKLYN++L SP+  FP+GVLSEDGFY+V  N +V+WFQLC+ MLFNHDPP C
Sbjct  32   CELSFVERNKLYNFSLASPLPRFPYGVLSEDGFYKVVMNESVLWFQLCDGMLFNHDPPRC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            ++C+DCGG SRCGM CSAL +    GY VC T+G  S+T++S+ID  +P KG++V+   +
Sbjct  92   VECLDCGGPSRCGMECSALVAKNALGYQVCTTIGHVSSTNVSVIDEQNPYKGVIVRMSSS  151

Query  597  ALNTNCSLAVSVVCDDAAT-GP  659
                NCSL+VS++CD     GP
Sbjct  152  GKGRNCSLSVSIICDSTGVQGP  173



>ref|XP_006411289.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
 gb|ESQ52742.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
Length=276

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 97/136 (71%), Gaps = 0/136 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NK++ +NL S I NFPHG LSEDGFYRV AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFSFTGRNKVFAFNLASSIRNFPHGALSEDGFYRVEANSTVLWFQLCDVLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC++LG  S++ + +ID   P KGI+VK    
Sbjct  86   VGCKDCGGPSHCGTSCSALLSENVRGYDVCSSLGHASSSKVDIIDKEDPGKGIIVKMSGG  145

Query  597  ALNTNCSLAVSVVCDD  644
            + N NCSL+VSV+C  
Sbjct  146  SSNQNCSLSVSVICQK  161



>ref|XP_004307687.1| PREDICTED: uncharacterized protein LOC101315282 [Fragaria vesca 
subsp. vesca]
Length=278

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  S   ++KLY+Y+L SP+  FPHGV SEDGFY+VA N TVIWFQLC+ M+FNHDPP C
Sbjct  28   CRLSVVDDDKLYDYSLDSPMPLFPHGVRSEDGFYKVAGNKTVIWFQLCDGMIFNHDPPGC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG S CGMGCSAL +  IGGY VC T+GR ++  I++ID N+P  G++VK    
Sbjct  88   VDCLDCGGPSHCGMGCSALVAKNIGGYDVCTTVGRAASMDINIIDKNNPHIGVIVKMSSN  147

Query  597  ALNTNCSLAVSVVCD  641
             L  NCSL+VSV+CD
Sbjct  148  GLKGNCSLSVSVMCD  162



>gb|AFK44428.1| unknown [Lotus japonicus]
Length=243

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NKLY+Y L+SPI NFPHGVLSEDGFY+VA N T +WFQLC+ M+FNHDPP C
Sbjct  29   CEFSFLDGNKLYSYTLSSPIRNFPHGVLSEDGFYKVAVNQTTLWFQLCDGMVFNHDPPTC  88

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG +RCGM C+AL ++ IGGY VC  +G  S   + +ID  +P  G++VK   +
Sbjct  89   ADCWDCGGPTRCGMECNALLANNIGGYHVCTAIGLGSKIDVEVIDKKNPHIGVIVKMSSS  148

Query  597  ALNTNCSLAVSVVCD  641
            +   NCSLAVSV+C+
Sbjct  149  SPKYNCSLAVSVLCN  163



>ref|XP_010534619.1| PREDICTED: uncharacterized protein LOC104810122 [Tarenaya hassleriana]
Length=276

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ SF + NK++++NL SP+ N+PHG LSEDGFYRV ANGTV+WFQLC+ ++FNHDPP C
Sbjct  26   CELSFTRRNKVFDFNLVSPLPNYPHGALSEDGFYRVEANGTVLWFQLCDALIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC  +G  S T + +ID  +P KGI+VK    
Sbjct  86   VGCADCGGPSHCGTACSALVSEHVRGYDVCNAIGHVSKTRVDVIDKENPGKGIIVKMSSG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
            +   NCS++VSV+C  +   GP
Sbjct  146  SGEKNCSVSVSVICQTNKVDGP  167



>ref|XP_010505757.1| PREDICTED: uncharacterized protein LOC104782507 isoform X1 [Camelina 
sativa]
Length=276

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++ F   NK++N+NL S I NFPHGVLSEDGFY+V AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFKFTGRNKIFNFNLASSIRNFPHGVLSEDGFYKVEANSTVLWFQLCDVLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C +CGG + CG  CSAL S  + GY VC +LG  S+T   +ID   P KG++VK    
Sbjct  86   VGCENCGGPTHCGTSCSALVSENLRGYDVCTSLGHGSSTKFDIIDKEDPGKGVIVKMSSG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              N NCSL+VSV+C  +   GP
Sbjct  146  NRNENCSLSVSVICQKNKVDGP  167



>ref|XP_002520790.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41499.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 6/147 (4%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  SF   + LYN++L SP+  FPHGVLSEDGFY+VAAN +V+WFQLC+ M+FNHDPP C
Sbjct  33   CQLSFVDGHSLYNFSLVSPLPKFPHGVLSEDGFYKVAANESVLWFQLCDGMIFNHDPPRC  92

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC+DCGG SRCGM CSAL ++   GY +C T+GR S    S++D  +PLKG++VK   T
Sbjct  93   VDCLDCGGPSRCGMECSALVANNREGYDICTTVGRVSNIVTSIMDEQNPLKGVIVKMSST  152

Query  597  ALNT-----NCSLAVSVVCD-DAATGP  659
               +     NCSL+VSV+C+ + A GP
Sbjct  153  VKTSSGSEHNCSLSVSVICNSNGAQGP  179



>ref|XP_010692932.1| PREDICTED: uncharacterized protein LOC104905961 [Beta vulgaris 
subsp. vulgaris]
Length=297

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+Y   + NKLY+Y+L+SPI+NFPHGVLSEDGFY+VAAN T+IWFQLC+ M+FNHDPP C
Sbjct  48   CEYDTLERNKLYSYSLSSPINNFPHGVLSEDGFYKVAANDTIIWFQLCDGMIFNHDPPRC  107

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC  CGG  RCGMGCSAL +   GGY  C T+G  +   I+L D N+P KG+ V     
Sbjct  108  VDCWGCGGPLRCGMGCSALVAKYSGGYYACTTIGHKTNFDINLTDKNTPDKGVTVTMSSN  167

Query  597  ALNTNCSLAVSVVCDD  644
                NCSL+VS+VCD 
Sbjct  168  IDGVNCSLSVSIVCDK  183



>ref|XP_008454838.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
 ref|XP_008454839.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
 ref|XP_008454840.1| PREDICTED: uncharacterized protein LOC103495149 [Cucumis melo]
Length=281

