BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF035A12

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611099.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    177   2e-49   Nicotiana tomentosiformis
ref|XP_009762623.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    174   2e-48   Nicotiana sylvestris
ref|XP_009620909.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    172   6e-48   Nicotiana tomentosiformis
ref|XP_009620902.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    173   2e-47   
ref|XP_007205483.1|  hypothetical protein PRUPE_ppa008150mg             168   2e-46   
ref|XP_008218676.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    168   3e-46   Prunus mume [ume]
ref|XP_008218667.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    168   3e-46   Prunus mume [ume]
emb|CDP13685.1|  unnamed protein product                                168   4e-46   Coffea canephora [robusta coffee]
ref|XP_007205484.1|  hypothetical protein PRUPE_ppa008150mg             167   5e-46   Prunus persica
ref|XP_009791010.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    166   2e-45   Nicotiana sylvestris
ref|XP_002267586.3|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    166   2e-45   Vitis vinifera
emb|CAN74282.1|  hypothetical protein VITISV_016708                     166   3e-45   Vitis vinifera
ref|XP_006344901.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    165   8e-45   Solanum tuberosum [potatoes]
gb|KDP39322.1|  hypothetical protein JCGZ_01079                         162   5e-44   Jatropha curcas
gb|KJB81576.1|  hypothetical protein B456_013G150600                    156   8e-42   Gossypium raimondii
ref|XP_010103951.1|  hypothetical protein L484_020203                   159   9e-42   
ref|XP_006346113.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    156   9e-42   Solanum tuberosum [potatoes]
gb|KJB81575.1|  hypothetical protein B456_013G150600                    156   1e-41   Gossypium raimondii
gb|KJB13894.1|  hypothetical protein B456_002G102600                    154   3e-41   Gossypium raimondii
ref|XP_011095581.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   4e-41   Sesamum indicum [beniseed]
ref|XP_010061428.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    154   4e-41   Eucalyptus grandis [rose gum]
ref|XP_002298883.1|  hypothetical protein POPTR_0001s38010g             154   5e-41   Populus trichocarpa [western balsam poplar]
gb|KHG25819.1|  hypothetical protein F383_09207                         154   5e-41   Gossypium arboreum [tree cotton]
ref|XP_007020422.1|  RING/U-box domain-containing protein isoform 2     154   5e-41   Theobroma cacao [chocolate]
ref|XP_007020421.1|  RING/U-box domain-containing protein isoform 1     154   5e-41   
ref|XP_006575716.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    153   5e-41   Glycine max [soybeans]
gb|KJB13895.1|  hypothetical protein B456_002G102600                    154   9e-41   Gossypium raimondii
gb|ACU18237.1|  unknown                                                 154   1e-40   Glycine max [soybeans]
gb|EYU27461.1|  hypothetical protein MIMGU_mgv1a011482mg                152   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_004244025.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    152   2e-40   Solanum lycopersicum
gb|KJB81577.1|  hypothetical protein B456_013G150600                    153   3e-40   Gossypium raimondii
gb|KHN43912.1|  E3 ubiquitin-protein ligase                             151   4e-40   Glycine soja [wild soybean]
ref|XP_006401395.1|  hypothetical protein EUTSA_v10014037mg             151   5e-40   Eutrema salsugineum [saltwater cress]
gb|KHN23825.1|  E3 ubiquitin-protein ligase                             154   7e-40   Glycine soja [wild soybean]
ref|XP_004491529.1|  PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin...    151   9e-40   
ref|XP_011038870.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    151   1e-39   Populus euphratica
ref|XP_011038869.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    150   1e-39   Populus euphratica
dbj|BAB09279.1|  unnamed protein product                                149   2e-39   Arabidopsis thaliana [mouse-ear cress]
gb|KHN31684.1|  hypothetical protein glysoja_022549                     145   2e-39   Glycine soja [wild soybean]
ref|XP_010450483.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    150   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010443238.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    149   3e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010483065.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    149   4e-39   Camelina sativa [gold-of-pleasure]
ref|NP_568834.1|  RING/U-box domain-containing protein                  149   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353104.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    149   7e-39   
ref|XP_010443237.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010061429.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    148   1e-38   Eucalyptus grandis [rose gum]
ref|XP_002864420.1|  zinc finger family protein                         148   1e-38   
ref|XP_004294914.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    147   1e-38   Fragaria vesca subsp. vesca
ref|XP_006280769.1|  hypothetical protein CARUB_v10026740mg             147   3e-38   Capsella rubella
gb|KHG22760.1|  hypothetical protein F383_06014                         145   8e-38   Gossypium arboreum [tree cotton]
ref|XP_009347513.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    145   1e-37   Pyrus x bretschneideri [bai li]
emb|CDX94309.1|  BnaC01g18750D                                          145   1e-37   
emb|CDY36773.1|  BnaA03g11130D                                          144   2e-37   Brassica napus [oilseed rape]
ref|XP_010539334.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    145   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_009132344.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    144   2e-37   Brassica rapa
emb|CDY11965.1|  BnaC03g13910D                                          144   2e-37   Brassica napus [oilseed rape]
emb|CDY61181.1|  BnaCnng37430D                                          144   3e-37   Brassica napus [oilseed rape]
ref|XP_006413164.1|  hypothetical protein EUTSA_v10025652mg             144   4e-37   Eutrema salsugineum [saltwater cress]
ref|XP_006602119.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    143   5e-37   Glycine max [soybeans]
ref|XP_009120112.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    143   6e-37   Brassica rapa
ref|XP_009120113.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    143   6e-37   Brassica rapa
ref|XP_011044923.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    143   7e-37   Populus euphratica
ref|XP_011044922.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    143   7e-37   Populus euphratica
ref|XP_006452653.1|  hypothetical protein CICLE_v10008862mg             142   1e-36   
ref|XP_006284075.1|  hypothetical protein CARUB_v10005205mg             142   1e-36   Capsella rubella
ref|XP_009142488.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    142   2e-36   Brassica rapa
ref|XP_002316784.2|  hypothetical protein POPTR_0011s09710g             142   2e-36   Populus trichocarpa [western balsam poplar]
emb|CDY17377.1|  BnaA10g10110D                                          142   2e-36   Brassica napus [oilseed rape]
emb|CDX89323.1|  BnaA01g15700D                                          142   2e-36   
ref|XP_006586152.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    142   2e-36   
ref|XP_006452654.1|  hypothetical protein CICLE_v10008862mg             142   3e-36   Citrus clementina [clementine]
ref|XP_006474826.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...    141   3e-36   Citrus sinensis [apfelsine]
gb|KDO59201.1|  hypothetical protein CISIN_1g019720mg                   141   3e-36   Citrus sinensis [apfelsine]
gb|KEH28464.1|  E3 ubiquitin protein ligase RIE1-like protein, pu...    141   4e-36   Medicago truncatula
ref|XP_007140118.1|  hypothetical protein PHAVU_008G085400g             140   5e-36   Phaseolus vulgaris [French bean]
ref|XP_003617871.1|  RING finger protein                                141   5e-36   
ref|XP_003617870.1|  RING finger protein                                141   5e-36   
ref|XP_009367256.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    141   6e-36   Pyrus x bretschneideri [bai li]
ref|XP_008384601.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   8e-36   
ref|XP_010438729.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   8e-36   Camelina sativa [gold-of-pleasure]
ref|XP_008384599.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    140   8e-36   
ref|XP_004498153.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    140   1e-35   
ref|XP_002867557.1|  protein binding protein                            138   7e-35   
ref|XP_010545287.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    137   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_008463025.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    137   1e-34   Cucumis melo [Oriental melon]
gb|KGN44388.1|  hypothetical protein Csa_7G278230                       137   2e-34   
ref|NP_194388.2|  RING/U-box domain-containing protein                  137   2e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CAB43854.1|  putative protein                                       138   4e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433472.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    135   6e-34   Camelina sativa [gold-of-pleasure]
gb|KHN24407.1|  E3 ubiquitin-protein ligase                             134   7e-34   Glycine soja [wild soybean]
ref|XP_010675979.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    134   2e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS57981.1|  hypothetical protein M569_16836                         133   3e-33   Genlisea aurea
ref|XP_004149408.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    132   9e-33   Cucumis sativus [cucumbers]
ref|XP_008463026.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    129   7e-32   Cucumis melo [Oriental melon]
ref|XP_010245027.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    130   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_004160245.1|  PREDICTED: E3 ubiquitin protein ligase RIE1-...    129   9e-32   
ref|XP_008463028.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    129   1e-31   
ref|XP_004149419.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    129   2e-31   Cucumis sativus [cucumbers]
ref|XP_002522801.1|  ring finger protein, putative                      125   2e-30   Ricinus communis
ref|XP_006857729.1|  hypothetical protein AMTR_s00061p00183390          122   3e-29   
ref|XP_010922953.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    122   3e-29   Elaeis guineensis
ref|XP_008791159.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    111   3e-25   Phoenix dactylifera
dbj|BAB92290.1|  RING zinc finger protein-like                          108   4e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02980.1|  predicted protein                                      107   5e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY75518.1|  hypothetical protein OsI_03422                          107   5e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_006644577.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    107   1e-23   Oryza brachyantha
ref|XP_010232201.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    106   1e-23   Brachypodium distachyon [annual false brome]
dbj|BAJ91193.1|  predicted protein                                      109   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA57962.1|  TPA: putative RING zinc finger domain superfamil...    107   3e-23   
emb|CDM83669.1|  unnamed protein product                                105   3e-23   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008675134.1|  PREDICTED: E3 ubiquitin-protein ligase At4g1...    106   4e-23   
ref|XP_009418470.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    104   1e-22   
ref|XP_009418469.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    103   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418468.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...    103   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS46348.1|  hypothetical protein TRIUR3_26831                       102   6e-22   Triticum urartu
gb|EMT31277.1|  E3 ubiquitin-protein ligase                           95.5    9e-20   
gb|KDO59202.1|  hypothetical protein CISIN_1g019720mg                 78.6    7e-14   Citrus sinensis [apfelsine]
ref|XP_002961593.1|  hypothetical protein SELMODRAFT_76977            55.5    1e-05   
ref|XP_002971210.1|  hypothetical protein SELMODRAFT_171829           55.1    1e-05   
gb|KJB70539.1|  hypothetical protein B456_011G078300                  54.7    2e-05   Gossypium raimondii
ref|XP_011081882.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  54.3    3e-05   Sesamum indicum [beniseed]
gb|EPS59843.1|  hypothetical protein M569_14963                       53.9    4e-05   Genlisea aurea
ref|XP_011087227.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  53.1    7e-05   
ref|XP_006366871.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  53.1    8e-05   Solanum tuberosum [potatoes]
ref|XP_009775580.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  52.8    9e-05   Nicotiana sylvestris
ref|XP_009775577.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  52.8    1e-04   Nicotiana sylvestris
ref|NP_178156.1|  putative zinc ion binding protein                   52.8    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EPS64040.1|  hypothetical protein M569_10741                       52.4    1e-04   Genlisea aurea
ref|XP_009586726.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  52.4    1e-04   
ref|XP_004251592.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  52.0    2e-04   
ref|XP_009595010.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  52.0    2e-04   Nicotiana tomentosiformis
emb|CDP18420.1|  unnamed protein product                              52.0    2e-04   Coffea canephora [robusta coffee]
ref|XP_006389789.1|  hypothetical protein EUTSA_v10018651mg           52.0    2e-04   Eutrema salsugineum [saltwater cress]
ref|XP_001765272.1|  predicted protein                                51.6    2e-04   
ref|XP_001765270.1|  predicted protein                                51.6    2e-04   
gb|EYU21913.1|  hypothetical protein MIMGU_mgv1a007146mg              51.6    3e-04   Erythranthe guttata [common monkey flower]
ref|XP_009381141.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  51.2    3e-04   
gb|KHF98391.1|  hypothetical protein F383_13476                       51.2    3e-04   Gossypium arboreum [tree cotton]
gb|KHG22085.1|  hypothetical protein F383_26605                       51.2    3e-04   Gossypium arboreum [tree cotton]
gb|ACU20068.1|  unknown                                               49.7    3e-04   Glycine max [soybeans]
gb|KJB68139.1|  hypothetical protein B456_010G227900                  51.2    4e-04   Gossypium raimondii
ref|XP_003522643.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  51.2    4e-04   Glycine max [soybeans]
ref|XP_006844405.1|  hypothetical protein AMTR_s00142p00106560        51.2    4e-04   
gb|KCW84811.1|  hypothetical protein EUGRSUZ_B01618                   50.8    4e-04   Eucalyptus grandis [rose gum]
gb|EYU29255.1|  hypothetical protein MIMGU_mgv1a007086mg              50.8    4e-04   Erythranthe guttata [common monkey flower]
ref|XP_009760536.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  50.8    5e-04   Nicotiana sylvestris
gb|KJB53924.1|  hypothetical protein B456_009G011400                  50.4    5e-04   Gossypium raimondii
ref|XP_010039941.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  50.4    6e-04   
ref|XP_003546278.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  50.4    6e-04   Glycine max [soybeans]
gb|KHM98780.1|  E3 ubiquitin-protein ligase                           50.4    6e-04   Glycine soja [wild soybean]
gb|KHG19351.1|  E3 ubiquitin ligase RIE1 -like protein                50.4    7e-04   Gossypium arboreum [tree cotton]
gb|KJB53925.1|  hypothetical protein B456_009G011400                  50.4    7e-04   Gossypium raimondii
gb|KJB53919.1|  hypothetical protein B456_009G011400                  50.4    7e-04   Gossypium raimondii
ref|XP_010537938.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  50.1    7e-04   Tarenaya hassleriana [spider flower]
ref|XP_004501279.1|  PREDICTED: E3 ubiquitin-protein ligase At1g1...  50.1    8e-04   Cicer arietinum [garbanzo]
ref|XP_002324833.1|  zinc finger family protein                       50.1    8e-04   
gb|KJB35099.1|  hypothetical protein B456_006G100000                  49.7    8e-04   Gossypium raimondii
ref|XP_007024038.1|  RING/U-box superfamily protein                   50.1    9e-04   
ref|XP_009125802.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  50.1    0.001   
ref|XP_004291419.1|  PREDICTED: E3 ubiquitin-protein ligase At1g6...  50.1    0.001   Fragaria vesca subsp. vesca
ref|XP_007161262.1|  hypothetical protein PHAVU_001G055600g           50.1    0.001   Phaseolus vulgaris [French bean]
ref|XP_006412451.1|  hypothetical protein EUTSA_v10025242mg           50.1    0.001   Eutrema salsugineum [saltwater cress]
ref|XP_002309588.2|  zinc finger family protein                       49.7    0.001   Populus trichocarpa [western balsam poplar]



>ref|XP_009611099.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Nicotiana tomentosiformis]
Length=349

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 108/142 (76%), Gaps = 7/142 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAA------ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN+R  +TTDS C+S         AT   +  M V  R  S +RT  S F++R+A+RISR
Sbjct  14   MNSRYFITTDSLCSSRVVVPVPPIATEVVEETMDVNVRNMSSARTPFSSFLIRMAIRISR  73

