BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034M16

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762562.1|  PREDICTED: alcohol dehydrogenase-like 7            158   4e-57   Nicotiana sylvestris
ref|XP_009605587.1|  PREDICTED: alcohol dehydrogenase-like 7            158   5e-57   Nicotiana tomentosiformis
ref|XP_004238410.1|  PREDICTED: alcohol dehydrogenase-like 7            161   1e-56   
gb|AAB33481.2|  alcohol dehydrogenase ADH                               161   2e-56   Solanum lycopersicum
gb|AAB33480.2|  alcohol dehydrogenase ADH                               154   3e-55   Solanum lycopersicum
ref|XP_006342106.1|  PREDICTED: alcohol dehydrogenase-like 7-like       148   3e-55   Solanum tuberosum [potatoes]
ref|XP_004238409.1|  PREDICTED: alcohol dehydrogenase-like 7            153   6e-55   
ref|XP_004253128.1|  PREDICTED: alcohol dehydrogenase-like 7            159   2e-54   Solanum lycopersicum
ref|XP_006342549.1|  PREDICTED: alcohol dehydrogenase-like 7-like       157   2e-54   Solanum tuberosum [potatoes]
ref|XP_009774475.1|  PREDICTED: alcohol dehydrogenase-like 7            155   2e-53   Nicotiana sylvestris
ref|XP_009613178.1|  PREDICTED: alcohol dehydrogenase-like 7            156   8e-53   Nicotiana tomentosiformis
emb|CDP07305.1|  unnamed protein product                                139   4e-48   Coffea canephora [robusta coffee]
ref|XP_002285917.2|  PREDICTED: alcohol dehydrogenase-like 7            137   7e-48   
ref|XP_010101303.1|  Alcohol dehydrogenase-like 7                       137   4e-47   Morus notabilis
gb|KDP36844.1|  hypothetical protein JCGZ_08135                         136   4e-47   Jatropha curcas
ref|XP_002510634.1|  alcohol dehydrogenase, putative                    133   5e-47   Ricinus communis
ref|XP_008387882.1|  PREDICTED: alcohol dehydrogenase-like 7            137   6e-47   
ref|XP_009334355.1|  PREDICTED: alcohol dehydrogenase-like 7            137   7e-47   Pyrus x bretschneideri [bai li]
ref|XP_010666439.1|  PREDICTED: alcohol dehydrogenase-like 7            140   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007223044.1|  hypothetical protein PRUPE_ppa006932mg             139   2e-46   Prunus persica
ref|XP_002285916.1|  PREDICTED: alcohol dehydrogenase-like 7            133   2e-46   Vitis vinifera
ref|XP_011099657.1|  PREDICTED: alcohol dehydrogenase-like 7            133   3e-46   Sesamum indicum [beniseed]
ref|XP_010061139.1|  PREDICTED: alcohol dehydrogenase-like 7            135   5e-46   Eucalyptus grandis [rose gum]
ref|XP_008221165.1|  PREDICTED: alcohol dehydrogenase-like 7            139   6e-46   Prunus mume [ume]
gb|KCW68037.1|  hypothetical protein EUGRSUZ_F01715                     135   6e-46   Eucalyptus grandis [rose gum]
ref|XP_002865545.1|  hypothetical protein ARALYDRAFT_494804             133   1e-45   
ref|XP_007017962.1|  Zinc-binding alcohol dehydrogenase family pr...    135   2e-45   
ref|XP_010482004.1|  PREDICTED: alcohol dehydrogenase-like 7            134   2e-45   Camelina sativa [gold-of-pleasure]
gb|EYU17538.1|  hypothetical protein MIMGU_mgv1a007994mg                134   2e-45   Erythranthe guttata [common monkey flower]
gb|EYU17539.1|  hypothetical protein MIMGU_mgv1a007994mg                133   2e-45   Erythranthe guttata [common monkey flower]
ref|XP_004501981.1|  PREDICTED: alcohol dehydrogenase-like 7-like       129   3e-45   Cicer arietinum [garbanzo]
ref|XP_004291254.1|  PREDICTED: alcohol dehydrogenase-like 7            137   3e-45   Fragaria vesca subsp. vesca
ref|XP_010493542.1|  PREDICTED: alcohol dehydrogenase-like 7            134   1e-44   
ref|NP_199040.1|  alcohol dehydrogenase-like 7                          132   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509865.1|  PREDICTED: alcohol dehydrogenase-like 7            134   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_008464876.1|  PREDICTED: alcohol dehydrogenase-like 7            125   2e-44   Cucumis melo [Oriental melon]
ref|XP_010493867.1|  PREDICTED: alcohol dehydrogenase-like 7            133   5e-44   Camelina sativa [gold-of-pleasure]
gb|KDO85026.1|  hypothetical protein CISIN_1g016507mg                   136   7e-44   Citrus sinensis [apfelsine]
ref|XP_006435310.1|  hypothetical protein CICLE_v10001457mg             136   7e-44   Citrus clementina [clementine]