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+YS   N K+YN+NL SP S  PHGVLSEDGFYRVA N TV+WFQLC+ M+FNHDPPMC
Sbjct  31   CEYSLVNNGKMYNFNLASPTSKSPHGVLSEDGFYRVAVNNTVVWFQLCDGMIFNHDPPMC  90

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            +DC  CGG S CGMGC AL ++ I GY VC T+G   +T+IS+ID  +P +G+ VK  + 
Sbjct  91   IDCSGCGGPSHCGMGCGALVANKIEGYDVCTTIGLVPSTNISIIDIKNPDRGVAVKMSNI  150

Query  597  ALNTNCSLAVSVVC  638
                 CSL+VSV+C
Sbjct  151  GTKVKCSLSVSVIC  164



>ref|XP_010517449.1| PREDICTED: uncharacterized protein LOC104792889 isoform X1 [Camelina 
sativa]
Length=271

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++ F    K++N+NL S I NFPHGVLSEDGFY+V AN TV+WFQLC+ ++FNHDPP C
Sbjct  21   CEFKFTGRKKVFNFNLASSIRNFPHGVLSEDGFYKVEANSTVLWFQLCDVLIFNHDPPRC  80

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C +CGG + CG  CSAL S  + GY VC++LG  S+T   +ID   P KG++VK    
Sbjct  81   VGCENCGGPTHCGTSCSALVSENLRGYDVCSSLGHGSSTKFDIIDKEDPGKGVIVKMSSG  140

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              N NCSL+VSV+C  +   GP
Sbjct  141  NRNENCSLSVSVICQKNKVDGP  162



>ref|XP_010921016.1| PREDICTED: uncharacterized protein LOC105044726 [Elaeis guineensis]
Length=280

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S +  + +YNY+L SP SN PHGVLSEDGFY+VA N T++WFQLC+ M+FNHDPP C
Sbjct  30   CELSVRWRDAIYNYSLASPTSNHPHGVLSEDGFYKVAVNETLLWFQLCDQMIFNHDPPRC  89

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C DCGG S CGM CSAL ++ IGGYPVC T+G      I+LID N P +G++++   +
Sbjct  90   FSCQDCGGPSHCGMKCSALVANNIGGYPVCTTIGGLPNQHIALIDENDPERGVIIRMSAS  149

Query  597  ALNTNCSLAVSVVCDDAAT  653
                 CSL+VSV CD   T
Sbjct  150  GQEKFCSLSVSVFCDSVKT  168



>ref|NP_181562.4| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY82252.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
 dbj|BAE99557.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09812.1| uncharacterized protein AT2G40316 [Arabidopsis thaliana]
Length=276

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++SF   NK++++NL S I N+PHGVLSEDGFY+V AN +V+WFQLC+ ++FNHDPP C
Sbjct  26   CEFSFTGRNKVFHFNLASSIRNYPHGVLSEDGFYKVEANSSVLWFQLCDVLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC +LG  S+T + +ID   P KG++V+    
Sbjct  86   VGCEDCGGPSHCGTSCSALVSENVRGYDVCTSLGHASSTKVDIIDKEDPGKGVIVQMSTG  145

Query  597  ALNTNCSLAVSVVCDDAAT-GP  659
              N NCSL+VSV+C      GP
Sbjct  146  NRNQNCSLSVSVICQKTKVDGP  167



>ref|XP_010508881.1| PREDICTED: uncharacterized protein LOC104785377 isoform X1 [Camelina 
sativa]
Length=276

 Score =   146 bits (368),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++ F    K++N+NL S I NFPHGVLSEDGFY+V AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFKFTGRKKVFNFNLASSIRNFPHGVLSEDGFYKVEANSTVLWFQLCDVLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C +CGG + CG  CSAL S  + GY VC++LG  S+T   +ID   P KG++VK    
Sbjct  86   VGCENCGGPTHCGTSCSALVSENLRGYDVCSSLGHGSSTKFDIIDKEDPGKGVIVKMSSG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              N NCSL+VSV+C  +   GP
Sbjct  146  NRNENCSLSVSVICQKNKVDGP  167



>emb|CDY18864.1| BnaC04g04860D [Brassica napus]
Length=275

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++ F + NK++ +NL S + N PHG LSEDGFYRV AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFRFNRRNKVFEFNLASSVKNHPHGALSEDGFYRVEANSTVLWFQLCDMLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC +LG  S++ + +ID   P KGI+VK    
Sbjct  86   VGCQDCGGPSHCGTSCSALLSENVRGYDVCTSLGHASSSKVDVIDKEDPGKGIIVKMLAG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
            + N NCSL+VSV+C  +   GP
Sbjct  146  SSNPNCSLSVSVICQKNKVDGP  167



>ref|XP_009143225.1| PREDICTED: uncharacterized protein LOC103866960 isoform X1 [Brassica 
rapa]
Length=275

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++ F + NK++++NL S + N PHG LSEDGFYRV AN TV+WFQLC+ ++FNHDPP C
Sbjct  26   CEFRFSRRNKVFDFNLASSVKNHPHGALSEDGFYRVEANSTVLWFQLCDLLIFNHDPPRC  85

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            + C DCGG S CG  CSAL S  + GY VC +LG  S++ + +ID   P KGI VK    
Sbjct  86   VGCQDCGGPSHCGTSCSALLSENVRGYDVCTSLGHASSSKVDVIDKEDPGKGITVKMLAG  145

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
            + N NCSL+VSV+C  +   GP
Sbjct  146  SSNPNCSLSVSVICQKNKVDGP  167



>ref|XP_002273745.2| PREDICTED: uncharacterized protein LOC100255420 [Vitis vinifera]
 emb|CBI25422.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  S      LY ++L SP S FPHGVLSEDGFY+VA N TV+WFQLC+ M+FNHDPP C
Sbjct  29   CRLSVLDRYNLYTFSLASPTSKFPHGVLSEDGFYKVAVNETVLWFQLCDGMIFNHDPPTC  88

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG SRCGM CSAL ++ + GY VC T+GR S+  I+LID N P KG+ VK    
Sbjct  89   ADCWDCGGPSRCGMDCSALVANNVKGYHVCTTIGRASSVDINLIDKNIPKKGVTVKMSSN  148

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
              + NCSL+VSV+C+ +   GP
Sbjct  149  GPDVNCSLSVSVICESNGVQGP  170