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            +R F FLRRVFHYQNGS  S+LG+NPFNS+TWMMMEC+ LSVQI+ TAYTLA+SKEERPV
Sbjct  74   SRCFSFLRRVFHYQNGSR-SELGANPFNSVTWMMMECIALSVQIIITAYTLAISKEERPV  132

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIWV GY+FGC+LS +LLY
Sbjct  133  WPMRIWVFGYSFGCVLSLILLY  154



>ref|XP_009762623.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=337

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 105/142 (74%), Gaps = 7/142 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAA------ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN+R  +TTDS C+S         AT      M V  R  S SRT  S F++R+ +RISR
Sbjct  1    MNSRYFITTDSLCSSRVVVPFPTIATEVVGETMDVNVRNMSSSRTPLSSFLIRMTIRISR  60

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            +R F FLRRVFHYQNGS  S+LGSNPFNS+ WMMMEC+ LS+QI+ TAYTLA+SKEERPV
Sbjct  61   SRCFSFLRRVFHYQNGSR-SELGSNPFNSVIWMMMECIALSIQIIVTAYTLAISKEERPV  119

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIWV GY+FGC+LS +LLY
Sbjct  120  WPMRIWVFGYSFGCVLSLILLY  141



>ref|XP_009620909.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Nicotiana tomentosiformis]
Length=341

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 11/144 (8%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGA--------AATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRI  469
            MN R  LT  S C+S          +A +G D  MS V  T+++S   PS  +VR+AMRI
Sbjct  1    MNTRYFLTPVSLCHSSIIVSFPPIISAATG-DERMSSVGGTRNRS-ILPSSLLVRMAMRI  58

Query  470  SRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEER  649
            SRARWF FLRRVFHYQNGS  SDLGSNP NS+TWMMMEC+ LSVQI+  +YTLAVSKEE+
Sbjct  59   SRARWFSFLRRVFHYQNGSR-SDLGSNPLNSMTWMMMECIALSVQIIIASYTLAVSKEEK  117

Query  650  PVWPMRIWVSGYAFGCLLSXLLLY  721
            PVWPM+IWV GYAFGC++S +LLY
Sbjct  118  PVWPMKIWVLGYAFGCIISVMLLY  141



>ref|XP_009620902.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Nicotiana tomentosiformis]
Length=402

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 107/144 (74%), Gaps = 11/144 (8%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGA--------AATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRI  469
            MN R  LT  S C+S          +A +G D  MS V  T+++S   PS  +VR+AMRI
Sbjct  62   MNTRYFLTPVSLCHSSIIVSFPPIISAATG-DERMSSVGGTRNRS-ILPSSLLVRMAMRI  119

Query  470  SRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEER  649
            SRARWF FLRRVFHYQNGS  SDLGSNP NS+TWMMMEC+ LSVQI+  +YTLAVSKEE+
Sbjct  120  SRARWFSFLRRVFHYQNGSR-SDLGSNPLNSMTWMMMECIALSVQIIIASYTLAVSKEEK  178

Query  650  PVWPMRIWVSGYAFGCLLSXLLLY  721
            PVWPM+IWV GYAFGC++S +LLY
Sbjct  179  PVWPMKIWVLGYAFGCIISVMLLY  202



>ref|XP_007205483.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
 gb|EMJ06682.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
Length=330

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R L  ++  CNS  +A S      G+D     V RT+S SR  PS F++R+AMRISR
Sbjct  1    MNTRYLFPSEPMCNSAGSAVSFSSTSPGDDRTAVSVIRTRS-SRAPPSSFLMRMAMRISR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L VQI  T  TLAVSK+ERPV
Sbjct  60   ARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFIALVVQISITTITLAVSKKERPV  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GC L+ L+L+
Sbjct  119  WPMRIWIVGYDIGCFLNLLVLF  140



>ref|XP_008218676.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Prunus 
mume]
Length=336

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R L  ++  CNS  +A S      G+D     V RT+S SR  PS F++R+AMRISR
Sbjct  1    MNTRYLFPSEPMCNSAGSAVSFSSTSPGDDRTAVSVIRTRS-SRAPPSSFLMRMAMRISR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L VQI  T  TLAVSK+ERPV
Sbjct  60   ARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFIALVVQISITTITLAVSKKERPV  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GC+L+ L+L+
Sbjct  119  WPMRIWIVGYDIGCVLNLLVLF  140



>ref|XP_008218667.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Prunus 
mume]
Length=343

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (73%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R L  ++  CNS  +A S      G+D     V RT+S SR  PS F++R+AMRISR
Sbjct  1    MNTRYLFPSEPMCNSAGSAVSFSSTSPGDDRTAVSVIRTRS-SRAPPSSFLMRMAMRISR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L VQI  T  TLAVSK+ERPV
Sbjct  60   ARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFIALVVQISITTITLAVSKKERPV  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GC+L+ L+L+
Sbjct  119  WPMRIWIVGYDIGCVLNLLVLF  140



>emb|CDP13685.1| unnamed protein product [Coffea canephora]
Length=342

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 102/143 (71%), Gaps = 7/143 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSG-AAATS-----GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R   T +  CNSG A A S     G+D  M V AR++  SR  PS F++R+AM+ISR
Sbjct  1    MNTRYFFTPELVCNSGFADAISSISPLGDDHRMVVSARSRPSSRVPPSSFLIRMAMKISR  60

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            +RWF FLRRVFHYQNG   SDL SNPFN+ +WMM E V L+VQI    YTLA+SKEERPV
Sbjct  61   SRWFSFLRRVFHYQNG-PRSDLASNPFNTGSWMMTEFVVLAVQIAMVVYTLAISKEERPV  119

Query  656  WPMRIWVSGYAFGCLLSXLLLYC  724
            WPMRIWVSGYA GC+LS + L C
Sbjct  120  WPMRIWVSGYACGCILSLMQLCC  142



>ref|XP_007205484.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
 gb|EMJ06683.1| hypothetical protein PRUPE_ppa008150mg [Prunus persica]
Length=343

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R L  ++  CNS  +A S      G+D     V RT+S SR  PS F++R+AMRISR
Sbjct  1    MNTRYLFPSEPMCNSAGSAVSFSSTSPGDDRTAVSVIRTRS-SRAPPSSFLMRMAMRISR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L VQI  T  TLAVSK+ERPV
Sbjct  60   ARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFIALVVQISITTITLAVSKKERPV  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GC L+ L+L+
Sbjct  119  WPMRIWIVGYDIGCFLNLLVLF  140



>ref|XP_009791010.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
sylvestris]
 ref|XP_009791011.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nicotiana 
sylvestris]
Length=336

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 104/145 (72%), Gaps = 10/145 (7%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-------SGEDTMMSVVARTQSQS--RTQPSPFMVRVAMR  466
            MN R  LT  S C+S    +       +  D  MS    T+++S      S F++R++MR
Sbjct  1    MNTRYFLTPVSLCHSSIIVSFPPMISPAAGDGRMSSGGGTRNRSIRNISHSSFLIRMSMR  60

Query  467  ISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEE  646
            ISR+RWF FLRRVFHYQNGS  SDLGSNPFNS+TWMMMEC+ LSVQI+  +YTL VSKEE
Sbjct  61   ISRSRWFSFLRRVFHYQNGSR-SDLGSNPFNSMTWMMMECIALSVQIIIASYTLTVSKEE  119

Query  647  RPVWPMRIWVSGYAFGCLLSXLLLY  721
            +PVWPMRIWV GYAFGC++S +LLY
Sbjct  120  KPVWPMRIWVLGYAFGCIISVMLLY  144



>ref|XP_002267586.3| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Vitis vinifera]
 emb|CBI39785.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 102/142 (72%), Gaps = 9/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT------SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R     DS CNSG + +      +GED M + V R +S SR  PS F++R AMRISR
Sbjct  1    MNTRYFFPPDSLCNSGISVSFSSLSPAGEDRMAAGV-RNRS-SRAPPSSFLIRTAMRISR  58

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  SDLG+NPFNS TWM++E + L VQI    +TL+VSK ERPV
Sbjct  59   ARWFSFLRRVFHYQNGSR-SDLGANPFNSSTWMILEFIALVVQIGVITFTLSVSKAERPV  117

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY FGC+LS LLLY
Sbjct  118  WPMRIWIVGYDFGCVLSLLLLY  139



>emb|CAN74282.1| hypothetical protein VITISV_016708 [Vitis vinifera]
Length=343

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 102/142 (72%), Gaps = 9/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT------SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R     DS CNSG + +      +GED M + V R +S SR  PS F++R AMRISR
Sbjct  1    MNTRYFFPPDSLCNSGISVSFSSLSPAGEDRMAAGV-RNRS-SRAPPSSFLIRTAMRISR  58

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  SDLG+NPFNS TWM++E + L VQI    +TL+VSK ERPV
Sbjct  59   ARWFSFLRRVFHYQNGSR-SDLGANPFNSNTWMILEFIALVVQIGVITFTLSVSKAERPV  117

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY FGC+LS LLLY
Sbjct  118  WPMRIWIVGYDFGCVLSLLLLY  139



>ref|XP_006344901.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Solanum 
tuberosum]
Length=354

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 13/146 (9%)
 Frame = +2

Query  323  RGLLTTDSFCNSG-------------AAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAM  463
            R  LT  S C+S              A +  G +       R    S    S F++R+AM
Sbjct  5    RYFLTPISLCHSSIVVSFPSISPSTTAVSVGGSNYAGGNRNRYTRASNIPDSSFLIRMAM  64

Query  464  RISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKE  643
            RISRA+WFIFLRRVFHYQNG + SDLGSNPFNS+TWMMMEC++LS+QI+ + YTL+VSK+
Sbjct  65   RISRAKWFIFLRRVFHYQNGYSRSDLGSNPFNSITWMMMECISLSIQIILSVYTLSVSKD  124

Query  644  ERPVWPMRIWVSGYAFGCLLSXLLLY  721
            E+PVWPMR+W  GY FGC+LS LLLY
Sbjct  125  EKPVWPMRMWAFGYVFGCILSVLLLY  150



>gb|KDP39322.1| hypothetical protein JCGZ_01079 [Jatropha curcas]
Length=346

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 98/142 (69%), Gaps = 9/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSG------AAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R   T DS CNSG      A +  GED     +      SR+ PS F++R+AMRISR
Sbjct  1    MNTRYFSTPDSLCNSGTTVSFSANSAIGEDR--GAMTTRNRPSRSPPSTFLIRIAMRISR  58

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  S+LGSNPFNS TWMM+E + L VQI  T  TLA+S+ E+PV
Sbjct  59   ARWFTFLRRVFHYQNGSR-SNLGSNPFNSSTWMMLEFIALIVQISMTTITLAISQTEKPV  117

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GCLLS L+LY
Sbjct  118  WPMRIWIVGYDIGCLLSLLVLY  139



>gb|KJB81576.1| hypothetical protein B456_013G150600 [Gossypium raimondii]
Length=342

 Score =   156 bits (395),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 94/141 (67%), Gaps = 7/141 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRA  478
            MN R     DS C S  A        G +  + V  R +   R  PS  ++R AMRISRA
Sbjct  1    MNTRYSFQPDSLCTSSTAVPFSSNPHGVEERIVVGMRNRP-PRAPPSSILIRTAMRISRA  59

Query  479  RWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVW  658
            RWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI   A+TLA+SKEERP+W
Sbjct  60   RWFNFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISIIAFTLAISKEERPIW  118

Query  659  PMRIWVSGYAFGCLLSXLLLY  721
            PMRIW+ GY  GC+LS LLLY
Sbjct  119  PMRIWIVGYDIGCVLSLLLLY  139



>ref|XP_010103951.1| hypothetical protein L484_020203 [Morus notabilis]
 gb|EXB97654.1| hypothetical protein L484_020203 [Morus notabilis]
Length=456

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 102/144 (71%), Gaps = 10/144 (7%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNS-------GAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRIS  472
            MN R  + +DS CNS        +++ +G D + +  AR ++  R  PS  ++R+AMR+S
Sbjct  1    MNTRYFIPSDSLCNSINTISIFSSSSVTGGDRIPATTARNRAP-RAPPS-LLIRMAMRVS  58

Query  473  RARWFIFLRRVFHYQNGSTT-SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEER  649
            RARWF FLRRVFHYQNGS + SDLGSNPFNS TWMM+E + L VQI  T  TLA+SK+ER
Sbjct  59   RARWFTFLRRVFHYQNGSGSRSDLGSNPFNSSTWMMLELIALLVQISITTITLAISKKER  118

Query  650  PVWPMRIWVSGYAFGCLLSXLLLY  721
            PVWPMR+W+ GY  GC L+ LLL+
Sbjct  119  PVWPMRMWIVGYDIGCFLNLLLLF  142



>ref|XP_006346113.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
tuberosum]
Length=325

 Score =   156 bits (394),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 6/138 (4%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVART--QSQSRTQPSPFMVRVAMRISRARWF  487
            M++R  +TTDS CNS      G + M   V RT   S S +  S F+VR+A+RISR+R F
Sbjct  1    MSSRYFITTDSLCNSRII---GPERMNLDVRRTPPSSSSSSSSSSFLVRMAIRISRSRCF  57

Query  488  IFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMR  667
             FLRRVFHYQNGS  S+LGSNPFNS+TWM+MEC+ LSVQI+ T  TL V+KEERPVWPMR
Sbjct  58   SFLRRVFHYQNGSR-SELGSNPFNSVTWMIMECIALSVQIIVTTITLVVTKEERPVWPMR  116

Query  668  IWVSGYAFGCLLSXLLLY  721
            IWV GY FGC++S +LLY
Sbjct  117  IWVFGYGFGCVISLILLY  134



>gb|KJB81575.1| hypothetical protein B456_013G150600 [Gossypium raimondii]
Length=345

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 94/141 (67%), Gaps = 7/141 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRA  478
            MN R     DS C S  A        G +  + V  R +   R  PS  ++R AMRISRA
Sbjct  1    MNTRYSFQPDSLCTSSTAVPFSSNPHGVEERIVVGMRNRP-PRAPPSSILIRTAMRISRA  59

Query  479  RWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVW  658
            RWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI   A+TLA+SKEERP+W
Sbjct  60   RWFNFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISIIAFTLAISKEERPIW  118

Query  659  PMRIWVSGYAFGCLLSXLLLY  721
            PMRIW+ GY  GC+LS LLLY
Sbjct  119  PMRIWIVGYDIGCVLSLLLLY  139



>gb|KJB13894.1| hypothetical protein B456_002G102600 [Gossypium raimondii]
Length=295

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRA  478
            MN R     DS CNS  A       +GE+  ++  +R +S  R   S  ++R+ MR+SRA
Sbjct  1    MNTRHSFQPDSLCNSSTAVPFSSNPTGEEDRVAAGSRNRSP-RAASSSILIRMVMRMSRA  59

Query  479  RWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVW  658
            RWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI    +TLA++K+E+PVW
Sbjct  60   RWFTFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLILVIQISIITFTLAIAKKEKPVW  118