ref|XP_006435311.1|  hypothetical protein CICLE_v10001457mg             136   8e-44   
ref|XP_006473751.1|  PREDICTED: alcohol dehydrogenase-like 7-like       136   8e-44   Citrus sinensis [apfelsine]
gb|KDO85024.1|  hypothetical protein CISIN_1g016507mg                   136   8e-44   Citrus sinensis [apfelsine]
gb|KDO85028.1|  hypothetical protein CISIN_1g016507mg                   135   1e-43   Citrus sinensis [apfelsine]
gb|KDO85029.1|  hypothetical protein CISIN_1g016507mg                   135   1e-43   Citrus sinensis [apfelsine]
ref|XP_010442151.1|  PREDICTED: alcohol dehydrogenase-like 7            130   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006280555.1|  hypothetical protein CARUB_v10026496mg             129   4e-43   
ref|XP_010272993.1|  PREDICTED: alcohol dehydrogenase-like 7            125   6e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010666441.1|  PREDICTED: alcohol dehydrogenase-like 7            133   6e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004491172.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    120   1e-42   Cicer arietinum [garbanzo]
ref|XP_004491173.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    120   1e-42   
ref|XP_004491174.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    120   1e-42   Cicer arietinum [garbanzo]
ref|XP_010266957.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    132   1e-42   
ref|XP_010667181.1|  PREDICTED: alcohol dehydrogenase-like 7            134   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011034915.1|  PREDICTED: alcohol dehydrogenase-like 7            126   1e-42   Populus euphratica
ref|XP_004144283.1|  PREDICTED: alcohol dehydrogenase-like 7-like       127   1e-42   
ref|XP_010266956.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    131   2e-42   
ref|XP_002465730.1|  hypothetical protein SORBIDRAFT_01g044590          135   2e-42   
ref|XP_009101606.1|  PREDICTED: alcohol dehydrogenase-like 7            134   2e-42   Brassica rapa
gb|KGN47563.1|  hypothetical protein Csa_6G361250                       127   3e-42   Cucumis sativus [cucumbers]
gb|KFK32944.1|  hypothetical protein AALP_AA6G309700                    130   3e-42   Arabis alpina [alpine rockcress]
ref|XP_006649531.1|  PREDICTED: alcohol dehydrogenase-like 7-like       134   4e-42   Oryza brachyantha
emb|CDY39423.1|  BnaAnng05540D                                          133   5e-42   Brassica napus [oilseed rape]
ref|XP_004291243.1|  PREDICTED: alcohol dehydrogenase-like 7            130   5e-42   Fragaria vesca subsp. vesca
gb|KHN26031.1|  Alcohol dehydrogenase-like 7                            117   6e-42   Glycine soja [wild soybean]
ref|XP_011459084.1|  PREDICTED: alcohol dehydrogenase-like 7            132   7e-42   Fragaria vesca subsp. vesca
ref|NP_001049222.1|  Os03g0189400                                       135   9e-42   
gb|EMS67660.1|  Alcohol dehydrogenase-like 7                            134   1e-41   Triticum urartu
ref|XP_002301931.2|  alcohol dehydrogenase family protein               123   1e-41   
dbj|BAK06271.1|  predicted protein                                      133   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006386151.1|  hypothetical protein POPTR_0002s01480g             123   2e-41   
ref|XP_003545495.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    115   3e-41   Glycine max [soybeans]
gb|KHN41317.1|  Alcohol dehydrogenase-like 7                            124   5e-41   Glycine soja [wild soybean]
ref|XP_003555362.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    124   5e-41   Glycine max [soybeans]
gb|KJB11818.1|  hypothetical protein B456_002G1197001                   126   6e-41   Gossypium raimondii
gb|KJB11817.1|  hypothetical protein B456_002G1197001                   126   7e-41   Gossypium raimondii
gb|KJB11814.1|  hypothetical protein B456_002G1197001                   126   7e-41   Gossypium raimondii
gb|KJB11813.1|  hypothetical protein B456_002G1197001                   126   8e-41   Gossypium raimondii
emb|CDY64947.1|  BnaCnng45600D                                          128   1e-40   Brassica napus [oilseed rape]
ref|XP_008804784.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    128   1e-40   Phoenix dactylifera