>emb|CAN76264.1| hypothetical protein VITISV_001854 [Vitis vinifera]
Length=297

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C  S      LY ++L SP S FPHGVLSEDGFY+VA N TV+WFQLC+ M+FNHDPP C
Sbjct  29   CRLSVLDRYNLYTFSLASPTSKFPHGVLSEDGFYKVAVNETVLWFQLCDGMIFNHDPPTC  88

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG SRCGM CSAL ++ + GY VC T+GR S+  I+LID N P KG+ VK    
Sbjct  89   ADCWDCGGPSRCGMDCSALVANNVKGYHVCTTIGRASSVDINLIDKNIPKKGVTVKMSSN  148

Query  597  ALNTNCSLAVSVVCD  641
              + NCSL+VSV+C+
Sbjct  149  GPDVNCSLSVSVICE  163



>ref|XP_010264546.1| PREDICTED: uncharacterized protein LOC104602522 isoform X1 [Nelumbo 
nucifera]
Length=280

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S    + LYN++L SP   +PHGVLSEDGFY+VA N TV+WFQLC  M+FNH PP C
Sbjct  30   CELSVVHRDGLYNFSLASPTQEYPHGVLSEDGFYKVAVNETVLWFQLCNRMIFNHHPPRC  89

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG SRCGM CSAL ++ IGGY VC T+G+ S+ +++LID   P KG+ V+   +
Sbjct  90   FDCQDCGGPSRCGMKCSALVANNIGGYHVCTTIGKASSVNVNLIDREDPQKGVNVRMSSS  149

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSL VSV CD +   GP
Sbjct  150  GSKGNCSLTVSVFCDSNGVEGP  171



>ref|XP_008804111.1| PREDICTED: uncharacterized protein LOC103717482 isoform X1 [Phoenix 
dactylifera]
Length=280

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S ++ N +YNY+L S  S  PHGVLSEDGFY+VA N T++WFQLC+ M+FNH+PP C
Sbjct  30   CELSVRRRNLVYNYSLASSTSKHPHGVLSEDGFYKVAVNETLLWFQLCDQMIFNHNPPRC  89

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C DCGG S CGM CSAL ++ IGGY VC T+G     +I+LID N P +G++++    
Sbjct  90   FGCQDCGGPSHCGMKCSALVANNIGGYHVCTTIGGLPNQNIALIDENDPERGVIIRMSAN  149

Query  597  ALNTNCSLAVSVVCDDAAT  653
            +L  NCSL+VSV CD   T
Sbjct  150  SLEKNCSLSVSVFCDSVKT  168



>ref|XP_002468020.1| hypothetical protein SORBIDRAFT_01g038200 [Sorghum bicolor]
 gb|EER95018.1| hypothetical protein SORBIDRAFT_01g038200 [Sorghum bicolor]
Length=201

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 101/139 (73%), Gaps = 4/139 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S ++  +LY+++L +P     HGVLSEDGFY+VA N +V+WFQLC+ MLFN DPPMC
Sbjct  35   CEFSVERGGELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSVLWFQLCDEMLFNFDPPMC  94

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ I GY VC T+G  S + ISL+D ++P KGI+VK +  
Sbjct  95   LNCEDCGGPLRCGTQCSALVSNYIRGYDVCTTIGSLSKSHISLVDESNPQKGIIVKMF--  152

Query  597  ALNTNCSLAVSVVCDDAAT  653
              ++ CS++VSV+CD  A 
Sbjct  153  --SSKCSISVSVICDSTAA  169



>tpg|DAA44899.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=203

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  + ++LY+++L +P     HGVLSEDGFY+VA N +++WFQLC+ MLFN DPPMC
Sbjct  37   CEFSVARGSELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSILWFQLCDEMLFNFDPPMC  96

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL+D  +P KGI+VK +  
Sbjct  97   LNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVDEGNPRKGIIVKMF--  154

Query  597  ALNTNCSLAVSVVCDDAA  650
              ++ CS++VSV+CD  A
Sbjct  155  --SSKCSISVSVICDSNA  170



>tpg|DAA44898.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=241

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  + ++LY+++L +P     HGVLSEDGFY+VA N +++WFQLC+ MLFN DPPMC
Sbjct  37   CEFSVARGSELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSILWFQLCDEMLFNFDPPMC  96

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL+D  +P KGI+VK +  
Sbjct  97   LNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVDEGNPRKGIIVKMF--  154

Query  597  ALNTNCSLAVSVVCDDAA  650
              ++ CS++VSV+CD  A
Sbjct  155  --SSKCSISVSVICDSNA  170



>emb|CDX74798.1| BnaA05g05440D [Brassica napus]
Length=288

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 2/143 (1%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQ-LCETMLFNHDPPM  413
            C++ F + NK++++NL S + N PHG LSEDGFYRV AN TV+WFQ LC+ ++FNHDPP 
Sbjct  26   CEFRFNRRNKVFDFNLASSVKNHPHGALSEDGFYRVEANSTVLWFQQLCDLLIFNHDPPR  85

Query  414  CLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYH  593
            C+ C DCGG S CG  CSAL S  + GY VC +LG  S++ + +ID   P KGI+VK   
Sbjct  86   CVGCQDCGGPSHCGTSCSALLSENVRGYDVCTSLGHDSSSKVDVIDKEDPGKGIIVKMLA  145

Query  594  TALNTNCSLAVSVVCD-DAATGP  659
             + N NCSL+VSV+C  +   GP
Sbjct  146  GSSNPNCSLSVSVICQKNKVDGP  168



>ref|XP_008647632.1| PREDICTED: uncharacterized protein LOC100502280 isoform X2 [Zea 
mays]
Length=311

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  + ++LY+++L +P     HGVLSEDGFY+VA N +++WFQLC+ MLFN DPPMC
Sbjct  107  CEFSVARGSELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSILWFQLCDEMLFNFDPPMC  166

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL+D  +P KGI+VK +  
Sbjct  167  LNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVDEGNPRKGIIVKMF--  224

Query  597  ALNTNCSLAVSVVCDDAA  650
              ++ CS++VSV+CD  A
Sbjct  225  --SSKCSISVSVICDSNA  240



>ref|NP_001183686.1| uncharacterized protein LOC100502280 precursor [Zea mays]
 gb|ACR37963.1| unknown [Zea mays]
 tpg|DAA44896.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
 tpg|DAA44897.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=283

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  + ++LY+++L +P     HGVLSEDGFY+VA N +++WFQLC+ MLFN DPPMC
Sbjct  37   CEFSVARGSELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSILWFQLCDEMLFNFDPPMC  96