Query  659  PMRIWVSGYAFGCLLSXLLLY  721
            PMRIW+ GY  GC LS LLLY
Sbjct  119  PMRIWIVGYDIGCALSLLLLY  139



>ref|XP_011095581.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Sesamum 
indicum]
Length=339

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 102/144 (71%), Gaps = 13/144 (9%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAA--------ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRI  469
            MN R     DS C+SG+A        A   E   +S  AR+   SRT P PF++R+AM+I
Sbjct  1    MNTRYFFQPDSLCSSGSAVSVSSIFPAAVEERIALSSPARS---SRTSP-PFLIRLAMKI  56

Query  470  SRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEER  649
            SR+RW+ FLRRVFHYQNGS  SDLG NPF+S  WM+ME + L+VQI  TAYTL +SK ER
Sbjct  57   SRSRWYSFLRRVFHYQNGSG-SDLGPNPFDSKNWMLMEFIALTVQISVTAYTLIISKGER  115

Query  650  PVWPMRIWVSGYAFGCLLSXLLLY  721
            PVWPMRIWV+GYAFGC L+ +LLY
Sbjct  116  PVWPMRIWVAGYAFGCFLNLVLLY  139



>ref|XP_010061428.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Eucalyptus 
grandis]
Length=342

 Score =   154 bits (390),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 97/139 (70%), Gaps = 4/139 (3%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT---SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARW  484
            MN R     +S C+S   AT   S   T    V  +++++   P  F+VR+AMRISRARW
Sbjct  1    MNTRYFFPPESLCSSSVGATFSSSSSATNDRAVIGSRNRAPRVPPSFLVRMAMRISRARW  60

Query  485  FIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPM  664
            F FLRRVFHYQNGS  SDLGSNPFNS TWM++E   L VQI  T++TLA+SK E+PVWPM
Sbjct  61   FTFLRRVFHYQNGSR-SDLGSNPFNSSTWMVLELTALMVQISITSFTLAISKSEKPVWPM  119

Query  665  RIWVSGYAFGCLLSXLLLY  721
            RIW+ GY  GC+LS LLLY
Sbjct  120  RIWIMGYDIGCMLSVLLLY  138



>ref|XP_002298883.1| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
 ref|XP_002298884.2| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
 gb|EEE83688.1| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
 gb|EEE83689.2| hypothetical protein POPTR_0001s38010g [Populus trichocarpa]
Length=341

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN R     +SFC S   A+   +   +V  R +S +RT  S  +VR AMRISRARWF F
Sbjct  1    MNTRYPFPMNSFCGSSPVASPAGEEHGTVSLRNRS-ARTPTSSLLVRTAMRISRARWFTF  59

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS  WMM+E V L +QI  T +TLA+SK E+PVWP+RIW
Sbjct  60   LRRVFHYQNGSR-SNLGSNPFNSSPWMMLEFVALVIQISITMFTLAISKAEKPVWPVRIW  118

Query  674  VSGYAFGCLLSXLLLY  721
            + GY  GC+LS LLLY
Sbjct  119  IIGYNIGCVLSLLLLY  134



>gb|KHG25819.1| hypothetical protein F383_09207 [Gossypium arboreum]
Length=342

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 90/140 (64%), Gaps = 5/140 (4%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTM----MSVVARTQSQSRTQPSPFMVRVAMRISRAR  481
            MN R     DS C S  A     +        VV       R  PS  ++R AMRISRAR
Sbjct  1    MNTRYSFQPDSLCTSSTAVPFSSNPHGVEERVVVGMRNRPPRAPPSSILIRTAMRISRAR  60

Query  482  WFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWP  661
            WF  LRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI   A+TLA+SKEERP+WP
Sbjct  61   WFNLLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISIIAFTLAISKEERPIWP  119

Query  662  MRIWVSGYAFGCLLSXLLLY  721
            MRIW+ GY  GC+LS LLLY
Sbjct  120  MRIWIVGYDIGCVLSLLLLY  139



>ref|XP_007020422.1| RING/U-box domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY11947.1| RING/U-box domain-containing protein isoform 2 [Theobroma cacao]
Length=343

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 100/142 (70%), Gaps = 9/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT------SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R     DS CNS  A +       GED M +  AR +S  R  PS  ++R+AMRISR
Sbjct  1    MNTRYSFQPDSLCNSSTAVSYSSNPPGGEDRM-AAGARNRS-PRAPPSSLLIRMAMRISR  58

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI  T +TLA+SK+ERPV
Sbjct  59   ARWFTFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISITTFTLAISKKERPV  117

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GCLLS LLLY
Sbjct  118  WPMRIWIVGYDIGCLLSLLLLY  139



>ref|XP_007020421.1| RING/U-box domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY11946.1| RING/U-box domain-containing protein isoform 1 [Theobroma cacao]
Length=346

 Score =   154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 100/142 (70%), Gaps = 9/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT------SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R     DS CNS  A +       GED M +  AR +S  R  PS  ++R+AMRISR
Sbjct  1    MNTRYSFQPDSLCNSSTAVSYSSNPPGGEDRM-AAGARNRS-PRAPPSSLLIRMAMRISR  58

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI  T +TLA+SK+ERPV
Sbjct  59   ARWFTFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISITTFTLAISKKERPV  117

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GCLLS LLLY
Sbjct  118  WPMRIWIVGYDIGCLLSLLLLY  139



>ref|XP_006575716.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Glycine 
max]
Length=303

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R  L       S    +S   T   V +      R  P  F+VR+AMRISRARWF F
Sbjct  1    MNSRCFLVHPQQEYSMVPFSSNSATEDRVASARNRPPRVTPPSFLVRIAMRISRARWFTF  60

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TWMM+E + L +QI  T +TLA+SK ERP+WPMRIW
Sbjct  61   LRRVFHYQNGSR-SNLGSNPFNSSTWMMLEFIALILQITITTFTLAISKRERPIWPMRIW  119

Query  674  VSGYAFGCLLSXLLLY  721
            VSGY  GC+L+ LLLY
Sbjct  120  VSGYDIGCVLNLLLLY  135



>gb|KJB13895.1| hypothetical protein B456_002G102600 [Gossypium raimondii]
Length=339

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRA  478
            MN R     DS CNS  A       +GE+  ++  +R +S  R   S  ++R+ MR+SRA
Sbjct  1    MNTRHSFQPDSLCNSSTAVPFSSNPTGEEDRVAAGSRNRS-PRAASSSILIRMVMRMSRA  59

Query  479  RWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVW  658
            RWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI    +TLA++K+E+PVW
Sbjct  60   RWFTFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLILVIQISIITFTLAIAKKEKPVW  118

Query  659  PMRIWVSGYAFGCLLSXLLLY  721
            PMRIW+ GY  GC LS LLLY
Sbjct  119  PMRIWIVGYDIGCALSLLLLY  139



>gb|ACU18237.1| unknown [Glycine max]
Length=365

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R  L       S    +S   T   V +      R  P  F+VR+AMRISRARWF F
Sbjct  1    MNSRCFLVHPQQEYSMVPFSSNSATEDRVASARNRPPRVTPPSFLVRIAMRISRARWFTF  60

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TWMM+E + L +QI  T +TLA+SK ERP+WPMRIW
Sbjct  61   LRRVFHYQNGSR-SNLGSNPFNSSTWMMLEFIALILQITITTFTLAISKRERPIWPMRIW  119

Query  674  VSGYAFGCLLSXLLLY  721
            VSGY  GC+L+ LLLY
Sbjct  120  VSGYDIGCVLNLLLLY  135



>gb|EYU27461.1| hypothetical protein MIMGU_mgv1a011482mg [Erythranthe guttata]
Length=280

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 96/141 (68%), Gaps = 7/141 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGA------AATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R   T DS C S +      A      +  +  +  +  SR     F++++AMR+SR
Sbjct  1    MNTRYFFTPDSLCTSVSITSILPAEERAAPSNSNPFSHPRPSSRNNSPSFLIKLAMRVSR  60

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            +RW+++LRRVFHYQNGS  SDLG NPF+S  WM+ME V+LSVQI+ T+YTL VS  ERPV
Sbjct  61   SRWYVYLRRVFHYQNGSG-SDLGPNPFDSRNWMLMELVSLSVQIIATSYTLIVSGGERPV  119

Query  656  WPMRIWVSGYAFGCLLSXLLL  718
            WPMRIWVSGYAFGC LS +LL
Sbjct  120  WPMRIWVSGYAFGCFLSLVLL  140



>ref|XP_004244025.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Solanum 
lycopersicum]
Length=329

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVART------QSQSRTQPSPFMVRVAMRISR  475
            M+NR  +TTDS C+S      G + +   V RT       S S +  S F++R+A+RISR
Sbjct  1    MSNRYFITTDSLCDSRII---GPERINLDVRRTPPSSSSSSSSSSSSSSFLIRMAIRISR  57

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            +R F FLRRVFHYQNGS  S+LGSNPFNS+TWM+ EC+ LSVQI+ T YTL V+K+ERPV
Sbjct  58   SRCFSFLRRVFHYQNGSR-SELGSNPFNSVTWMITECIALSVQIIVTTYTLVVTKDERPV  116

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIWV GY FGC++S +LLY
Sbjct  117  WPMRIWVFGYGFGCVISLILLY  138



>gb|KJB81577.1| hypothetical protein B456_013G150600, partial [Gossypium raimondii]
Length=366

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 91/132 (69%), Gaps = 7/132 (5%)
 Frame = +2

Query  341  DSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRV  505
            DS C S  A        G +  + V  R +   R  PS  ++R AMRISRARWF FLRRV
Sbjct  34   DSLCTSSTAVPFSSNPHGVEERIVVGMRNRP-PRAPPSSILIRTAMRISRARWFNFLRRV  92

Query  506  FHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGY  685
            FHYQNGS  SDLGSNPFNS TWMM+E + L +QI   A+TLA+SKEERP+WPMRIW+ GY
Sbjct  93   FHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISIIAFTLAISKEERPIWPMRIWIVGY  151

Query  686  AFGCLLSXLLLY  721
              GC+LS LLLY
Sbjct  152  DIGCVLSLLLLY  163



>gb|KHN43912.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=322

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  362  AAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDL  541
            ++ ++ ED + S   R     R  P  F+VR+AMRISRARWF FLRRVFHYQNGS  S+L
Sbjct  5    SSNSATEDRVASARNRP---PRVTPPSFLVRIAMRISRARWFTFLRRVFHYQNGSR-SNL  60

Query  542  GSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            GSNPFNS TWMM+E + L +QI  T +TLA+SK ERP+WPMRIWVSGY  GC+L+ LLLY
Sbjct  61   GSNPFNSSTWMMLEFIALILQITITTFTLAISKRERPIWPMRIWVSGYDIGCVLNLLLLY  120



>ref|XP_006401395.1| hypothetical protein EUTSA_v10014037mg [Eutrema salsugineum]
 gb|ESQ42848.1| hypothetical protein EUTSA_v10014037mg [Eutrema salsugineum]
Length=338

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = +2

Query  398  VVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMM  577
            VVA + +Q R  PS F +R+AMR+SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM
Sbjct  31   VVAASDAQERA-PSSFYIRLAMRVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMM  88

Query  578  MECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             E + L VQ+     TLA+SKEERP+WP+R+W++GY  GCLLS +LLY
Sbjct  89   SELIALLVQLTVITLTLAISKEERPIWPVRLWITGYDVGCLLSLMLLY  136



>gb|KHN23825.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=464

 Score =   154 bits (388),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R  L       S    +S   T   V +      R  P  FMVR+AMRISRARWF F
Sbjct  1    MNSRCFLVHPQQEYSMVPFSSNSATEDRVASARNRPPRVTPPSFMVRMAMRISRARWFTF  60

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TWMM+E + L +QI  T +TLA+SK ERP+WPMRIW
Sbjct  61   LRRVFHYQNGSR-SNLGSNPFNSSTWMMLEFIALILQITITTFTLAISKRERPIWPMRIW  119

Query  674  VSGYAFGCLLSXLLLY  721
            +SGY  GC+L+ LLLY
Sbjct  120  ISGYDIGCVLNLLLLY  135



>ref|XP_004491529.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase At1g63170-like 
[Cicer arietinum]
Length=333

 Score =   151 bits (381),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 98/136 (72%), Gaps = 10/136 (7%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R LL ++S           ED+M S  +RT+ Q  + P  F VR+AMRISR+RWF F
Sbjct  1    MNSRCLLNSNSI-------VQXEDSMAS--SRTRPQRASSPPSFSVRMAMRISRSRWFTF  51

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRR+FHYQNGS  S+LGSNPFNS TWMM+E + L  QI+ + +TLA+SK E+PVWPMR+W
Sbjct  52   LRRIFHYQNGSR-SNLGSNPFNSSTWMMLEFIALISQIVISTFTLAISKMEKPVWPMRVW  110

Query  674  VSGYAFGCLLSXLLLY  721
            + GY  GC+L+ LL+Y
Sbjct  111  ICGYDIGCVLNLLLVY  126



>ref|XP_011038870.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Populus 
euphratica]
Length=338

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN R     +SFC S  AA+   +   +V  R +S +RT  S  +VR AMRISRARWF F
Sbjct  1    MNTRYPFPVNSFCGSSPAASLAGEEHGTVSLRNRS-ARTPTSSLLVRTAMRISRARWFTF  59

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFH QNGS  S+LGSNPFNS TWMM+E V L +QI  T +TLA+SK E+PVWP+RIW
Sbjct  60   LRRVFHCQNGSR-SNLGSNPFNSSTWMMLEFVALVIQISITMFTLAISKAEKPVWPVRIW  118

Query  674  VSGYAFGCLLSXLLLY  721
            + GY  G +LS LLLY
Sbjct  119  IIGYNIGVVLSLLLLY  134



>ref|XP_011038869.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Populus 
euphratica]
Length=341

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN R     +SFC S  AA+   +   +V  R +S +RT  S  +VR AMRISRARWF F
Sbjct  1    MNTRYPFPVNSFCGSSPAASLAGEEHGTVSLRNRS-ARTPTSSLLVRTAMRISRARWFTF  59

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFH QNGS  S+LGSNPFNS TWMM+E V L +QI  T +TLA+SK E+PVWP+RIW
Sbjct  60   LRRVFHCQNGSR-SNLGSNPFNSSTWMMLEFVALVIQISITMFTLAISKAEKPVWPVRIW  118

Query  674  VSGYAFGCLLSXLLLY  721
            + GY  G +LS LLLY
Sbjct  119  IIGYNIGVVLSLLLLY  134



>dbj|BAB09279.1| unnamed protein product [Arabidopsis thaliana]
Length=320

 Score =   149 bits (377),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            S VA    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWM
Sbjct  35   SHVAAANGQERS-PSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWM  92

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            M E + L VQ+    +TLA+SKEERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  93   MSELIALLVQLTVITFTLAISKEERPIWPVRLWITGYDVGCLLNLMLLY  141



>gb|KHN31684.1| hypothetical protein glysoja_022549 [Glycine soja]
Length=174

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 4/113 (4%)
 Frame = +2

Query  380  EDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFN  559
            E +M SV     S S      FM RVAMRISR+RWF FLRRVFHYQNG   SDLGSNPFN
Sbjct  11   EHSMASV---QNSHSPASSPSFMTRVAMRISRSRWFTFLRRVFHYQNG-PRSDLGSNPFN  66