ref|XP_008804785.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    128   2e-40   Phoenix dactylifera
ref|XP_010530336.1|  PREDICTED: alcohol dehydrogenase-like 7            129   2e-40   Tarenaya hassleriana [spider flower]
gb|ACG35040.1|  alcohol dehydrogenase 1                                 125   2e-40   Zea mays [maize]
ref|NP_001132441.1|  putative alcohol dehydrogenase superfamily p...    125   2e-40   Zea mays [maize]
ref|XP_003617079.1|  Alcohol dehydrogenase-like protein                 120   2e-40   Medicago truncatula
ref|XP_004158271.1|  PREDICTED: alcohol dehydrogenase-like 7-like       122   2e-40   
ref|XP_004144219.1|  PREDICTED: alcohol dehydrogenase-like 7-like       122   2e-40   Cucumis sativus [cucumbers]
ref|XP_004985405.1|  PREDICTED: alcohol dehydrogenase-like 7-like       128   3e-40   Setaria italica
gb|ACU19225.1|  unknown                                                 112   3e-40   Glycine max [soybeans]
ref|XP_003519482.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    112   3e-40   Glycine max [soybeans]
ref|XP_003601300.1|  Alcohol dehydrogenase-like protein                 112   4e-40   Medicago truncatula
ref|XP_008219143.1|  PREDICTED: LOW QUALITY PROTEIN: alcohol dehy...    130   6e-40   
ref|XP_007141577.1|  hypothetical protein PHAVU_008G207700g             112   4e-39   Phaseolus vulgaris [French bean]
ref|XP_007141579.1|  hypothetical protein PHAVU_008G2078000g            111   6e-39   Phaseolus vulgaris [French bean]
emb|CDP15696.1|  unnamed protein product                                125   8e-39   Coffea canephora [robusta coffee]
ref|XP_003519481.1|  PREDICTED: alcohol dehydrogenase-like 7-like       110   6e-38   Glycine max [soybeans]
emb|CDP09729.1|  unnamed protein product                                129   1e-37   Coffea canephora [robusta coffee]
ref|XP_007141581.1|  hypothetical protein PHAVU_008G207900g             110   1e-37   Phaseolus vulgaris [French bean]
emb|CDP09728.1|  unnamed protein product                                128   2e-37   Coffea canephora [robusta coffee]
ref|XP_004291255.1|  PREDICTED: alcohol dehydrogenase-like 7            116   2e-37   Fragaria vesca subsp. vesca
emb|CDP09731.1|  unnamed protein product                                127   2e-37   Coffea canephora [robusta coffee]
ref|XP_004238532.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    129   2e-37   Solanum lycopersicum
ref|XP_006363285.1|  PREDICTED: alcohol dehydrogenase-like 1-like...    128   3e-37   
ref|XP_006363284.1|  PREDICTED: alcohol dehydrogenase-like 1-like...    128   4e-37   
gb|KJB64118.1|  hypothetical protein B456_010G038400                    121   7e-37   Gossypium raimondii
emb|CDP04608.1|  unnamed protein product                                125   9e-37   Coffea canephora [robusta coffee]
emb|CDP15616.1|  unnamed protein product                                125   1e-36   Coffea canephora [robusta coffee]
ref|XP_003602833.1|  Alcohol dehydrogenase-like protein                 117   1e-36   Medicago truncatula
gb|KEH35715.1|  zinc-binding alcohol dehydrogenase family protein       117   1e-36   Medicago truncatula
gb|KJB64119.1|  hypothetical protein B456_010G038400                    120   1e-36   Gossypium raimondii
gb|KJB64122.1|  hypothetical protein B456_010G038400                    120   1e-36   Gossypium raimondii
gb|KJB64120.1|  hypothetical protein B456_010G038400                    120   1e-36   Gossypium raimondii
gb|KJB64115.1|  hypothetical protein B456_010G038400                    120   1e-36   Gossypium raimondii
gb|KJB64124.1|  hypothetical protein B456_010G038400                    120   1e-36   Gossypium raimondii
emb|CDP09730.1|  unnamed protein product                                125   2e-36   Coffea canephora [robusta coffee]
emb|CDP15613.1|  unnamed protein product                                124   2e-36   Coffea canephora [robusta coffee]
gb|KJB64123.1|  hypothetical protein B456_010G038400                    120   2e-36   Gossypium raimondii
ref|XP_006363286.1|  PREDICTED: alcohol dehydrogenase-like 1-like       126   3e-36   Solanum tuberosum [potatoes]
ref|XP_002465729.1|  hypothetical protein SORBIDRAFT_01g044580          120   6e-36   
gb|KGN47562.1|  hypothetical protein Csa_6G361240                       117   6e-36   Cucumis sativus [cucumbers]