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL+D  +P KGI+VK +  
Sbjct  97   LNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVDEGNPRKGIIVKMF--  154

Query  597  ALNTNCSLAVSVVCDDAA  650
              ++ CS++VSV+CD  A
Sbjct  155  --SSKCSISVSVICDSNA  170



>ref|XP_008647628.1| PREDICTED: uncharacterized protein LOC100502280 isoform X1 [Zea 
mays]
Length=335

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 101/138 (73%), Gaps = 4/138 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  + ++LY+++L +P     HGVLSEDGFY+VA N +++WFQLC+ MLFN DPPMC
Sbjct  107  CEFSVARGSELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSILWFQLCDEMLFNFDPPMC  166

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL+D  +P KGI+VK +  
Sbjct  167  LNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVDEGNPRKGIIVKMF--  224

Query  597  ALNTNCSLAVSVVCDDAA  650
              ++ CS++VSV+CD  A
Sbjct  225  --SSKCSISVSVICDSNA  240



>gb|EEE58880.1| hypothetical protein OsJ_10490 [Oryza sativa Japonica Group]
Length=239

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  +  KLY+++L SP +   HGVLSEDGFY+VA N +V+WFQLC+ M+FN DPP+C
Sbjct  36   CEFSVARGGKLYSFSLASPTTAHRHGVLSEDGFYKVAVNNSVLWFQLCDQMIFNFDPPVC  95

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+  GGY VC T+GR S + ISLID+ +P KG+VVK +  
Sbjct  96   LNCEDCGGPQRCGTQCSALVSNNRGGYDVCTTIGRASKSHISLIDDINPQKGVVVKMF--  153

Query  597  ALNTNCSLAVSVVCDD  644
              ++ CS++V + CD 
Sbjct  154  --SSKCSISVYIYCDS  167



>ref|XP_002311247.2| hypothetical protein POPTR_0008s07320g [Populus trichocarpa]
 gb|EEE88614.2| hypothetical protein POPTR_0008s07320g [Populus trichocarpa]
Length=354

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 108/169 (64%), Gaps = 28/169 (17%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQ--------------  374
            C+ SF   +K+Y++NL SP+ NFPHGVLSEDGFY+ A N TV+WFQ              
Sbjct  34   CELSFVVRDKVYSFNLVSPLPNFPHGVLSEDGFYKAAVNETVLWFQVGSIRCGATSKTNT  93

Query  375  -------------LCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATL  515
                         LC+ M+FNHDPP C++C+DCGG SRCGM CSAL +  I GY VC T+
Sbjct  94   HLANSTLELPQYHLCDGMIFNHDPPRCVECLDCGGASRCGMECSALMARNIEGYDVCTTI  153

Query  516  GRPSTTSISLIDNNSPLKGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
            G+ ++TS ++IDN +P KG++VK   +    NCSL+VSV+CD +   GP
Sbjct  154  GKVTSTSTNIIDNQNPHKGVIVKMTSSGSKHNCSLSVSVICDSNRVHGP  202



>gb|EEC75047.1| hypothetical protein OsI_11153 [Oryza sativa Indica Group]
Length=239

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  +  KLY+++L SP +   HGVLSEDGFY+VA N +V+WFQLC+ M+FN DPP+C
Sbjct  36   CEFSVARGGKLYSFSLASPTTAHRHGVLSEDGFYKVAVNNSVLWFQLCDQMIFNFDPPVC  95

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+  GGY VC T+GR S + ISLID+ +P KG+VVK +  
Sbjct  96   LNCEDCGGPQRCGTQCSALVSNNRGGYDVCTTIGRVSKSHISLIDDINPQKGVVVKMF--  153

Query  597  ALNTNCSLAVSVVCDD  644
              ++ CS++V + CD 
Sbjct  154  --SSKCSISVYIYCDS  167



>ref|NP_001049832.1| Os03g0296700 [Oryza sativa Japonica Group]
 gb|ABF95446.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11746.1| Os03g0296700 [Oryza sativa Japonica Group]
Length=264

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  +  KLY+++L SP +   HGVLSEDGFY+VA N +V+WFQLC+ M+FN DPP+C
Sbjct  36   CEFSVARGGKLYSFSLASPTTAHRHGVLSEDGFYKVAVNNSVLWFQLCDQMIFNFDPPVC  95

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+  GGY VC T+GR S + ISLID+ +P KG+VVK +  
Sbjct  96   LNCEDCGGPQRCGTQCSALVSNNRGGYDVCTTIGRASKSHISLIDDINPQKGVVVKMF--  153

Query  597  ALNTNCSLAVSVVCDD  644
              ++ CS++V + CD 
Sbjct  154  --SSKCSISVYIYCDS  167



>ref|XP_004984880.1| PREDICTED: uncharacterized protein LOC101783634 isoform X1 [Setaria 
italica]
Length=289

 Score =   136 bits (342),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 98/137 (72%), Gaps = 4/137 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            CD S ++   LY++ L +P+    HGVLSEDGFY+VA N + +WFQLC+ MLFN DPPMC
Sbjct  43   CDLSVERGGALYSFALAAPMPAHRHGVLSEDGFYKVAVNDSTLWFQLCDEMLFNFDPPMC  102

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+ +GGY VC T+G  S + ISLID ++P KGIVVK +  
Sbjct  103  LNCEDCGGPLRCGTQCSALVSNNMGGYDVCTTIGSLSKSHISLIDESNPRKGIVVKMF--  160

Query  597  ALNTNCSLAVSVVCDDA  647
              +  CS++VSV+CD +
Sbjct  161  --SPKCSISVSVLCDSS  175



>dbj|BAJ90180.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=280

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 97/137 (71%), Gaps = 4/137 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S ++   LYN++L +P     HGVLSEDGFY+VA N +VIWFQLC+ M+FN DPP+C
Sbjct  34   CELSVERGGTLYNFSLAAPTPAHRHGVLSEDGFYKVAMNDSVIWFQLCDQMIFNFDPPVC  93

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L C DCGG  RCG  CSALAS+ +GGY VC T+G    + ISLID+ +P KG++VK +  
Sbjct  94   LHCEDCGGPLRCGTQCSALASNNVGGYDVCTTIGSAFGSHISLIDDGNPQKGVIVKMF--  151

Query  597  ALNTNCSLAVSVVCDDA  647
              ++ CS++V + CD A
Sbjct  152  --SSKCSISVFIFCDSA  166



>ref|XP_003558130.1| PREDICTED: uncharacterized protein LOC100823098 [Brachypodium 
distachyon]
Length=282