Query  560  SLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLL  718
            S TWMM+E + L VQI  T +TLA+SK E+P+WPMR+W++GY  GC+L+ LLL
Sbjct  67   SSTWMMLELIALLVQITSTTFTLAISKSEKPIWPMRVWIAGYDIGCVLNLLLL  119



>ref|XP_010450483.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Camelina 
sativa]
Length=343

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            +T   D      A    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGS
Sbjct  29   STPRGDNSHVTTAGNNDQERSPPSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGS  87

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NPFNS  WMM E V L VQ+     TLA+SKEERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  88   NPFNSSVWMMSELVALLVQLTVITLTLAISKEERPIWPVRLWITGYDVGCLLNLMLLY  145



>ref|XP_010443238.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Camelina sativa]
Length=312

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            +T   D      A    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGS
Sbjct  29   STPRGDNSHVTTAGNNDQERSPPSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGS  87

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NPFNS  WMM E V L VQ+     TLA+SK+ERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  88   NPFNSSAWMMSELVALLVQLTVITLTLAISKDERPIWPVRLWITGYDVGCLLNLMLLY  145



>ref|XP_010483065.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=345

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            +T   D      A    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGS
Sbjct  29   STPRGDNSHVTTAGNNDQERSPPSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGS  87

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NPFNS  WMM E V L VQ+     TLA+SKEERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  88   NPFNSSAWMMSELVALLVQLTVITLTLAISKEERPIWPVRLWITGYDVGCLLNLMLLY  145



>ref|NP_568834.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_851197.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AAM62485.1| unknown [Arabidopsis thaliana]
 gb|AED96704.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AED96705.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=343

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            S VA    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWM
Sbjct  35   SHVAAANGQERS-PSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWM  92

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            M E + L VQ+    +TLA+SKEERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  93   MSELIALLVQLTVITFTLAISKEERPIWPVRLWITGYDVGCLLNLMLLY  141



>ref|XP_008353104.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Malus 
domestica]
Length=342

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN+R L + +  C S ++A S      G+D     + RT+S SR  PS F++R+AMRISR
Sbjct  1    MNSRYLFSPEPMCQSASSAVSFSSNSLGDDRGAVSLVRTRS-SRAPPSSFLMRMAMRISR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  S+LGSNPFN+ TWMM+E + L VQI  T  TLAVSK+ERPV
Sbjct  60   ARWFXFLRRVFHYQNGSR-SNLGSNPFNNSTWMMLEFMALVVQIGVTTITLAVSKKERPV  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GC+L+  +L+
Sbjct  119  WPMRIWIIGYDIGCVLNLFVLF  140



>ref|XP_010443237.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Camelina sativa]
Length=343

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            +T   D      A    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGS
Sbjct  29   STPRGDNSHVTTAGNNDQERSPPSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGS  87

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NPFNS  WMM E V L VQ+     TLA+SK+ERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  88   NPFNSSAWMMSELVALLVQLTVITLTLAISKDERPIWPVRLWITGYDVGCLLNLMLLY  145



>ref|XP_010061429.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Eucalyptus 
grandis]
 gb|KCW68370.1| hypothetical protein EUGRSUZ_F02028 [Eucalyptus grandis]
 gb|KCW68371.1| hypothetical protein EUGRSUZ_F02028 [Eucalyptus grandis]
Length=335

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            +V+       R  PS F+VR+AMRISRARWF FLRRVFHYQNGS  SDLGSNPFNS TWM
Sbjct  25   AVIGSRNRAPRVPPS-FLVRMAMRISRARWFTFLRRVFHYQNGSR-SDLGSNPFNSSTWM  82

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            ++E   L VQI  T++TLA+SK E+PVWPMRIW+ GY  GC+LS LLLY
Sbjct  83   VLELTALMVQISITSFTLAISKSEKPVWPMRIWIMGYDIGCMLSVLLLY  131



>ref|XP_002864420.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40679.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            S  A   +Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWM
Sbjct  35   SHAADGNAQERS-PSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWM  92

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            M E + L VQ+    +TLA+SKEERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  93   MSELIALLVQLTVITFTLAISKEERPIWPVRLWITGYDVGCLLNLMLLY  141



>ref|XP_004294914.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = +2

Query  383  DTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNS  562
            +  M+V  R++S SR  PS F++R+AMRISRARWF FLRRVFHYQNGS  SDLGSNPFNS
Sbjct  17   ENQMAVNGRSRS-SRPLPSTFLMRMAMRISRARWFTFLRRVFHYQNGSR-SDLGSNPFNS  74

Query  563  LTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             TWM +E + L VQI  T  TLAVS+ E+PVWPMRIW+ GY  GC+L+ LLL+
Sbjct  75   TTWMTLEFIALVVQISITTITLAVSEREKPVWPMRIWIVGYDIGCILNLLLLF  127



>ref|XP_006280769.1| hypothetical protein CARUB_v10026740mg [Capsella rubella]
 gb|EOA13667.1| hypothetical protein CARUB_v10026740mg [Capsella rubella]
Length=338

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  398  VVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMM  577
            V +    Q R+ PS F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM
Sbjct  37   VTSGNNDQERS-PSSFYIRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMM  94

Query  578  MECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             E V L +Q+    +TLA+SKEERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  95   SELVALLLQLTVITFTLAISKEERPIWPVRLWITGYDVGCLLNLMLLY  142



>gb|KHG22760.1| hypothetical protein F383_06014 [Gossypium arboreum]
Length=339

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 93/141 (66%), Gaps = 7/141 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRA  478
            MN R     DS CNS  AA      +GE+  ++         R   S  ++R+ MR+SRA
Sbjct  1    MNTRHSFQPDSLCNSSTAAPFSSNPTGEEDGVAA-GSRSRSPRAASSSILIRMVMRMSRA  59

Query  479  RWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVW  658
            RWF FLRRVFHYQNGS  SDLGSNPFNS TWMM+E + L +QI    +TLA++K+E+PVW
Sbjct  60   RWFTFLRRVFHYQNGSR-SDLGSNPFNSSTWMMLEFLALVIQISVITFTLAIAKKEKPVW  118

Query  659  PMRIWVSGYAFGCLLSXLLLY  721
            PMRIW+ GY  GC LS LLLY
Sbjct  119  PMRIWIVGYDIGCALSLLLLY  139



>ref|XP_009347513.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
 ref|XP_009347523.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Pyrus 
x bretschneideri]
Length=342

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 101/142 (71%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN+R L + +  C S ++A S       +D     + RT+S SR  PS F++R+AMRISR
Sbjct  1    MNSRYLFSPEPMCQSASSAVSFSSNSLADDHGAVSLVRTRS-SRAPPSSFLMRMAMRISR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            +RWF FLRRVFHYQNGS  S+LGSNPFN+ TWMM+E + L VQI  T  TLAVSK+ERPV
Sbjct  60   SRWFTFLRRVFHYQNGSR-SNLGSNPFNNGTWMMLEFMALVVQIGVTTITLAVSKKERPV  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GC+L+  +L+
Sbjct  119  WPMRIWIIGYDIGCILNLFVLF  140



>emb|CDX94309.1| BnaC01g18750D [Brassica napus]
Length=342

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  434  PSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMF  613
            P+PF++R+AMR+SRARWFIFLRRVFHYQNGS  SDLG+NPF S TWM+ E + L VQI  
Sbjct  48   PTPFLIRLAMRVSRARWFIFLRRVFHYQNGSR-SDLGANPFESTTWMISELIALLVQITV  106

Query  614  TAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              +TLA+SK ERP+WP+R+W++GY  GCLLS ++LY
Sbjct  107  ITFTLALSKNERPIWPVRLWITGYNVGCLLSLMILY  142



>emb|CDY36773.1| BnaA03g11130D [Brassica napus]
Length=325

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  410  TQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECV  589
            T + +  Q   F +R AMR+SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM E +
Sbjct  29   THAPASVQERSFYLRFAMRVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMSELI  87

Query  590  TLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             L VQ+     TLA+SKEERPVWP+R+W++GY  GCLLS +LLY
Sbjct  88   ALLVQLTVITLTLAISKEERPVWPVRLWITGYDVGCLLSLMLLY  131



>ref|XP_010539334.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
 ref|XP_010539335.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
 ref|XP_010539336.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
 ref|XP_010539339.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Tarenaya 
hassleriana]
Length=342

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 4/116 (3%)
 Frame = +2

Query  374  SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNP  553
            S   T M   A  + +S   PS F++R+A+R+SRARWFIFLRRVFHYQNGS  SDLGSNP
Sbjct  31   SDTTTRMEDAANARERS---PSSFLIRLAVRVSRARWFIFLRRVFHYQNGSR-SDLGSNP  86

Query  554  FNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            FNS TWMM E + L VQI    +TLA SK+ERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  87   FNSSTWMMSELIALLVQITVITFTLAASKKERPIWPVRLWITGYDVGCLLNLMLLY  142



>ref|XP_009132344.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Brassica 
rapa]
Length=325

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  410  TQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECV  589
            T + +  Q   F +R AMR+SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM E +
Sbjct  29   THAPASVQERSFYLRFAMRVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMSELI  87

Query  590  TLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             L VQ+     TLA+SKEERPVWP+R+W++GY  GCLLS +LLY
Sbjct  88   ALLVQLTVITLTLAISKEERPVWPVRLWITGYDVGCLLSLMLLY  131



>emb|CDY11965.1| BnaC03g13910D [Brassica napus]
Length=325

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +2

Query  410  TQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECV  589
            T + +  Q   F +R AMR+SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM E +
Sbjct  29   THAPASVQERSFYLRFAMRVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMSELI  87

Query  590  TLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             L VQ+     TLA+SKEERPVWP+R+W++GY  GCLLS +LLY
Sbjct  88   ALLVQLTVITLTLAISKEERPVWPVRLWITGYDVGCLLSLMLLY  131



>emb|CDY61181.1| BnaCnng37430D [Brassica napus]
Length=329

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  434  PSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMF  613
            P+ F +R+AMR+SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM E + L +Q+  
Sbjct  45   PTSFYLRLAMRVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMSELIALFIQLTV  103

Query  614  TAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              +TLA+SK+ERP+WP+R+W++GY  GCLLS +LLY
Sbjct  104  ITFTLAISKDERPIWPVRLWITGYDVGCLLSLMLLY  139



>ref|XP_006413164.1| hypothetical protein EUTSA_v10025652mg [Eutrema salsugineum]
 gb|ESQ54617.1| hypothetical protein EUTSA_v10025652mg [Eutrema salsugineum]
Length=338

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = +2

Query  365  AATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLG  544
            + T  ++  M+ V+ T+  S   P  F+ R+AMR+SRARWFIFLRRVFHYQNGS  SDLG
Sbjct  27   STTRDDNNHMATVSNTRDNS---PLSFLTRLAMRVSRARWFIFLRRVFHYQNGSR-SDLG  82

Query  545  SNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +NPF+S+TWM+ E + L VQI     TLA+SK ERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  83   TNPFDSVTWMISELIALLVQITVITITLALSKNERPIWPVRLWITGYNVGCLLNLMLLY  141



>ref|XP_006602119.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Glycine 
max]
Length=328

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            S+ +   S S      FM RVAMRISR+RWF FLRRVFHYQNG   SDLGSNPFNS TWM
Sbjct  13   SMASAQNSHSPASSPSFMTRVAMRISRSRWFTFLRRVFHYQNG-PRSDLGSNPFNSSTWM  71

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLL  718
            M+E + L VQI  T +TLA+SK E+P+WPMR+W++GY  GC+L+ LLL
Sbjct  72   MLELIALLVQITSTTFTLAISKSEKPIWPMRVWIAGYDIGCVLNLLLL  119



>ref|XP_009120112.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Brassica 
rapa]
Length=329

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  434  PSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMF  613
            P+ F +R+AM++SRARWFIFLRRVFHYQNGST SDLGSNPFNS TWMM E + L +Q+  
Sbjct  45   PTSFYLRLAMKVSRARWFIFLRRVFHYQNGST-SDLGSNPFNSSTWMMSELIALFIQLTV  103

Query  614  TAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              +TLA+SK+E P+WP+R+W++GY  GCLLS +LLY
Sbjct  104  ITFTLAISKDESPIWPVRLWITGYDIGCLLSLMLLY  139



>ref|XP_009120113.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X2 [Brassica 
rapa]
Length=328

 Score =   143 bits (361),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  434  PSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMF  613
            P+ F +R+AM++SRARWFIFLRRVFHYQNGST SDLGSNPFNS TWMM E + L +Q+  
Sbjct  45   PTSFYLRLAMKVSRARWFIFLRRVFHYQNGST-SDLGSNPFNSSTWMMSELIALFIQLTV  103

Query  614  TAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              +TLA+SK+E P+WP+R+W++GY  GCLLS +LLY
Sbjct  104  ITFTLAISKDESPIWPVRLWITGYDIGCLLSLMLLY  139



>ref|XP_011044923.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X2 [Populus euphratica]
Length=343

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +2

Query  425  RTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQ  604
            R  PS   VR AMRISRARWF FLRRVFHYQNGS  S+LGSNPFNS +WMM+E V L +Q
Sbjct  42   RVAPSSLFVRTAMRISRARWFTFLRRVFHYQNGSR-SNLGSNPFNSSSWMMLEFVALLLQ  100

Query  605  IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            I  T +TLA+SK E PVWP+RIW++GY  GC+LS LLLY
Sbjct  101  ICITTFTLAISKAENPVWPVRIWITGYNIGCVLSLLLLY  139



>ref|XP_011044922.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like isoform 
X1 [Populus euphratica]
Length=346

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +2

Query  425  RTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQ  604
            R  PS   VR AMRISRARWF FLRRVFHYQNGS  S+LGSNPFNS +WMM+E V L +Q
Sbjct  42   RVAPSSLFVRTAMRISRARWFTFLRRVFHYQNGSR-SNLGSNPFNSSSWMMLEFVALLLQ  100

Query  605  IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            I  T +TLA+SK E PVWP+RIW++GY  GC+LS LLLY
Sbjct  101  ICITTFTLAISKAENPVWPVRIWITGYNIGCVLSLLLLY  139



>ref|XP_006452653.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
 gb|ESR65893.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
Length=296

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 95/142 (67%), Gaps = 11/142 (8%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSG------AAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R    +DS CNS       ++  + ED M    AR +  +R     F++R AMRISR
Sbjct  1    MNTRYSFPSDSLCNSSTTVPYSSSPPATEDRM----ARNRPAARAGAPSFLIRTAMRISR  56

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQNGS  SDLGSNPFNS TWM +E + L VQI    +TL++SK+E P+
Sbjct  57   ARWFNFLRRVFHYQNGSR-SDLGSNPFNSSTWMTLELLALLVQISIITFTLSISKKESPI  115

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMRIW+ GY  GCLLS LLLY
Sbjct  116  WPMRIWIVGYDIGCLLSLLLLY  137