dbj|BAJ90549.1|  predicted protein                                      119   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG05239.1|  hypothetical protein F383_30798                         113   1e-35   Gossypium arboreum [tree cotton]
ref|XP_010098631.1|  Alcohol dehydrogenase-like 2                       113   1e-35   Morus notabilis
ref|XP_008464880.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    116   2e-35   
ref|XP_008464878.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    115   2e-35   Cucumis melo [Oriental melon]
ref|XP_010676005.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    114   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675994.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    113   2e-35   
ref|XP_006575597.1|  PREDICTED: alcohol dehydrogenase-like 7-like...  95.5    3e-35   Glycine max [soybeans]
ref|XP_007018718.1|  GroES-like zinc-binding dehydrogenase family...    114   3e-35   
ref|XP_007224791.1|  hypothetical protein PRUPE_ppa023795mg             117   3e-35   
ref|XP_008464879.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    115   3e-35   
ref|XP_007018717.1|  GroES-like zinc-binding dehydrogenase family...    114   3e-35   
ref|XP_007018720.1|  GroES-like zinc-binding dehydrogenase family...    114   3e-35   
ref|XP_004158272.1|  PREDICTED: alcohol dehydrogenase-like 7-like       115   4e-35   
ref|XP_004501694.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    113   5e-35   
ref|XP_004501693.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    113   6e-35   Cicer arietinum [garbanzo]
gb|KJB64121.1|  hypothetical protein B456_010G038400                    115   6e-35   Gossypium raimondii
tpg|DAA43802.1|  TPA: putative alcohol dehydrogenase superfamily ...    117   7e-35   
ref|NP_001141131.1|  uncharacterized protein LOC100273217               117   8e-35   Zea mays [maize]
ref|XP_004501695.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    112   8e-35   
ref|XP_010916712.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    111   1e-34   Elaeis guineensis
ref|XP_004238533.1|  PREDICTED: alcohol dehydrogenase-like 1            122   1e-34   
ref|XP_010916713.1|  PREDICTED: alcohol dehydrogenase-like 7 isof...    111   1e-34   Elaeis guineensis
gb|EMT04315.1|  Alcohol dehydrogenase-like protein 2                    114   2e-34   
ref|XP_007018721.1|  GroES-like zinc-binding dehydrogenase family...    112   2e-34   
ref|XP_006828009.1|  hypothetical protein AMTR_s00008p00243660          109   2e-34   Amborella trichopoda
ref|XP_007141580.1|  hypothetical protein PHAVU_008G2078000g          95.9    3e-34   Phaseolus vulgaris [French bean]
ref|XP_002890514.1|  hypothetical protein ARALYDRAFT_472484             123   3e-34   
ref|XP_010664347.1|  PREDICTED: alcohol dehydrogenase-like 1            109   4e-34   Vitis vinifera
ref|XP_006828005.1|  hypothetical protein AMTR_s00008p00242230          105   4e-34   Amborella trichopoda
ref|XP_003558622.1|  PREDICTED: alcohol dehydrogenase-like 7            135   6e-34   Brachypodium distachyon [annual false brome]
ref|NP_173660.1|  alcohol dehydrogenase-like 2                          123   8e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44339.1|  hypothetical protein AALP_AA1G245200                    120   1e-33   Arabis alpina [alpine rockcress]
gb|EEC74659.1|  hypothetical protein OsI_10323                          115   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006416200.1|  hypothetical protein EUTSA_v10007878mg             120   1e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006416199.1|  hypothetical protein EUTSA_v10007889mg             121   2e-33   Eutrema salsugineum [saltwater cress]
gb|KDP41414.1|  hypothetical protein JCGZ_15821                         113   3e-33   Jatropha curcas
ref|XP_010477503.1|  PREDICTED: alcohol dehydrogenase-like 2            120   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003561960.1|  PREDICTED: alcohol dehydrogenase-like 2            112   5e-33   Brachypodium distachyon [annual false brome]
ref|XP_010498712.1|  PREDICTED: alcohol dehydrogenase-like 2            120   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007017963.1|  Zinc-binding alcohol dehydrogenase family pr...  92.8    9e-33   