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 94/137 (69%), Gaps = 4/137 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S  +   LYN++L +P     HGVLSEDGFYRVA N ++IWFQLC+ M+FN DPP+C
Sbjct  35   CELSVARGGALYNFSLAAPTPAHRHGVLSEDGFYRVAMNDSIIWFQLCDQMIFNFDPPVC  94

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C DCGG  RCG  CSAL S+ +GGY VC T+GR   + ISLID  +P KG+VVK +  
Sbjct  95   HLCEDCGGPLRCGTQCSALVSNNVGGYDVCTTIGRAFGSHISLIDQGNPQKGVVVKMF--  152

Query  597  ALNTNCSLAVSVVCDDA  647
              ++ CS++V V CD A
Sbjct  153  --SSKCSISVLVFCDSA  167



>gb|EMT00564.1| hypothetical protein F775_08095 [Aegilops tauschii]
Length=276

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 98/144 (68%), Gaps = 11/144 (8%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S ++   LYN++L +P     HGVLSEDGFY+VA N +VIWFQLC+ M+FN DPP+C
Sbjct  32   CELSVERGGALYNFSLAAPTPAHRHGVLSEDGFYKVAMNDSVIWFQLCDQMIFNFDPPVC  91

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLI-------DNNSPLKGI  575
            L C DCGG  RCG  CSALAS+ IGGY VC T+GR S + ISLI       D+ +P KG+
Sbjct  92   LHCEDCGGPLRCGTQCSALASNNIGGYDVCTTIGRASGSHISLIGKNHGKADDGNPQKGV  151

Query  576  VVKTYHTALNTNCSLAVSVVCDDA  647
            + K +    ++ CS++V + CD A
Sbjct  152  IFKMF----SSKCSISVFIFCDSA  171



>ref|XP_006651281.1| PREDICTED: uncharacterized protein LOC102717143 [Oryza brachyantha]
Length=440

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 4/135 (3%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S     +LY+++L SP     HG+LSEDGFY+VA N +V+WFQLC+ M+FN DPP+C
Sbjct  194  CELSVAHGGRLYSFSLASPTPAHRHGILSEDGFYKVAVNDSVLWFQLCDQMIFNFDPPVC  253

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
            L+C DCGG  RCG  CSAL S+   GY VC T+GR S + ISLID  +P KG+VVK +  
Sbjct  254  LNCEDCGGPLRCGTQCSALVSNNRRGYDVCTTIGRVSKSHISLIDELNPQKGVVVKMF--  311

Query  597  ALNTNCSLAVSVVCD  641
              ++ CS++V + CD
Sbjct  312  --SSKCSISVYIFCD  324



>gb|KHN04787.1| hypothetical protein glysoja_031887 [Glycine soja]
Length=259

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 91/142 (64%), Gaps = 20/142 (14%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +SF    KLYNY L+SPI NFPHG+LSEDGFY+VA N T +WFQLC+ M+FNHDPP+C
Sbjct  28   CQFSFLDGKKLYNYTLSSPIRNFPHGILSEDGFYKVAVNDTTLWFQLCDGMIFNHDPPIC  87

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
             DC DCGG  RCGM C+AL ++ +G                   D  +P  G++VK  ++
Sbjct  88   ADCWDCGGPKRCGMECNALVANNVG-------------------DKKNPHTGVIVKMSNS  128

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
                NCSLAVSV+C+ +   GP
Sbjct  129  GPKYNCSLAVSVLCNLNGVQGP  150



>ref|XP_008233814.1| PREDICTED: uncharacterized protein LOC103332832 isoform X2 [Prunus 
mume]
Length=261

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 89/143 (62%), Gaps = 21/143 (15%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +S   +NKLY+Y+L SPI  FPHG+ SEDGFY+VAAN TV+WFQ C        P  C
Sbjct  28   CHFSVIDDNKLYDYSLGSPIPLFPHGIQSEDGFYKVAANETVLWFQDCG------GPSRC  81

Query  417  -LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYH  593
             + C             SAL ++ IGGY VC+T+GR S+  I++ID  +P  G++VK  +
Sbjct  82   GMGC-------------SALVANNIGGYDVCSTIGRASSIDINIIDKKNPNSGVIVKMSN  128

Query  594  TALNTNCSLAVSVVCD-DAATGP  659
            + L  NCSL+VSV+CD +   GP
Sbjct  129  SGLKRNCSLSVSVICDPNRVQGP  151



>ref|XP_008363772.1| PREDICTED: uncharacterized protein LOC103427491 isoform X2 [Malus 
domestica]
Length=260

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/142 (48%), Positives = 87/142 (61%), Gaps = 19/142 (13%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +S   ++KLYNY L SPI  FPHGV SEDGFY+VAAN TV+WFQ C          + 
Sbjct  28   CHFSVVDDDKLYNYTLDSPIPFFPHGVQSEDGFYKVAANETVLWFQDC----------VG  77

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C D        MG SAL S+ IGGY VC T+GR S+  +++ID  +P  G++VK   +
Sbjct  78   ASCCD--------MGSSALVSNNIGGYDVCTTIGRASSMDMNIIDRKNPNTGVIVKMSSS  129

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  130  GLKFNCSLSVSVICDPNRVQGP  151



>tpg|DAA44895.1| TPA: hypothetical protein ZEAMMB73_360049 [Zea mays]
Length=141

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C++S  + ++LY+++L +P     HGVLSEDGFY+VA N +++WFQLC+ MLFN DPPMC
Sbjct  37   CEFSVARGSELYSFDLAAPTPAHRHGVLSEDGFYKVAVNDSILWFQLCDEMLFNFDPPMC  96

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            L+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL++
Sbjct  97   LNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVE  141



>ref|XP_009369219.1| PREDICTED: uncharacterized protein LOC103958653 isoform X2 [Pyrus 
x bretschneideri]
Length=260

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 87/142 (61%), Gaps = 19/142 (13%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C +S   ++KLYN+ L SPI  FPHGV SEDGFY+VAAN TV+WFQ C          + 
Sbjct  28   CHFSVVDDDKLYNFTLDSPIPFFPHGVQSEDGFYKVAANETVLWFQDC----------VG  77

Query  417  LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHT  596
              C D        MG SAL S+ IGGY VC T+GR S+ ++++ID  +   G++VK   +
Sbjct  78   ASCCD--------MGSSALVSNNIGGYDVCTTIGRASSMNMNIIDRKNANTGVIVKMSSS  129