>ref|XP_006284075.1| hypothetical protein CARUB_v10005205mg [Capsella rubella]
 gb|EOA16973.1| hypothetical protein CARUB_v10005205mg [Capsella rubella]
Length=334

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 2/105 (2%)
 Frame = +2

Query  410  TQSQSRTQPSP-FMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMEC  586
            T    ++ PSP F++R+AMR+SRARWFIFLRRVFHYQN S  SDLG+NPFNS+TWM+ E 
Sbjct  34   THMAPQSSPSPSFLMRLAMRVSRARWFIFLRRVFHYQNASR-SDLGTNPFNSVTWMISEL  92

Query  587  VTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            + L VQI     TLA+SK+ERPVWPMR+W++GY  GCLL+ +LLY
Sbjct  93   IALLVQITVITSTLALSKKERPVWPMRLWITGYNVGCLLNLMLLY  137



>ref|XP_009142488.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
 ref|XP_009142496.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
 ref|XP_009142504.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brassica rapa]
Length=343

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 87/116 (75%), Gaps = 4/116 (3%)
 Frame = +2

Query  374  SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNP  553
              ++T MS  +  +  S   P+ F++R+AMR+SRARWFIFLRRVFHYQNGS  SDLG+NP
Sbjct  32   DDDNTRMSPASNARVNS---PTSFLIRLAMRVSRARWFIFLRRVFHYQNGSR-SDLGANP  87

Query  554  FNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            F S TWM+ E + L VQI    +TLA+SK ERP+WP+R+W++GY  GCLLS ++LY
Sbjct  88   FESTTWMISELIALLVQITVITFTLALSKNERPIWPVRLWITGYNVGCLLSLMILY  143



>ref|XP_002316784.2| hypothetical protein POPTR_0011s09710g [Populus trichocarpa]
 gb|EEE97396.2| hypothetical protein POPTR_0011s09710g [Populus trichocarpa]
Length=346

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/99 (69%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +2

Query  425  RTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQ  604
            R  PS   VR AMRISRARWF FLRRVFHYQNGS+ S+LGSNPFNS +WMM+E V L +Q
Sbjct  42   RLAPSSLFVRAAMRISRARWFTFLRRVFHYQNGSS-SNLGSNPFNSSSWMMLEFVALLLQ  100

Query  605  IMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            I  T +TLA+SK E PVWP+RIW+ GY  GC+LS LLLY
Sbjct  101  ICITTFTLAISKAENPVWPVRIWIIGYNIGCVLSLLLLY  139



>emb|CDY17377.1| BnaA10g10110D [Brassica napus]
Length=329

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 80/96 (83%), Gaps = 1/96 (1%)
 Frame = +2

Query  434  PSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMF  613
            P+ F +R+AM++SRARWFIFLRRVFHYQNGS  SDLGSNPFNS TWMM E + L +Q+  
Sbjct  45   PTSFYLRLAMKVSRARWFIFLRRVFHYQNGSR-SDLGSNPFNSSTWMMSELIALFIQLTV  103

Query  614  TAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              +TLA+SK+E+P+WP+R+W++GY  GCLLS +LLY
Sbjct  104  ITFTLAISKDEKPIWPVRLWITGYDVGCLLSLMLLY  139



>emb|CDX89323.1| BnaA01g15700D [Brassica napus]
Length=343

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +2

Query  380  EDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFN  559
            ++T MS  + T+  S   P+ F++R+AMR+SRARWFIFLRRVFHYQNGS  SDLG+NPF 
Sbjct  34   DNTRMSPASNTRVNS---PTSFLIRLAMRVSRARWFIFLRRVFHYQNGSR-SDLGANPFE  89

Query  560  SLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            S TWM+ E + L VQI     TLA+SK ERP+WP+R+W++GY  GCLLS ++LY
Sbjct  90   STTWMISELIALLVQITVITSTLALSKNERPIWPVRLWITGYNVGCLLSLMILY  143



>ref|XP_006586152.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Glycine 
max]
 gb|KHN11170.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=329

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = +2

Query  380  EDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFN  559
            E +M S  A+  S        FM RVAMRISR+RWF FLRRVFHYQNG   S+LGSNPFN
Sbjct  11   EHSMAS--AQQNSNPHASSPSFMTRVAMRISRSRWFTFLRRVFHYQNG-PRSNLGSNPFN  67

Query  560  SLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLL  718
            S TWMM+E + L VQI  T +TLA+SK E+P+WPMR+W++GY  GC+L+ LLL
Sbjct  68   SSTWMMLELIALLVQIASTTFTLAISKSEKPIWPMRVWIAGYDIGCVLNLLLL  120



>ref|XP_006452654.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
 gb|ESR65894.1| hypothetical protein CICLE_v10008862mg [Citrus clementina]
Length=336

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAA--TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWF  487
            MN R    +DS CNS      +S        +AR +  +R     F++R AMRISRARWF
Sbjct  1    MNTRYSFPSDSLCNSSTTVPYSSSPPATEDRMARNRPAARAGAPSFLIRTAMRISRARWF  60

Query  488  IFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMR  667
             FLRRVFHYQNGS  SDLGSNPFNS TWM +E + L VQI    +TL++SK+E P+WPMR
Sbjct  61   NFLRRVFHYQNGSR-SDLGSNPFNSSTWMTLELLALLVQISIITFTLSISKKESPIWPMR  119

Query  668  IWVSGYAFGCLLSXLLLY  721
            IW+ GY  GCLLS LLLY
Sbjct  120  IWIVGYDIGCLLSLLLLY  137



>ref|XP_006474826.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Citrus 
sinensis]
Length=336

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAA--TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWF  487
            MN R    +DS CNS      +S        +AR +  +R     F++R AMRISRARWF
Sbjct  1    MNTRYSFPSDSLCNSSTTVPYSSSPPATEDRMARNRPAARAGAPSFLIRTAMRISRARWF  60

Query  488  IFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMR  667
             FLRRVFHYQNGS  SDLGSNPFNS TWM +E + L VQI    +TL++SK+E P+WPMR
Sbjct  61   NFLRRVFHYQNGSR-SDLGSNPFNSSTWMALELLALLVQISIITFTLSISKKESPIWPMR  119

Query  668  IWVSGYAFGCLLSXLLLY  721
            IW+ GY  GCLLS LLLY
Sbjct  120  IWIVGYDIGCLLSLLLLY  137



>gb|KDO59201.1| hypothetical protein CISIN_1g019720mg [Citrus sinensis]
Length=336

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAA--TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWF  487
            MN R    +DS CNS      +S        +AR +  +R     F++R AMRISRARWF
Sbjct  1    MNTRYSFPSDSLCNSSTTVPYSSSPPATEDRMARNRPAARAGAPSFLIRTAMRISRARWF  60

Query  488  IFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMR  667
             FLRRVFHYQNGS  SDLGSNPFNS TWM +E + L VQI    +TL++SK+E P+WPMR
Sbjct  61   NFLRRVFHYQNGSR-SDLGSNPFNSSTWMTLELLALLVQISIITFTLSISKKESPIWPMR  119

Query  668  IWVSGYAFGCLLSXLLLY  721
            IW+ GY  GCLLS LLLY
Sbjct  120  IWIVGYDIGCLLSLLLLY  137



>gb|KEH28464.1| E3 ubiquitin protein ligase RIE1-like protein, putative [Medicago 
truncatula]
Length=328

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R LL ++S   S + + + E+ ++S  +R + Q  + PS F VR+AMRISR+RWF  
Sbjct  1    MNSRCLLNSNSIVQSSSNSETREERVVS--SRNRPQHASSPS-FSVRMAMRISRSRWFTL  57

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TW+MME + L +QI+ + +TL +SK E+PVWPMRIW
Sbjct  58   LRRVFHYQNGSR-SNLGSNPFNSSTWLMMEFIALIIQIIISTFTLVISKREKPVWPMRIW  116

Query  674  VSGYAFGCLLSXLLLY  721
            +SGY  GC+L+ L +Y
Sbjct  117  ISGYDIGCVLNLLTVY  132



>ref|XP_007140118.1| hypothetical protein PHAVU_008G085400g [Phaseolus vulgaris]
 gb|ESW12112.1| hypothetical protein PHAVU_008G085400g [Phaseolus vulgaris]
Length=327

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +2

Query  362  AAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDL  541
            A+  S   +  S+     S  +     FM RVAMR+SR+RWF FLRRVFHYQNG   SDL
Sbjct  2    ASFPSNSASEHSMAGAQNSHPQASSPSFMTRVAMRVSRSRWFTFLRRVFHYQNG-PRSDL  60

Query  542  GSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLL  718
            GSNPFNS TWMM+E + L +QI  T  TLA+SK E+P+WPMR+W++GY  GC+L+ LLL
Sbjct  61   GSNPFNSSTWMMLELIALVLQITITTLTLAISKSEKPIWPMRVWLAGYDIGCVLNLLLL  119



>ref|XP_003617871.1| RING finger protein [Medicago truncatula]
 gb|AET00830.1| E3 ubiquitin protein ligase RIE1-like protein, putative [Medicago 
truncatula]
Length=340

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R LL ++S   S + + + E+ ++S  +R + Q  + PS F VR+AMRISR+RWF  
Sbjct  1    MNSRCLLNSNSIVQSSSNSETREERVVS--SRNRPQHASSPS-FSVRMAMRISRSRWFTL  57

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TW+MME + L +QI+ + +TL +SK E+PVWPMRIW
Sbjct  58   LRRVFHYQNGSR-SNLGSNPFNSSTWLMMEFIALIIQIIISTFTLVISKREKPVWPMRIW  116

Query  674  VSGYAFGCLLSXLLLY  721
            +SGY  GC+L+ L +Y
Sbjct  117  ISGYDIGCVLNLLTVY  132



>ref|XP_003617870.1| RING finger protein [Medicago truncatula]
 gb|AET00829.1| E3 ubiquitin protein ligase RIE1-like protein, putative [Medicago 
truncatula]
Length=337

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 101/136 (74%), Gaps = 4/136 (3%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN+R LL ++S   S + + + E+ ++S  +R + Q  + PS F VR+AMRISR+RWF  
Sbjct  1    MNSRCLLNSNSIVQSSSNSETREERVVS--SRNRPQHASSPS-FSVRMAMRISRSRWFTL  57

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TW+MME + L +QI+ + +TL +SK E+PVWPMRIW
Sbjct  58   LRRVFHYQNGSR-SNLGSNPFNSSTWLMMEFIALIIQIIISTFTLVISKREKPVWPMRIW  116

Query  674  VSGYAFGCLLSXLLLY  721
            +SGY  GC+L+ L +Y
Sbjct  117  ISGYDIGCVLNLLTVY  132



>ref|XP_009367256.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Pyrus x bretschneideri]
Length=341

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            + V+  +++S   P  F++R+AMRISRARWF FLRRV+HYQNGS  S+LGSNPF++ TWM
Sbjct  32   AAVSLVRTRSSRAPPSFLMRMAMRISRARWFTFLRRVYHYQNGSR-SNLGSNPFDNSTWM  90

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            M+E + L VQI  T  TLAVSKEERPVWPMRIW+ GY  GC+L+ L+L+
Sbjct  91   MLEFMALVVQIGVTTITLAVSKEERPVWPMRIWIVGYDIGCVLNMLVLF  139



>ref|XP_008384601.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Malus 
domestica]
Length=334

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  377  GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPF  556
            G+D     + RT+S SR  P  F++R+AMRISRARWF FLRRVFHYQNGS  S+LGSNPF
Sbjct  28   GDDGAAVSLVRTRS-SRA-PXSFLMRMAMRISRARWFTFLRRVFHYQNGSR-SNLGSNPF  84

Query  557  NSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            ++ TWMM+E + L VQI  T  TLAVSK+ERPVWPMR+W+ GY  GC+L  L+L+
Sbjct  85   DNSTWMMLEFMALVVQIGVTTITLAVSKKERPVWPMRVWIVGYDIGCVLXMLVLF  139



>ref|XP_010438729.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=335

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 6/124 (5%)
 Frame = +2

Query  365  AATSGEDTMMSVVARTQSQSRTQP-----SPFMVRVAMRISRARWFIFLRRVFHYQNGST  529
            + T    +++         +R  P     S F++R+AMR+SRARWF FLRRVFHYQN S 
Sbjct  16   SITVSSSSLLDSTPHEDDNTRMAPESSPSSSFLMRLAMRVSRARWFFFLRRVFHYQNASR  75

Query  530  TSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSX  709
             SDLG+NPFNS+TWM+ E + L VQI    +TLA+SK+ERPVWPMR+W++GY  GCLL+ 
Sbjct  76   -SDLGTNPFNSVTWMISELIALLVQITVITFTLALSKKERPVWPMRLWITGYNVGCLLNL  134

Query  710  LLLY  721
            +LLY
Sbjct  135  MLLY  138



>ref|XP_008384599.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Malus 
domestica]
 ref|XP_008384600.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 isoform X1 [Malus 
domestica]
Length=341

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 3/115 (3%)
 Frame = +2

Query  377  GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPF  556
            G+D     + RT+S SR  P  F++R+AMRISRARWF FLRRVFHYQNGS  S+LGSNPF
Sbjct  28   GDDGAAVSLVRTRS-SRA-PXSFLMRMAMRISRARWFTFLRRVFHYQNGSR-SNLGSNPF  84

Query  557  NSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            ++ TWMM+E + L VQI  T  TLAVSK+ERPVWPMR+W+ GY  GC+L  L+L+
Sbjct  85   DNSTWMMLEFMALVVQIGVTTITLAVSKKERPVWPMRVWIVGYDIGCVLXMLVLF  139



>ref|XP_004498153.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cicer 
arietinum]
Length=345

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 92/130 (71%), Gaps = 10/130 (8%)
 Frame = +2

Query  344  SFCNSGAAATSGEDTM-----MSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVF  508
            SFC++ A    GE+ M     M     T SQS++QPS F  RVAMRISR+R F FLRRVF
Sbjct  19   SFCSNYAI---GENNMAIVQNMPPPQATLSQSQSQPS-FFTRVAMRISRSRCFNFLRRVF  74

Query  509  HYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYA  688
            HYQNG   S+LGSNPFNS TWMM+E + L VQI  T +TL +SK E+PVWPMR+W+ GY 
Sbjct  75   HYQNG-PRSNLGSNPFNSNTWMMLELIALLVQITSTTFTLVISKSEKPVWPMRVWIVGYD  133

Query  689  FGCLLSXLLL  718
             GC+L+ LLL
Sbjct  134  IGCVLNLLLL  143



>ref|XP_002867557.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43816.1| protein binding protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 78/95 (82%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F++R+AMR+SRA WFIFLRRVFHYQN S  SDLG+NPFNS+TWM+ E + L VQI   
Sbjct  44   SSFLMRLAMRVSRATWFIFLRRVFHYQNASR-SDLGTNPFNSITWMISELIALLVQITVI  102

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              TLA+SK+ERPVWPMR+W++GY  GCLL+ +LLY
Sbjct  103  TSTLALSKKERPVWPMRLWITGYNVGCLLNLMLLY  137