Query  597  ALNTNCSLAVSVVCD-DAATGP  659
             L  NCSL+VSV+CD +   GP
Sbjct  130  GLKFNCSLSVSVICDPNRVQGP  151



>ref|XP_010264547.1| PREDICTED: uncharacterized protein LOC104602522 isoform X2 [Nelumbo 
nucifera]
Length=262

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 81/143 (57%), Gaps = 21/143 (15%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQLCETMLFNHDPPMC  416
            C+ S    + LYN++L SP   +PHGVLSEDGFY+VA N TV+WFQ C        P  C
Sbjct  30   CELSVVHRDGLYNFSLASPTQEYPHGVLSEDGFYKVAVNETVLWFQDC------GGPSRC  83

Query  417  -LDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYH  593
             + C             SAL ++ IGGY VC T+G+ S+ +++LID   P KG+ V+   
Sbjct  84   GMKC-------------SALVANNIGGYHVCTTIGKASSVNVNLIDREDPQKGVNVRMSS  130

Query  594  TALNTNCSLAVSVVCD-DAATGP  659
            +    NCSL VSV CD +   GP
Sbjct  131  SGSKGNCSLTVSVFCDSNGVEGP  153



>ref|XP_006355642.1| PREDICTED: uncharacterized protein LOC102579236 isoform X2 [Solanum 
tuberosum]
Length=213

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 72/97 (74%), Gaps = 1/97 (1%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ M+FNHDPP C++C DCGG SRCGMGCSAL ++IIGGYPVC TLG  S+TS  LID
Sbjct  8    QLCDAMIFNHDPPTCVECGDCGGISRCGMGCSALVANIIGGYPVCTTLGYSSSTSFELID  67

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
               PLKGI  K  +    +NCSLAVSVVCD +   GP
Sbjct  68   KTDPLKGITAKLSNRGSKSNCSLAVSVVCDTNGVQGP  104



>ref|XP_009591922.1| PREDICTED: uncharacterized protein LOC104088879 isoform X2 [Nicotiana 
tomentosiformis]
Length=213

 Score = 99.8 bits (247),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ M+FNHDPP C+DC DCGG SRCGMGCSAL ++IIGGYPVC TLG  S+T   LID
Sbjct  8    QLCDAMIFNHDPPTCIDCRDCGGNSRCGMGCSALVANIIGGYPVCTTLGYSSSTFFELID  67

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
               PLKGI  K  +     NCSLAVS+VCD +   GP
Sbjct  68   KKDPLKGITAKMSYRGPKLNCSLAVSIVCDTNGVQGP  104



>ref|XP_009776957.1| PREDICTED: uncharacterized protein LOC104226625 isoform X2 [Nicotiana 
sylvestris]
Length=213

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ M+FNHDPP C+DC DCGG SRCGMGCSAL ++ +GGYPVC TLG  S+T   LID
Sbjct  8    QLCDAMIFNHDPPTCIDCKDCGGNSRCGMGCSALVANTVGGYPVCTTLGYSSSTIFELID  67

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCD  641
               PLKGI  K  +     NCSLAVS+VCD
Sbjct  68   KKDPLKGITAKMSYRGPKLNCSLAVSIVCD  97



>gb|EPS65241.1| hypothetical protein M569_09538, partial [Genlisea aurea]
Length=87

 Score = 88.6 bits (218),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWF-QLCETMLFNHDPPM  413
            C+++ +    +Y Y L +   NFPHG+LSEDGFYRV  NGT +WF QLC +M+FNHDPP+
Sbjct  23   CEFTAKDKKSVYQYALATSRPNFPHGILSEDGFYRVTTNGTTLWFQQLCGSMIFNHDPPL  82

Query  414  CLDC  425
            C++C
Sbjct  83   CVNC  86



>ref|XP_007219770.1| hypothetical protein PRUPE_ppa025595mg, partial [Prunus persica]
 gb|EMJ20969.1| hypothetical protein PRUPE_ppa025595mg, partial [Prunus persica]
Length=175

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +3

Query  387  MLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPL  566
            M+FNHDPP C+DC DCGG SRCGMGCSAL ++ IGGY VC T+GR S+  I++ID  +P 
Sbjct  1    MIFNHDPPRCVDCWDCGGPSRCGMGCSALVANNIGGYDVCTTIGRASSIDINIIDKKNPN  60

Query  567  KGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
             G++VK  ++ L  NCSL+VSV+CD +   GP
Sbjct  61   SGVIVKMSNSGLKLNCSLSVSVICDPNRVQGP  92



>gb|KJB74365.1| hypothetical protein B456_011G290500 [Gossypium raimondii]
Length=201

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 68/92 (74%), Gaps = 1/92 (1%)
 Frame = +3

Query  387  MLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPL  566
            MLFNHDPP C +C +CGG SRCG  CSALA+   GGY VC+TLG  S+T++S++D  +P 
Sbjct  1    MLFNHDPPRCAECSECGGPSRCGTECSALAARNAGGYHVCSTLGHASSTNVSILDKQNPF  60

Query  567  KGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
            KG++V+   +  + +CSL+VS++CD + A GP
Sbjct  61   KGVIVRMSSSGKDPSCSLSVSILCDSNGAQGP  92



>ref|XP_006411288.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
 gb|ESQ52741.1| hypothetical protein EUTSA_v10017062mg [Eutrema salsugineum]
Length=214

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ ++FNHDPP C+ C DCGG S CG  CSAL S  + GY VC++LG  S++ + +ID
Sbjct  9    QLCDVLIFNHDPPRCVGCKDCGGPSHCGTSCSALLSENVRGYDVCSSLGHASSSKVDIID  68

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCDD  644
               P KGI+VK    + N NCSL+VSV+C  
Sbjct  69   KEDPGKGIIVKMSGGSSNQNCSLSVSVICQK  99



>ref|XP_006294774.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
 gb|EOA27672.1| hypothetical protein CARUB_v10023827mg [Capsella rubella]
Length=214

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 66/98 (67%), Gaps = 1/98 (1%)
 Frame = +3

Query  369  FQLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLI  548
            +QLC+ ++FNHDPP C+ C +CGG S CG  CSAL S  + GY VC++LG  S+T + +I
Sbjct  8    YQLCDVLIFNHDPPRCVGCENCGGPSHCGTSCSALVSENLRGYDVCSSLGNSSSTKVDII  67

Query  549  DNNSPLKGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
            D   P KG++VK  +   N NCSL+VSV+C  +   GP
Sbjct  68   DKEDPGKGVIVKMSNGNRNQNCSLSVSVICQKNKVDGP  105



>ref|XP_001756445.1| predicted protein [Physcomitrella patens]
 gb|EDQ78841.1| predicted protein [Physcomitrella patens]
Length=434

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 76/146 (52%), Gaps = 24/146 (16%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANG----TVIWFQLCETMLFNHD  404
            C ++   N K+Y++NL SP   +PHG+LSEDGFY+++A      T  WFQLCE M FN +
Sbjct  195  CAWATTTNGKMYSFNLVSPTKGYPHGILSEDGFYKISAKSKDGETNYWFQLCEHMKFNFN  254

Query  405  PPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVK  584
            PP+C +C  CGG   CG  CSAL SS    YP                D + P +G+ V 
Sbjct  255  PPLCENCEGCGGLGHCGETCSALVSS---SYP----------------DQDKPEQGVRVN  295

Query  585  -TYHTALNTNCSLAVSVVCDDAATGP  659
             T       NCS +V V C  +   P
Sbjct  296  MTTCNKSKPNCSFSVLVYCSHSGFEP  321



>ref|XP_010517450.1| PREDICTED: uncharacterized protein LOC104792889 isoform X2 [Camelina 
sativa]
Length=214

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  369  FQLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLI  548
            +QLC+ ++FNHDPP C+ C +CGG + CG  CSAL S  + GY VC++LG  S+T   +I
Sbjct  8    YQLCDVLIFNHDPPRCVGCENCGGPTHCGTSCSALVSENLRGYDVCSSLGHGSSTKFDII  67

Query  549  DNNSPLKGIVVKTYHTALNTNCSLAVSVVCDD  644
            D   P KG++VK      N NCSL+VSV+C  
Sbjct  68   DKEDPGKGVIVKMSSGNRNENCSLSVSVICQK  99



>gb|AAX55150.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
Length=214

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ ++FNHDPP C+ C DCGG S CG  CSAL S  + GY VC +LG  S+T + +ID
Sbjct  9    QLCDVLIFNHDPPRCVGCEDCGGPSHCGTSCSALVSENVRGYDVCTSLGHASSTKVDIID  68

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCDDAAT-GP  659
               P KG++V+      N NCSL+VSV+C      GP
Sbjct  69   KEDPGKGVIVQMSTGNRNQNCSLSVSVICQKTKVDGP  105



>ref|XP_010508882.1| PREDICTED: uncharacterized protein LOC104785377 isoform X2 [Camelina 
sativa]
Length=214

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  369  FQLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLI  548
            +QLC+ ++FNHDPP C+ C +CGG + CG  CSAL S  + GY VC++LG  S+T   +I
Sbjct  8    YQLCDVLIFNHDPPRCVGCENCGGPTHCGTSCSALVSENLRGYDVCSSLGHGSSTKFDII  67

Query  549  DNNSPLKGIVVKTYHTALNTNCSLAVSVVCDD  644
            D   P KG++VK      N NCSL+VSV+C  
Sbjct  68   DKEDPGKGVIVKMSSGNRNENCSLSVSVICQK  99



>gb|AAO86846.1| hypothetical protein [Arabidopsis thaliana]
Length=214

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ ++FNHDPP C+ C DCGG S CG  CSAL S  + GY VC +LG  S+T + +ID
Sbjct  9    QLCDVLIFNHDPPRCVGCEDCGGPSHCGTSCSALVSENVRGYDVCTSLGHASSTKVDIID  68

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVC  638
               P KG++V+      N NCSL+VSV+C
Sbjct  69   KEDPGKGVIVQMSTGNRNQNCSLSVSVIC  97



>ref|XP_010505758.1| PREDICTED: uncharacterized protein LOC104782507 isoform X2 [Camelina 
sativa]
Length=214

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = +3

Query  369  FQLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLI  548
            +QLC+ ++FNHDPP C+ C +CGG + CG  CSAL S  + GY VC +LG  S+T   +I
Sbjct  8    YQLCDVLIFNHDPPRCVGCENCGGPTHCGTSCSALVSENLRGYDVCTSLGHGSSTKFDII  67

Query  549  DNNSPLKGIVVKTYHTALNTNCSLAVSVVCDD  644
            D   P KG++VK      N NCSL+VSV+C  
Sbjct  68   DKEDPGKGVIVKMSSGNRNENCSLSVSVICQK  99



>ref|XP_007008867.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 3 [Theobroma cacao]
 gb|EOY17677.1| Leucine-rich repeat and IQ domain-containing protein 3, putative 
isoform 3 [Theobroma cacao]
Length=201

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 65/92 (71%), Gaps = 1/92 (1%)
 Frame = +3

Query  387  MLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPL  566
            MLFNHDPP C++C+DCGG SRCGM CSAL +    GY VC T+G  S+T++S+ID  +P 
Sbjct  1    MLFNHDPPRCVECLDCGGPSRCGMECSALVAKNALGYQVCTTIGHVSSTNVSVIDEQNPY  60

Query  567  KGIVVKTYHTALNTNCSLAVSVVCDDAAT-GP  659
            KG++V+   +    NCSL+VS++CD     GP
Sbjct  61   KGVIVRMSSSGKGRNCSLSVSIICDSTGVQGP  92



>ref|XP_009143226.1| PREDICTED: uncharacterized protein LOC103866960 isoform X2 [Brassica 
rapa]
Length=226

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 60/91 (66%), Gaps = 0/91 (0%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ ++FNHDPP C+ C DCGG S CG  CSAL S  + GY VC +LG  S++ + +ID
Sbjct  22   QLCDLLIFNHDPPRCVGCQDCGGPSHCGTSCSALLSENVRGYDVCTSLGHASSSKVDVID  81

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCDD  644
               P KGI VK    + N NCSL+VSV+C  
Sbjct  82   KEDPGKGITVKMLAGSSNPNCSLSVSVICQK  112



>gb|ACR36424.1| unknown [Zea mays]
Length=155

 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +3

Query  387  MLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPL  566
            MLFN DPPMCL+C DCGG  RCG  CSAL S+ IGGY VC T+G  S + ISL+D  +P 
Sbjct  1    MLFNFDPPMCLNCEDCGGPLRCGTQCSALVSNNIGGYDVCTTIGGLSKSHISLVDEGNPR  60

Query  567  KGIVVKTYHTALNTNCSLAVSVVCDDAA  650
            KGI+VK +    ++ CS++VSV+CD  A
Sbjct  61   KGIIVKMF----SSKCSISVSVICDSNA  84