>ref|XP_010545287.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Tarenaya hassleriana]
 ref|XP_010545288.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Tarenaya hassleriana]
Length=335

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 2/105 (2%)
 Frame = +2

Query  410  TQSQSRTQPSP-FMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMEC  586
            T+   R +P P F++R+AM++SRARWFIF RRVFHYQNGS   DLGSNPF+S TWM  E 
Sbjct  34   TRMSGRERPPPSFLIRMAMKVSRARWFIFSRRVFHYQNGSR-PDLGSNPFDSSTWMTTEL  92

Query  587  VTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            + L +QI    +TLAVS +ERP+WP+R+W++GY  GCLL+ +LLY
Sbjct  93   IALVIQITLITFTLAVSNKERPIWPVRLWITGYDVGCLLNLMLLY  137



>ref|XP_008463025.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X1 [Cucumis 
melo]
Length=347

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 87/118 (74%), Gaps = 2/118 (2%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            + SGED  M+   R ++     PS F V++AM+ISRARWFIFLRRVFHYQNGS  SDLG 
Sbjct  25   SVSGEDGAMADDIRNEASDSVPPS-FWVKMAMKISRARWFIFLRRVFHYQNGSR-SDLGP  82

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NPFNS  WM ME V L  Q++ + +TLA+S+ E+PVWPMR+W+ GY  GC+LS LLLY
Sbjct  83   NPFNSGLWMAMELVALLFQLIISVFTLAISQAEKPVWPMRLWIGGYDLGCVLSLLLLY  140



>gb|KGN44388.1| hypothetical protein Csa_7G278230 [Cucumis sativus]
Length=347

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 2/118 (2%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            + S ED  M+   R ++     PS F V++AM+ISRARWFIFLRRVFHYQNGS  SDLG 
Sbjct  25   SVSEEDGAMADDIRNEASDSVPPS-FWVKMAMKISRARWFIFLRRVFHYQNGSR-SDLGP  82

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NPFNS +WM ME V L  Q++ +A+TLA+S+ E+PVWPMR+W+ GY  GC+LS LLLY
Sbjct  83   NPFNSGSWMAMELVALLFQLIISAFTLAISQAEKPVWPMRLWIGGYDLGCVLSLLLLY  140



>ref|NP_194388.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 ref|NP_001190848.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAE99787.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85222.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
 gb|AEE85223.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=335

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 8/113 (7%)
 Frame = +2

Query  404  ARTQSQSRTQPSP-------FMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNS  562
            A TQ    T  +P       F +R+AMR+SRARWFIFLRRVFHYQN S  SDLG+NPFNS
Sbjct  26   ASTQLDDNTHTAPESSPSSSFFMRLAMRVSRARWFIFLRRVFHYQNASR-SDLGTNPFNS  84

Query  563  LTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            + WM+ E + L +QI     TLA+SK ERPVWPMR+W++GY  GCLL+ +LLY
Sbjct  85   IAWMVSELIALLLQITVITSTLALSKNERPVWPMRLWITGYNVGCLLNLMLLY  137



>emb|CAB43854.1| putative protein [Arabidopsis thaliana]
 emb|CAB79513.1| putative protein [Arabidopsis thaliana]
Length=464

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 8/113 (7%)
 Frame = +2

Query  404  ARTQSQSRTQPSP-------FMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNS  562
            A TQ    T  +P       F +R+AMR+SRARWFIFLRRVFHYQN S  SDLG+NPFNS
Sbjct  155  ASTQLDDNTHTAPESSPSSSFFMRLAMRVSRARWFIFLRRVFHYQNASR-SDLGTNPFNS  213

Query  563  LTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            + WM+ E + L +QI     TLA+SK ERPVWPMR+W++GY  GCLL+ +LLY
Sbjct  214  IAWMVSELIALLLQITVITSTLALSKNERPVWPMRLWITGYNVGCLLNLMLLY  266



>ref|XP_010433472.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Camelina 
sativa]
Length=336

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = +2

Query  347  FCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGS  526
            F +S    T  +D   + +A   S S    S F++R+AMR+SRARWF FLRRVFHYQN S
Sbjct  20   FSSSSLDPTPHDDDDNTRMAPESSPS----SSFLMRLAMRVSRARWFFFLRRVFHYQNAS  75

Query  527  TTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLS  706
              SDLG+NPFNS+TWM+ E + L VQI     TLA+SK+ERPVWPMR+ ++GY  GCLL+
Sbjct  76   R-SDLGTNPFNSVTWMISELIALLVQITVITITLALSKKERPVWPMRLLITGYNVGCLLN  134

Query  707  XLLLY  721
             +LLY
Sbjct  135  LMLLY  139



>gb|KHN24407.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=263

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +2

Query  455  VAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAV  634
            +AMRISRA+WF FLRRVFHYQNGS+ S+LGSNPFNS TWMM+E +TL VQI    +TLA+
Sbjct  1    MAMRISRAKWFNFLRRVFHYQNGSS-SNLGSNPFNSSTWMMLEFITLVVQITIITFTLAI  59

Query  635  SKEERPVWPMRIWVSGYAFGCLLSXLLL  718
            S+ ERP+WP+RIW+SGY  GC+L+ LLL
Sbjct  60   SERERPIWPIRIWISGYDIGCILNFLLL  87



>ref|XP_010675979.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Beta vulgaris 
subsp. vulgaris]
Length=337

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = +2

Query  335  TTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHY  514
            ++ SF         GE     V        R   +  +VR+AMR+SRA+WF FLRRVFHY
Sbjct  10   SSSSFSRVEEREEDGEIAHGGVTHDQIRPVREFSTSMVVRMAMRVSRAKWFNFLRRVFHY  69

Query  515  QNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFG  694
            QNGS  S LG NPFNS  WMM+E VTL VQI  T  TL VSK ERPVWPMRIW+ GY FG
Sbjct  70   QNGSR-SHLGENPFNSYGWMMLEFVTLLVQICITMITLFVSKAERPVWPMRIWIVGYDFG  128

Query  695  CLLSXLLLY  721
            C++S  +L+
Sbjct  129  CVMSLFILF  137



>gb|EPS57981.1| hypothetical protein M569_16836, partial [Genlisea aurea]
Length=302

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +2

Query  434  PSP-FMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIM  610
            PSP F + +A+R+SR+RW+ F+R+VFHYQNGS  SDLG NPF+S  WM+ME + L+VQI 
Sbjct  1    PSPGFALGLAVRVSRSRWYRFMRKVFHYQNGSG-SDLGPNPFDSKNWMLMEFIALTVQIS  59

Query  611  FTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLYC  724
              AYTL +SK E+P WPMRIW SGYA  C LS LLLYC
Sbjct  60   LIAYTLMISKAEKPAWPMRIWSSGYAVACSLSILLLYC  97



>ref|XP_004149408.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Cucumis sativus]
Length=315

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 80/100 (80%), Gaps = 1/100 (1%)
 Frame = +2

Query  422  SRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSV  601
            S + P  F V++AM+ISRARWFIFLRRVFHYQNGS  SDLG NPFNS +WM ME V L  
Sbjct  10   SDSVPPSFWVKMAMKISRARWFIFLRRVFHYQNGSR-SDLGPNPFNSGSWMAMELVALLF  68

Query  602  QIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            Q++ +A+TLA+S+ E+PVWPMR+W+ GY  GC+LS LLLY
Sbjct  69   QLIISAFTLAISQAEKPVWPMRLWIGGYDLGCVLSLLLLY  108



>ref|XP_008463026.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Cucumis 
melo]
 ref|XP_008463027.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 isoform X2 [Cucumis 
melo]
Length=315

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +2

Query  422  SRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSV  601
            S + P  F V++AM+ISRARWFIFLRRVFHYQNGS  SDLG NPFNS  WM ME V L  
Sbjct  10   SDSVPPSFWVKMAMKISRARWFIFLRRVFHYQNGSR-SDLGPNPFNSGLWMAMELVALLF  68

Query  602  QIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            Q++ + +TLA+S+ E+PVWPMR+W+ GY  GC+LS LLLY
Sbjct  69   QLIISVFTLAISQAEKPVWPMRLWIGGYDLGCVLSLLLLY  108



>ref|XP_010245027.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Nelumbo 
nucifera]
Length=346

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 81/130 (62%), Gaps = 7/130 (5%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT------SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            MN R   T DS   SG   T      +GE    +        +RT  S F+VR AMRISR
Sbjct  1    MNTRYYFTPDSLYGSGIQVTFSSPSPAGEGHHAAAGGVRSGSTRTPSSSFLVRTAMRISR  60

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWF FLRRVFHYQN S  SDLGSNPFNS TW+ +E + L VQ+     TL++S EE+PV
Sbjct  61   ARWFNFLRRVFHYQNASR-SDLGSNPFNSGTWITLELLVLIVQLTLITITLSISTEEKPV  119

Query  656  WPMRIWVSGY  685
            WP+R+W+ GY
Sbjct  120  WPLRVWIVGY  129



>ref|XP_004160245.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like, partial [Cucumis 
sativus]
Length=299

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +2

Query  443  FMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAY  622
            F V++AM+ISRARWFIFLRRVFHYQNGS  SDLG NPFNS +WM ME V L  Q++ +A+
Sbjct  1    FWVKMAMKISRARWFIFLRRVFHYQNGSR-SDLGPNPFNSGSWMAMELVALLFQLIISAF  59

Query  623  TLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            TLA+S+ E+PVWPMR+W+ GY  GC+LS LLLY
Sbjct  60   TLAISQAEKPVWPMRLWIGGYDLGCVLSLLLLY  92



>ref|XP_008463028.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
melo]
 ref|XP_008463029.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
melo]
Length=338

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 93/142 (65%), Gaps = 8/142 (6%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATS------GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISR  475
            M N     + S CN GA  +        E+    V  R  + S    + F VR+AMR+SR
Sbjct  1    MVNSVYFVSGSSCNCGAGTSLFTPNSLVEEDGAGVDVRDDN-SVALSASFWVRLAMRVSR  59

Query  476  ARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPV  655
            ARWFIFLRRVFHYQNGS  S+LGS+PFNS +WM ME V + VQ++ T + LA+S+ E+P+
Sbjct  60   ARWFIFLRRVFHYQNGSR-SNLGSDPFNSSSWMAMELVAMVVQLVITVFVLAISEAEKPI  118

Query  656  WPMRIWVSGYAFGCLLSXLLLY  721
            WPMR+W+ GY  GC+LS LLLY
Sbjct  119  WPMRLWIVGYDLGCILSLLLLY  140



>ref|XP_004149419.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Cucumis 
sativus]
 gb|KGN44387.1| hypothetical protein Csa_7G278220 [Cucumis sativus]
Length=336

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 90/141 (64%), Gaps = 6/141 (4%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAAT-----SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRA  478
            M N     + S CN G   +     S  +    VV      S   P+ F VR+AMR+SRA
Sbjct  1    MINSVYFVSGSSCNCGGGTSLFIPNSLLEEDEPVVDVRDDNSVALPASFWVRLAMRVSRA  60

Query  479  RWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVW  658
            RWFIFLRRVFHYQNGS  S+LGS+PFNS +WM +E V +  Q+  T + LA+S+ E+P+W
Sbjct  61   RWFIFLRRVFHYQNGSR-SNLGSDPFNSSSWMAVELVAMVFQLSITVFVLAISEAEKPIW  119

Query  659  PMRIWVSGYAFGCLLSXLLLY  721
            PMR+W+ GY  GC+LS LLLY
Sbjct  120  PMRLWIVGYDLGCILSLLLLY  140



>ref|XP_002522801.1| ring finger protein, putative [Ricinus communis]
 gb|EEF39652.1| ring finger protein, putative [Ricinus communis]
Length=323

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 83/136 (61%), Gaps = 17/136 (13%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIF  493
            MN R   T DSFCNSG A +   +   S V   +        P  +R    +       F
Sbjct  1    MNTRYFSTPDSFCNSGTAVSFSSN---SAVGENRG-------PVSIRTRSXVP------F  44

Query  494  LRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIW  673
            LRRVFHYQNGS  S+LGSNPFNS TWMM+E + L VQI  T +TL +SK E+P+WPMRIW
Sbjct  45   LRRVFHYQNGSR-SNLGSNPFNSSTWMMLEFIALLVQISMTTFTLVISKMEKPIWPMRIW  103

Query  674  VSGYAFGCLLSXLLLY  721
            + GY  GCLLS LL+Y
Sbjct  104  IVGYDIGCLLSLLLVY  119



>ref|XP_006857729.1| hypothetical protein AMTR_s00061p00183390 [Amborella trichopoda]
 gb|ERN19196.1| hypothetical protein AMTR_s00061p00183390 [Amborella trichopoda]
Length=331

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 6/118 (5%)
 Frame = +2

Query  368  ATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGS  547
            A+SGED            +R+ P   + R A++ISRARWF F+RR++HYQNG   SDLGS
Sbjct  11   ASSGEDR-----ETQHGPARSMPFSLLTRAAIQISRARWFSFIRRLYHYQNG-VRSDLGS  64

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NP NS  W+ +E + ++ QI+     L +SK E+PVWP+RIWV+GY FGCLLS  +LY
Sbjct  65   NPLNSKPWIWLELILVTAQIITITTILVISKNEKPVWPLRIWVTGYNFGCLLSLPMLY  122



>ref|XP_010922953.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Elaeis 
guineensis]
Length=318

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 80/115 (70%), Gaps = 1/115 (1%)
 Frame = +2

Query  377  GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPF  556
              +  M ++   Q+ +R+ P  F++R+ MR+SRARWF FLRRVF YQNGS  SDL SNPF
Sbjct  16   AREGQMPIMEGHQNAARSLPLAFLMRMVMRMSRARWFSFLRRVFQYQNGSR-SDLVSNPF  74

Query  557  NSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NS  W+ +E + L  QI+    T+AVS++E PVWP+RIW+SGY  G LLS  LLY
Sbjct  75   NSNPWLALEFLLLVFQIVVITVTMAVSQKENPVWPLRIWLSGYNLGNLLSFPLLY  129



>ref|XP_008791159.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Phoenix 
dactylifera]
Length=320

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 69/103 (67%), Gaps = 1/103 (1%)
 Frame = +2

Query  377  GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPF  556
              +  M +V   Q+  R  P  F++R+ MRISRARWF FLRRVF YQNGS  SDL SNPF
Sbjct  16   AREGHMPIVEGHQNAPRALPLAFLMRMVMRISRARWFSFLRRVFQYQNGSR-SDLVSNPF  74

Query  557  NSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGY  685
            NS  W+ +E + L  Q++    T+AVS +E PVWP+R W++GY
Sbjct  75   NSKPWLALESIVLVFQMVVITVTMAVSHKENPVWPLRSWLAGY  117



>dbj|BAB92290.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 gb|EAZ13242.1| hypothetical protein OsJ_03165 [Oryza sativa Japonica Group]
 dbj|BAG94351.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  16   SAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSPGWLALELGVIMAQMVVT  74

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S +ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  75   TAVVATSPKERPAWPLRVWVAAYNVGNVLSLPLLY  109



>dbj|BAK02980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  22   SAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSPGWLALELGVIVAQMLIT  80

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S +ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  81   TTVVATSPKERPAWPLRLWVTAYNVGNVLSLPLLY  115



>gb|EAY75518.1| hypothetical protein OsI_03422 [Oryza sativa Indica Group]
Length=304

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  16   SAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSSGWLALELGVIMAQMVVT  74

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S +ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  75   TAVVATSPKERPAWPLRVWVAAYNVGNVLSLPLLY  109



>ref|XP_006644577.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Oryza 
brachyantha]
Length=308

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  21   SAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSPGWLALELGVIVAQMVVT  79

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S  ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  80   TAVVATSPGERPAWPLRVWVAAYNVGNVLSLPLLY  114



>ref|XP_010232201.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680 [Brachypodium 
distachyon]
Length=305

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = +2

Query  395  SVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWM  574
            S  A T     ++ S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+
Sbjct  8    SSAATTPPAGTSRASAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSPGWL  66

Query  575  MMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             +E   +  Q++ T   +  S +ERP WP+R+WV+ Y  G +LS  LL+
Sbjct  67   ALELGVIVAQMLITTVVVVSSPKERPAWPLRLWVAAYNVGNVLSLPLLF  115



>dbj|BAJ91193.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=720

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  437  SAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSPGWLALELGVIVAQMLIT  495

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S +ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  496  TTVVATSPKERPAWPLRLWVTAYNVGNVLSLPLLY  530



>tpg|DAA57962.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=469

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S   +R   R+SRARWF+FLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  142  SALTMRAVARMSRARWFVFLRRVYQYQNG-PRSDLGSNPFNSPGWLALELGVIVAQVVLT  200

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S  ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  201  TAVVATSAAERPAWPLRLWVAAYNVGNVLSLPLLY  235



>emb|CDM83669.1| unnamed protein product [Triticum aestivum]
Length=305

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S F +R   R+SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  22   SAFTMRAVARMSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSSGWLALELGVIVAQMVIT  80

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S +ERP WP+R+WV  Y  G +LS  LLY
Sbjct  81   MGVVATSPKERPAWPLRLWVCAYNVGNVLSLPLLY  115



>ref|XP_008675134.1| PREDICTED: E3 ubiquitin-protein ligase At4g11680-like [Zea mays]
 tpg|DAA57963.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=429

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = +2

Query  437  SPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFT  616
            S   +R   R+SRARWF+FLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T
Sbjct  142  SALTMRAVARMSRARWFVFLRRVYQYQNG-PRSDLGSNPFNSPGWLALELGVIVAQVVLT  200

Query  617  AYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
               +A S  ERP WP+R+WV+ Y  G +LS  LLY
Sbjct  201  TAVVATSAAERPAWPLRLWVAAYNVGNVLSLPLLY  235



>ref|XP_009418470.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=313

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +2

Query  371  TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSN  550
            +SG  + M   A     +R  P   ++R+AMR+SRARWF FLRRVF YQNGS  SDL SN
Sbjct  8    SSGTRSQMPPAAGNNDGARALPLALLMRMAMRVSRARWFSFLRRVFRYQNGSR-SDLVSN  66

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGY  685
            PFN+  W+ +E   L  Q++    T+A S++E PVWP+RIW++GY
Sbjct  67   PFNARPWLALELAALVAQVVIITATMATSRKENPVWPLRIWLTGY  111



>ref|XP_009418469.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=314

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +2

Query  371  TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSN  550
            +SG  + M   A     +R  P   ++R+AMR+SRARWF FLRRVF YQNGS  SDL SN
Sbjct  8    SSGTRSQMPPAAGNNDGARALPLALLMRMAMRVSRARWFSFLRRVFRYQNGSR-SDLVSN  66

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGY  685
            PFN+  W+ +E   L  Q++    T+A S++E PVWP+RIW++GY
Sbjct  67   PFNARPWLALELAALVAQVVIITATMATSRKENPVWPLRIWLTGY  111



>ref|XP_009418468.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=315

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = +2

Query  371  TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSN  550
            +SG  + M   A     +R  P   ++R+AMR+SRARWF FLRRVF YQNGS  SDL SN
Sbjct  8    SSGTRSQMPPAAGNNDGARALPLALLMRMAMRVSRARWFSFLRRVFRYQNGSR-SDLVSN  66

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGY  685
            PFN+  W+ +E   L  Q++    T+A S++E PVWP+RIW++GY
Sbjct  67   PFNARPWLALELAALVAQVVIITATMATSRKENPVWPLRIWLTGY  111



>gb|EMS46348.1| hypothetical protein TRIUR3_26831 [Triticum urartu]
Length=379

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = +2

Query  467  ISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEE  646
            +SRARWFIFLRRV+ YQNG   SDLGSNPFNS  W+ +E   +  Q++ T   +A S +E
Sbjct  1    MSRARWFIFLRRVYQYQNG-PRSDLGSNPFNSSGWLALELGVIVAQMVITTTVVATSPKE  59

Query  647  RPVWPMRIWVSGYAFGCLLSXLLLY  721
            RP WP+R+WV  Y  G +LS  LLY
Sbjct  60   RPAWPLRLWVCAYNVGNVLSLPLLY  84



>gb|EMT31277.1| E3 ubiquitin-protein ligase [Aegilops tauschii]
Length=274

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = +2

Query  467  ISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEE  646
            +SRARWFIFLRRV+ YQNG   S +GSNPFNS  W+ +E   +  Q++ T   +A S +E
Sbjct  1    MSRARWFIFLRRVYQYQNG-PRSGVGSNPFNSSGWLALELGVIVAQMVITTTVVATSPKE  59

Query  647  RPVWPMRIWVSGYAFGCLLSXLLLY  721
            RP WP+R+WV  Y  G +LS  LLY
Sbjct  60   RPAWPLRLWVCAYNVGNVLSLPLLY  84



>gb|KDO59202.1| hypothetical protein CISIN_1g019720mg [Citrus sinensis]
Length=309

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 67/138 (49%), Gaps = 30/138 (22%)
 Frame = +2

Query  314  MNNRGLLTTDSFCNSGAAA--TSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWF  487
            MN R    +DS CNS      +S        +AR +  +R     F++R AMRISRA   
Sbjct  1    MNTRYSFPSDSLCNSSTTVPYSSSPPATEDRMARNRPAARAGAPSFLIRTAMRISRAS--  58

Query  488  IFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMR  667
                                      TWM +E + L VQI    +TL++SK+E P+WPMR
Sbjct  59   --------------------------TWMTLELLALLVQISIITFTLSISKKESPIWPMR  92

Query  668  IWVSGYAFGCLLSXLLLY  721
            IW+ GY  GCLLS LLLY
Sbjct  93   IWIVGYDIGCLLSLLLLY  110



>ref|XP_002961593.1| hypothetical protein SELMODRAFT_76977 [Selaginella moellendorffii]
 gb|EFJ36853.1| hypothetical protein SELMODRAFT_76977 [Selaginella moellendorffii]
Length=403

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E      QI+ +   L++S++E+P  P+ +WV+GYA GCL +  LLY
Sbjct  71   SPLNSGLWISIELTITVSQIVASIIVLSLSRDEKPQAPLSVWVAGYAAGCLATLPLLY  128



>ref|XP_002971210.1| hypothetical protein SELMODRAFT_171829 [Selaginella moellendorffii]
 gb|EFJ27808.1| hypothetical protein SELMODRAFT_171829 [Selaginella moellendorffii]
Length=392

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E      QI+ +   L++S++E+P  P+ +WV+GYA GCL +  LLY
Sbjct  71   SPLNSGLWISIELTITVSQIVASIIVLSLSRDEKPQAPLSVWVAGYAAGCLATLPLLY  128



>gb|KJB70539.1| hypothetical protein B456_011G078300 [Gossypium raimondii]
Length=420

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/147 (27%), Positives = 68/147 (46%), Gaps = 4/147 (3%)
 Frame = +2

Query  281  YRFLVDRANMNMNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVA  460
            Y  L++R   +     ++  D      A++++ +D   S V  TQS+ R  PS       
Sbjct  16   YPLLMERVESHNGEEHII--DIMRRDDASSSTSQDERPSGVDLTQSEDR--PSSSTQTPT  71

Query  461  MRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSK  640
             R S +   +  R     +N         +P NS  W+ +E V    QI+ +   L++S+
Sbjct  72   NRTSFSSNRLNSRNSSFARNSDGYGRRRRSPLNSGLWISVELVVTVSQIIASVVVLSLSR  131

Query  641  EERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +E+P  P+  W+ GYA GC+ +  +LY
Sbjct  132  DEKPQAPLFAWIVGYASGCVATLPILY  158



>ref|XP_011081882.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011081883.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011081884.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011081885.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=426

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+     L++SK E+P  P+R WV GYA GCL    LLY
Sbjct  103  SPLNSGLWISVELVLTVSQIIAAIVVLSLSKHEKPRAPLRAWVVGYASGCLAILPLLY  160



>gb|EPS59843.1| hypothetical protein M569_14963, partial [Genlisea aurea]
Length=417

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS+ W+ +E +  + QI+     L++S++E+P  P+R W++GYA GC     LLY
Sbjct  93   SPLNSVVWISVELLLTASQIIAAVSVLSLSRDEKPHTPLRTWIAGYASGCCGILPLLY  150



>ref|XP_011087227.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
 ref|XP_011087300.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Sesamum 
indicum]
Length=425

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    Q++     L++SK E+P  P+R W+ GYA GC     LLY
Sbjct  102  SPLNSGLWITVELVLTLSQVIAAVIVLSLSKNEKPRAPLRAWIVGYALGCFAIVPLLY  159



>ref|XP_006366871.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366872.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform 
X2 [Solanum tuberosum]
Length=419

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  533  SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXL  712
            SD   +PFN+L W+ +E +    QI      L++SKEE P  P+  W+ GYA GC  S  
Sbjct  92   SDRRWSPFNTLLWLSIELIFTLGQIGAAVVVLSLSKEENPETPLFAWIVGYATGCAASLP  151

Query  713  LLY  721
            LLY
Sbjct  152  LLY  154



>ref|XP_009775580.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X2 [Nicotiana 
sylvestris]
Length=422

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NSL W+ +E V    QI+     LA+S++E P  P+  W+ GYA GC+    LLY
Sbjct  103  SPLNSLLWISIELVLTVSQIIAAVVVLAMSRDEHPRAPLSQWIVGYASGCVAILPLLY  160



>ref|XP_009775577.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009775579.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 isoform X1 [Nicotiana 
sylvestris]
Length=444

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NSL W+ +E V    QI+     LA+S++E P  P+  W+ GYA GC+    LLY
Sbjct  103  SPLNSLLWISIELVLTVSQIIAAVVVLAMSRDEHPRAPLSQWIVGYASGCVAILPLLY  160



>ref|NP_178156.1| putative zinc ion binding protein [Arabidopsis thaliana]
 gb|AAG52430.1|AC018848_1 putative RING zinc finger protein; 53384-54880 [Arabidopsis thaliana]
 gb|AAL32923.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAN15389.1| putative RING zinc finger protein [Arabidopsis thaliana]
 dbj|BAH19697.1| AT1G80400 [Arabidopsis thaliana]
 gb|AEE36398.1| putative zinc ion binding protein [Arabidopsis thaliana]
Length=407

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 51/115 (44%), Gaps = 16/115 (14%)
 Frame = +2

Query  377  GEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPF  556
            GE+T++S    TQ Q  T PSP   R               R     NG  T     +P 
Sbjct  57   GEETVLSSSNATQ-QHPTHPSPPQQRPTSS-----------RRGDNGNGRRTR----SPL  100

Query  557  NSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            NS  W+ +E V    QI+     + ++K+E P  P+  WV GY  GCL +  +LY
Sbjct  101  NSGLWISVELVVTVAQIVAAIVVMVLAKDEHPEAPLFTWVIGYTCGCLATLPILY  155



>gb|EPS64040.1| hypothetical protein M569_10741, partial [Genlisea aurea]
Length=334

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            P NS  W+ +E +    QI+     L++SK E+P  P++ W+ GYA GCL    +LY
Sbjct  83   PLNSGLWISVELILTVSQIIAAIIVLSLSKHEKPGAPLKTWIVGYASGCLAVLPVLY  139



>ref|XP_009586726.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Nicotiana tomentosiformis]
 ref|XP_009586727.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Nicotiana tomentosiformis]
 ref|XP_009586728.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760 [Nicotiana tomentosiformis]
Length=422

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            P NSL W+ +E V    QI+     LA+S++E P  P+  W+ GYA GC+    LLY
Sbjct  104  PLNSLLWISIELVLTVSQIIAAIVVLAMSRDEHPRAPLSQWIVGYASGCVAILPLLY  160



>ref|XP_004251592.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_004251593.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313717.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313718.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313719.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313720.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313721.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313722.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
 ref|XP_010313723.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Solanum lycopersicum]
Length=419

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  533  SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXL  712
            SD   +PFN+L W+ +E +    QI      L++SKEE P  P+  W+ GYA GC  +  
Sbjct  92   SDRRWSPFNTLLWLSIELIFTLGQIGAAVVVLSLSKEENPETPLFAWIVGYATGCAATLP  151

Query  713  LLY  721
            LLY
Sbjct  152  LLY  154



>ref|XP_009595010.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
tomentosiformis]
Length=413

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = +2

Query  533  SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXL  712
            SD   +PFN+L W+ +E V +  QI+     L++S+ E P  P+  WV GYA GC  S  
Sbjct  91   SDRRWSPFNTLLWLSIELVFILGQIVAAIVVLSLSRGENPETPLFAWVVGYATGCAASLP  150

Query  713  LLY  721
            LLY
Sbjct  151  LLY  153



>emb|CDP18420.1| unnamed protein product [Coffea canephora]
Length=424

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +2

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            P NS  W+  E V    QI+     + +S++E P  P+R+WV GYA GC+    LLY
Sbjct  108  PLNSGKWIATELVLTMSQIIAAIVVMTLSRQEHPHAPLRVWVVGYASGCVAILPLLY  164



>ref|XP_006389789.1| hypothetical protein EUTSA_v10018651mg [Eutrema salsugineum]
 gb|ESQ27075.1| hypothetical protein EUTSA_v10018651mg [Eutrema salsugineum]
Length=404

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (44%), Gaps = 12/116 (10%)
 Frame = +2

Query  374  SGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNP  553
            S +D     ++ + +Q  T PSP   R +           L R     NG   +   S P
Sbjct  52   SHQDQSEERISSSSTQHPTHPSPPQQRAS-----------LARRGDDGNGRRNTSTRS-P  99

Query  554  FNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             NS  W+ +E V    QI+     + ++K+E P  P+  WV GY  GC+ +  +LY
Sbjct  100  LNSGLWISVELVVTVAQIVAAIVVMVLAKDEHPEAPLFTWVVGYTTGCVATLPILY  155



>ref|XP_001765272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70000.1| predicted protein, partial [Physcomitrella patens]
Length=304

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E      QI+ +   L +S+ E P  P+ +WV+GYA GCL +  LLY
Sbjct  5    SPLNSGLWVSIELTITISQIIASIIVLVLSRNEHPQAPLHVWVAGYAAGCLATLPLLY  62