>gb|KEH34808.1| autophagy-related protein [Medicago truncatula]
Length=201

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 62/92 (67%), Gaps = 1/92 (1%)
 Frame = +3

Query  387  MLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPL  566
            M+FNHDPP C DC DCGG +RCGM C AL S+ IGGY VCA +GR     I +ID  +P 
Sbjct  1    MIFNHDPPTCADCWDCGGPTRCGMECGALVSNNIGGYHVCAAIGRGPKIDIDVIDKKNPH  60

Query  567  KGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
             G+ VK   ++L  NCSLAVSV+C+ +   GP
Sbjct  61   VGVTVKMSSSSLKYNCSLAVSVLCNVNGVQGP  92



>ref|XP_008804113.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804114.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008804115.1| PREDICTED: uncharacterized protein LOC103717482 isoform X2 [Phoenix 
dactylifera]
Length=201

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  387  MLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLIDNNSPL  566
            M+FNH+PP C  C DCGG S CGM CSAL ++ IGGY VC T+G     +I+LID N P 
Sbjct  1    MIFNHNPPRCFGCQDCGGPSHCGMKCSALVANNIGGYHVCTTIGGLPNQNIALIDENDPE  60

Query  567  KGIVVKTYHTALNTNCSLAVSVVCDDAAT  653
            +G++++    +L  NCSL+VSV CD   T
Sbjct  61   RGVIIRMSANSLEKNCSLSVSVFCDSVKT  89



>gb|KCW65716.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=205

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 58/104 (56%), Gaps = 20/104 (19%)
 Frame = +3

Query  333  FYRVAANGTVIWFQLCETMLFNHDPPMC-LDCVDcgggsrcgmgcsALASSIIGGYPVCA  509
            FY+VAAN TV+WFQ C        P  C ++C             SAL    +GGYPVC 
Sbjct  5    FYKVAANDTVLWFQNCG------GPSHCGMEC-------------SALVIDDVGGYPVCK  45

Query  510  TLGRPSTTSISLIDNNSPLKGIVVKTYHTALNTNCSLAVSVVCD  641
            T+GR ++T +++ID   P  G+ VK       +NCSL+VS+VCD
Sbjct  46   TIGRATSTYVNVIDEKKPHSGVTVKMISDGGKSNCSLSVSIVCD  89



>gb|AAD25947.1|AF085279_20 hypothetical protein [Arabidopsis thaliana]
 gb|AAM15351.1| hypothetical protein [Arabidopsis thaliana]
Length=111

 Score = 72.4 bits (176),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDGFYRVAANGTVIWFQL  377
            C++SF   NK++++NL S I N+PHGVLSEDGFY+V AN +V+WFQ+
Sbjct  26   CEFSFTGRNKVFHFNLASSIRNYPHGVLSEDGFYKVEANSSVLWFQV  72



>gb|KHN31307.1| hypothetical protein glysoja_022961 [Glycine soja]
Length=356

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 37/60 (62%), Gaps = 13/60 (22%)
 Frame = +3

Query  237  CDYSFQQNNKLYNYNLTSPISNFPHGVLSEDG-------------FYRVAANGTVIWFQL  377
            C +SF   N LYNY L+SPI NFPHG+LSEDG             FY+VA N T +WFQ+
Sbjct  32   CQFSFLDGNTLYNYTLSSPIRNFPHGILSEDGSLPDLPLTLSLSPFYKVAVNDTTLWFQV  91



>gb|EPS63394.1| hypothetical protein M569_11391, partial [Genlisea aurea]
Length=190

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 2/65 (3%)
 Frame = +3

Query  468  ALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHTALNTNCSLAVSVVCD-D  644
            AL S+ I GYPVC TLGRPS+T+I + +  SP  G++V   +     NCSL VSVVCD +
Sbjct  16   ALVSNKIEGYPVCTTLGRPSSTAIVIRERKSPHSGVIV-MMNDGTRQNCSLYVSVVCDSN  74

Query  645  AATGP  659
               GP
Sbjct  75   KVQGP  79



>gb|KCW65717.1| hypothetical protein EUGRSUZ_G03091 [Eucalyptus grandis]
Length=205

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +3

Query  468  ALASSIIGGYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHTALNTNCSLAVSVVCD  641
            AL    +GGYPVC T+GR ++T +++ID   P  G+ VK       +NCSL+VS+VCD
Sbjct  32   ALVIDDVGGYPVCKTIGRATSTYVNVIDEKKPHSGVTVKMISDGGKSNCSLSVSIVCD  89



>ref|NP_001078029.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC09813.1| uncharacterized protein AT2G40316 [Arabidopsis thaliana]
Length=195

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 20/97 (21%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ ++FNHDPP C+ C D                   GG   C T    +  S ++ D
Sbjct  9    QLCDVLIFNHDPPRCVGCED------------------CGGPSHCGT-SCSALVSENVRD  49

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCDDAAT-GP  659
               P KG++V+      N NCSL+VSV+C      GP
Sbjct  50   KEDPGKGVIVQMSTGNRNQNCSLSVSVICQKTKVDGP  86



>gb|AAY82253.1| hypothetical protein At2g40316 [Arabidopsis thaliana]
Length=195

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 45/97 (46%), Gaps = 20/97 (21%)
 Frame = +3

Query  372  QLCETMLFNHDPPMCLDCVDcgggsrcgmgcsALASSIIGGYPVCATLGRPSTTSISLID  551
            QLC+ ++FNHDPP C+ C D                   GG   C T    +  S ++ D
Sbjct  9    QLCDVLIFNHDPPRCVGCED------------------CGGPSHCGT-SCSALVSENVRD  49

Query  552  NNSPLKGIVVKTYHTALNTNCSLAVSVVCDDAAT-GP  659
               P KG++V+      N NCSL+VSV+C      GP
Sbjct  50   KEDPGKGVIVQMSTGNRNQNCSLSVSVICQKTKVDGP  86



>ref|XP_010264548.1| PREDICTED: uncharacterized protein LOC104602522 isoform X3 [Nelumbo 
nucifera]
Length=230

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 35/57 (61%), Gaps = 1/57 (2%)
 Frame = +3

Query  492  GYPVCATLGRPSTTSISLIDNNSPLKGIVVKTYHTALNTNCSLAVSVVCD-DAATGP  659
            GY VC T+G+ S+ +++LID   P KG+ V+   +    NCSL VSV CD +   GP
Sbjct  65   GYHVCTTIGKASSVNVNLIDREDPQKGVNVRMSSSGSKGNCSLTVSVFCDSNGVEGP  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320