>ref|XP_001765270.1| predicted protein [Physcomitrella patens]
 gb|EDQ69998.1| predicted protein, partial [Physcomitrella patens]
Length=300

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E      QI+ +   L +S+ E P  P+ +WV+GYA GCL +  LLY
Sbjct  5    SPLNSGLWVSIELTITISQIIASIIVLVLSRNEHPQAPLHVWVAGYAAGCLATLPLLY  62



>gb|EYU21913.1| hypothetical protein MIMGU_mgv1a007146mg [Erythranthe guttata]
Length=417

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E +    QI+     L++SK E+P  P++ W+ GYA GCL    LLY
Sbjct  96   SPLNSGVWISVELLLTVGQIIAAIVVLSLSKHEKPHAPLKAWIVGYASGCLAILPLLY  153



>ref|XP_009381141.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Musa acuminata 
subsp. malaccensis]
Length=426

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 64/149 (43%), Gaps = 11/149 (7%)
 Frame = +2

Query  287  FLVDRANMNMNNRGLLTTDSFCNSGAAA----TSGEDTMMSVVARTQSQSRTQPSPFMVR  454
            F++DRA  N+N R  +   S  N  +A+    T   D   +      S S   P   ++ 
Sbjct  21   FMMDRA-ANLNRREHVIDISQRNDASASISTRTDNSDADGADNEDGPSTSTLAPVSQLIS  79

Query  455  VAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAV  634
                +S +  F   RR  +Y   + +      P NS  W+ +E V    QI+     L+V
Sbjct  80   ATPNVSNSINFSLPRRADNYGRRNRS------PLNSGLWISVELVVNMSQIIAAIIVLSV  133

Query  635  SKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            S+ E P  P+  W+ GY  GC+ +   LY
Sbjct  134  SRHEHPRTPLFAWIIGYTAGCIATLPHLY  162



>gb|KHF98391.1| hypothetical protein F383_13476 [Gossypium arboreum]
Length=420

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   L++S++E+P  P+  W+ GYA GC+ +  +LY
Sbjct  101  SPLNSGLWISVELVVTVSQIIASVVVLSLSRDEKPQAPLFAWIVGYASGCVATLPILY  158



>gb|KHG22085.1| hypothetical protein F383_26605 [Gossypium arboreum]
Length=420

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = +2

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            P NS  W+ +E V    QI+ +   LA+S+ E+P  P+  W+ GYA GC+ +  +LY
Sbjct  102  PLNSGLWISVELVVTVSQIIASIVVLALSRNEKPQAPLFAWIVGYATGCIATLPILY  158



>gb|ACU20068.1| unknown [Glycine max]
Length=168

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = +2

Query  542  GSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            G +P NS  W+ +E V    QI+ +   L++S+ E P  P+  W+ GY  GC+ +  +LY
Sbjct  101  GRSPLNSGLWISVELVVTVSQIIASIVVLSLSRNENPQAPLFAWIVGYGSGCVATLPILY  160



>gb|KJB68139.1| hypothetical protein B456_010G227900 [Gossypium raimondii]
 gb|KJB68140.1| hypothetical protein B456_010G227900 [Gossypium raimondii]
Length=420

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   LA+S+ E+P  P+  W+ GYA GC+ +  +LY
Sbjct  101  SPLNSGLWISVELVVTVSQIIASIVVLALSRNEKPQTPLFAWIVGYASGCIATLPILY  158



>ref|XP_003522643.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X1 [Glycine max]
 ref|XP_006578174.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like isoform 
X2 [Glycine max]
 gb|KHN02589.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=385

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   L++SK E P  P+  W+ GYA GC+ +  LLY
Sbjct  56   SPLNSGLWICVELVITVSQIVASVVVLSLSKHEHPHAPLIAWIVGYASGCVATLPLLY  113



>ref|XP_006844405.1| hypothetical protein AMTR_s00142p00106560 [Amborella trichopoda]
 gb|ERN06080.1| hypothetical protein AMTR_s00142p00106560 [Amborella trichopoda]
Length=451

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E   +  QI+ +   LA+S+ E+P  P+ IWV GYA GC+ +   LY
Sbjct  100  SPLNSGLWISIEFTIVLSQIIASIVVLALSRNEKPQAPLFIWVVGYALGCVATLPHLY  157



>gb|KCW84811.1| hypothetical protein EUGRSUZ_B01618 [Eucalyptus grandis]
Length=420

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (44%), Gaps = 14/153 (9%)
 Frame = +2

Query  281  YRFLVDRANMNMNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQ---SRTQPSPF--  445
            Y  L+++   +  +R ++  +   N  A+ T+        V  T+ +   S   P+P   
Sbjct  15   YPLLMEQVESSSGHRHIIDVER--NGDASLTASHGDQQRRVDSTEDEDGLSPIMPAPADQ  72

Query  446  -MVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAY  622
              V  + R++        RR   Y    T+      P NS  W+ +E V    QI+ +  
Sbjct  73   TTVNSSNRLNSVNSSSTRRRSDDYHQHRTS------PLNSGLWISVELVVTVGQIIASIV  126

Query  623  TLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             L++S+ E P  P+  WV GYA GC+ +  +LY
Sbjct  127  VLSLSRHENPEAPLFAWVVGYASGCVATLPILY  159



>gb|EYU29255.1| hypothetical protein MIMGU_mgv1a007086mg [Erythranthe guttata]
Length=420

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+     L++S+ E+P  P+R WV GYA GC     LLY
Sbjct  104  SPLNSGLWISVELVLTVSQIIAAIVVLSLSEHEKPQAPLRAWVVGYATGCTAILPLLY  161



>ref|XP_009760536.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Nicotiana 
sylvestris]
Length=408

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = +2

Query  533  SDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXL  712
            SD   +PFN+L W+ +E V    QI+     L++S+ E P  P+  WV GYA GC  S  
Sbjct  91   SDRRWSPFNTLLWLSIELVFTLGQIVAAIVVLSLSRGENPETPLFAWVVGYATGCAASLP  150

Query  713  LLY  721
            LLY
Sbjct  151  LLY  153



>gb|KJB53924.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
Length=383

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   LA+S+ E P  P+  W+ GYA GC+ +  LLY
Sbjct  99   SPLNSGLWISIELVLTVSQIVASVIVLALSRNEHPRTPLFAWIVGYASGCVATLPLLY  156



>ref|XP_010039941.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Eucalyptus 
grandis]
Length=461

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 67/153 (44%), Gaps = 14/153 (9%)
 Frame = +2

Query  281  YRFLVDRANMNMNNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQ---SRTQPSPF--  445
            Y  L+++   +  +R ++  +   N  A+ T+        V  T+ +   S   P+P   
Sbjct  54   YPLLMEQVESSSGHRHIIDVER--NGDASLTASHGDQQRRVDSTEDEDGLSPIMPAPADQ  111

Query  446  -MVRVAMRISRARWFIFLRRVFHYQNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAY  622
              V  + R++        RR   Y    T+      P NS  W+ +E V    QI+ +  
Sbjct  112  TTVNSSNRLNSVNSSSTRRRSDDYHQHRTS------PLNSGLWISVELVVTVGQIIASIV  165

Query  623  TLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
             L++S+ E P  P+  WV GYA GC+ +  +LY
Sbjct  166  VLSLSRHENPEAPLFAWVVGYASGCVATLPILY  198



>ref|XP_003546278.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170-like [Glycine 
max]
Length=424

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +2

Query  521  GSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCL  700
            G      G +P NS  W+ +E V    QI+ +   L++S+ E P  P+  W+ GYA GC+
Sbjct  94   GEGYGHHGRSPLNSGLWISVELVVTVSQIIASIVVLSLSRNENPQAPLFAWIVGYASGCV  153

Query  701  LSXLLLY  721
             +  +LY
Sbjct  154  ATLPILY  160



>gb|KHM98780.1| E3 ubiquitin-protein ligase [Glycine soja]
Length=424

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +2

Query  521  GSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCL  700
            G      G +P NS  W+ +E V    QI+ +   L++S+ E P  P+  W+ GYA GC+
Sbjct  94   GEGYGHHGRSPLNSGLWISVELVVTVSQIIASIVVLSLSRNENPQAPLFAWIVGYASGCV  153

Query  701  LSXLLLY  721
             +  +LY
Sbjct  154  ATLPILY  160



>gb|KHG19351.1| E3 ubiquitin ligase RIE1 -like protein [Gossypium arboreum]
Length=453

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   LA+S+ E P  P+  W+ GYA GC+ +  LLY
Sbjct  99   SPLNSGLWISIELVLTVSQIVASVIVLALSRNEHPRTPLFAWIVGYASGCVATLPLLY  156



>gb|KJB53925.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
Length=413

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   LA+S+ E P  P+  W+ GYA GC+ +  LLY
Sbjct  99   SPLNSGLWISIELVLTVSQIVASVIVLALSRNEHPRTPLFAWIVGYASGCVATLPLLY  156



>gb|KJB53919.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53920.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53921.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53922.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53923.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53926.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
 gb|KJB53927.1| hypothetical protein B456_009G011400 [Gossypium raimondii]
Length=451

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   LA+S+ E P  P+  W+ GYA GC+ +  LLY
Sbjct  99   SPLNSGLWISIELVLTVSQIVASVIVLALSRNEHPRTPLFAWIVGYASGCVATLPLLY  156



>ref|XP_010537938.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Tarenaya hassleriana]
 ref|XP_010537939.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Tarenaya hassleriana]
Length=420

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 61/137 (45%), Gaps = 2/137 (1%)
 Frame = +2

Query  317  NNRGLLTTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFL  496
            N+R  +   +  +  +++ S  D   + ++  Q + R   S       + +S  +  +  
Sbjct  26   NDREHIIDITSNDEDSSSRSSIDEQTTEMSSHQGEERVSSSSIEHPTHLPLSSPQQRLNP  85

Query  497  RRVFHYQNGSTTSDL--GSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRI  670
            R V   + G        G +P NS  W+ +E +    QI+     LA++++E P  P+  
Sbjct  86   RHVSSSRRGGDGHGRLSGRSPLNSGLWISVELIVTVGQIVAAIVVLALARDEHPQAPLFT  145

Query  671  WVSGYAFGCLLSXLLLY  721
            WV GY  GC+ +  +LY
Sbjct  146  WVFGYTSGCIATLPILY  162



>ref|XP_004501279.1| PREDICTED: E3 ubiquitin-protein ligase At1g12760-like [Cicer 
arietinum]
Length=396

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 17/119 (14%)
 Frame = +2

Query  398  VVARTQSQSRTQPSPF----MVRVAMRISRARWFIFLRRVFHYQN-----GSTTSDLGS-  547
            V+  T++   T+ SP     +  V  R++R      LR   +  N     G +  + GS 
Sbjct  23   VIDITETSHETETSPIRQTSVTEVDFRVAR------LRVSSNGSNSRMIRGDSRGEGGSR  76

Query  548  -NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
              P NS  W+ +E     +QI+ +   L +SK E P  P+  W+ GYA GC++S  LL+
Sbjct  77   RTPLNSGLWISLELFFTVIQIVASLLVLFLSKNEHPHAPLFAWIVGYASGCVVSLPLLF  135



>ref|XP_002324833.1| zinc finger family protein [Populus trichocarpa]
 gb|EEF03398.1| zinc finger family protein [Populus trichocarpa]
Length=434

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   L+VS++E P  P+  W+ GYA GC+ +  LLY
Sbjct  99   SPLNSGLWISVELVLTLSQIIASIVVLSVSRKEHPRAPLFAWIVGYASGCVATLPLLY  156



>gb|KJB35099.1| hypothetical protein B456_006G100000 [Gossypium raimondii]
Length=264

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +2

Query  551  PFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            P NS  W++ E + +  QI  +   L++S+ E+P  P+  W+ GYA GC+    +LY
Sbjct  97   PLNSALWILFELLFIVSQITASVVVLSLSRNEKPEAPLFTWIVGYASGCVAKLPILY  153



>ref|XP_007024038.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY26660.1| RING/U-box superfamily protein [Theobroma cacao]
Length=417

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   L++S+ E+P  P+  W+ GYA GC+ +  +LY
Sbjct  100  SPLNSGLWISVELVVTVSQIIASIVVLSLSRNEKPQAPLFAWIVGYASGCIATLPILY  157



>ref|XP_009125802.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Brassica rapa]
Length=417

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 58/129 (45%), Gaps = 7/129 (5%)
 Frame = +2

Query  335  TTDSFCNSGAAATSGEDTMMSVVARTQSQSRTQPSPFMVRVAMRISRARWFIFLRRVFHY  514
            ++D   +  + A+S  D + +V+   Q +S + P P      + +S+    +        
Sbjct  4    SSDHVIDIPSTASSSHDRISNVLEPLQHESPSTPPP------LPVSQPVATVSSASSSTR  57

Query  515  QNGSTTSDLGSNPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFG  694
             N  T     S P NS  W+ +E      QI+     L++SK E P  P+  W+ GYA G
Sbjct  58   SNPRTNRRRRS-PLNSGLWISIELFLTLGQIVAAIVVLSLSKHEHPRAPLFAWIVGYACG  116

Query  695  CLLSXLLLY  721
            C+ +  LLY
Sbjct  117  CVATLPLLY  125



>ref|XP_004291419.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459149.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459150.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459151.1| PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Fragaria vesca 
subsp. vesca]
Length=430

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   L++S++E P  P+  W+ GYA GC+ +  LLY
Sbjct  103  SPLNSGIWISIELVLTVSQIVASIVVLSLSRDEHPRTPLFAWIVGYASGCVATLPLLY  160



>ref|XP_007161262.1| hypothetical protein PHAVU_001G055600g [Phaseolus vulgaris]
 gb|ESW33256.1| hypothetical protein PHAVU_001G055600g [Phaseolus vulgaris]
Length=415

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P +S  W+ +E V L  QI+ +   L++S+ ERP  P+  W+ GYA GC+ +  LLY
Sbjct  85   SPVHSGLWISIELVLLVSQIVASIVVLSLSRHERPRTPLFQWIIGYASGCVATLPLLY  142



>ref|XP_006412451.1| hypothetical protein EUTSA_v10025242mg [Eutrema salsugineum]
 gb|ESQ53904.1| hypothetical protein EUTSA_v10025242mg [Eutrema salsugineum]
Length=435

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+     L++SK E P  P+  W+ GYA GC+ +  LLY
Sbjct  94   SPLNSGLWISIELVLTVGQIIAAIVVLSLSKHEHPRAPLFAWIVGYACGCVATLPLLY  151



>ref|XP_002309588.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE93111.2| zinc finger family protein [Populus trichocarpa]
Length=429

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +2

Query  548  NPFNSLTWMMMECVTLSVQIMFTAYTLAVSKEERPVWPMRIWVSGYAFGCLLSXLLLY  721
            +P NS  W+ +E V    QI+ +   L+VS+ E P  P+  W+ GYA GC+ +  LLY
Sbjct  101  SPLNSGLWISVELVLTLSQIVASIVVLSVSRHEHPHAPLFAWIVGYASGCVATLPLLY  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455