emb|CDX91678.1|  BnaC08g05970D                                          118   9e-33   
ref|XP_009145341.1|  PREDICTED: alcohol dehydrogenase-like 1            117   9e-33   Brassica rapa
emb|CDY21362.1|  BnaA09g30650D                                          117   9e-33   Brassica napus [oilseed rape]
emb|CDY00452.1|  BnaC07g13740D                                          117   1e-32   
ref|XP_009103237.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    117   1e-32   Brassica rapa
ref|XP_009103238.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    117   2e-32   Brassica rapa
gb|KEH35713.1|  zinc-binding alcohol dehydrogenase family protein       103   2e-32   Medicago truncatula
gb|KEH35714.1|  zinc-binding alcohol dehydrogenase family protein       103   2e-32   Medicago truncatula
emb|CDY71245.1|  BnaAnng36660D                                          116   2e-32   Brassica napus [oilseed rape]
ref|XP_010459997.1|  PREDICTED: alcohol dehydrogenase-like 2            120   2e-32   Camelina sativa [gold-of-pleasure]
gb|ABF94389.1|  oxidoreductase, zinc-binding dehydrogenase family...    113   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049223.1|  Os03g0189600                                       113   3e-32   
ref|XP_009110138.1|  PREDICTED: alcohol dehydrogenase-like 2            117   3e-32   Brassica rapa
ref|XP_009409158.1|  PREDICTED: alcohol dehydrogenase-like 7            117   3e-32   
emb|CDP01100.1|  unnamed protein product                                117   3e-32   Coffea canephora [robusta coffee]
gb|ABF94390.1|  oxidoreductase, zinc-binding dehydrogenase family...    112   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82469.1|  hypothetical protein OsI_26910                          110   6e-32   Oryza sativa Indica Group [Indian rice]
gb|EMT16703.1|  Alcohol dehydrogenase-like protein 7                    116   6e-32   
gb|AAN64150.1|  Putative alcohol dehydrogenase                          112   7e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009409164.1|  PREDICTED: alcohol dehydrogenase-like 7            116   8e-32   
emb|CDY04816.1|  BnaC05g17730D                                          114   8e-32   
ref|XP_006649532.1|  PREDICTED: alcohol dehydrogenase-like 2-like       110   8e-32   
gb|EEC82468.1|  hypothetical protein OsI_26909                          113   9e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_004958352.1|  PREDICTED: alcohol dehydrogenase-like 2-like       106   1e-31   Setaria italica
ref|NP_001060310.1|  Os07g0621800                                       108   2e-31   
ref|XP_010916714.1|  PREDICTED: alcohol dehydrogenase-like 7            114   2e-31   Elaeis guineensis
ref|XP_006658830.1|  PREDICTED: alcohol dehydrogenase-like 2-like       114   2e-31   Oryza brachyantha
gb|EMS67661.1|  Alcohol dehydrogenase-like 2                            104   2e-31   Triticum urartu
emb|CDY41481.1|  BnaA08g20830D                                          114   3e-31   Brassica napus [oilseed rape]
ref|NP_567645.1|  GroES-like zinc-binding dehydrogenase family pr...    113   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867792.1|  hypothetical protein ARALYDRAFT_492663             113   4e-31   
ref|XP_007146073.1|  hypothetical protein PHAVU_006G0103000g            120   4e-31   Phaseolus vulgaris [French bean]
ref|XP_006305040.1|  hypothetical protein CARUB_v10009406mg             115   5e-31   Capsella rubella
ref|XP_008804783.1|  PREDICTED: LOW QUALITY PROTEIN: alcohol dehy...    104   7e-31   
emb|CDX82904.1|  BnaC01g13540D                                          111   8e-31   
ref|XP_006413691.1|  hypothetical protein EUTSA_v10025421mg             111   9e-31   
gb|EMS47035.1|  Alcohol dehydrogenase-like 7                            114   1e-30   Triticum urartu
ref|XP_010320184.1|  PREDICTED: alcohol dehydrogenase-like 1 isof...    107   1e-30   
ref|XP_006305514.1|  hypothetical protein CARUB_v10009981mg             114   1e-30   
ref|XP_010459996.1|  PREDICTED: alcohol dehydrogenase-like 1            114   1e-30   Camelina sativa [gold-of-pleasure]
ref|NP_173659.1|  GroES-like zinc-binding dehydrogenase family pr...    114   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67260.1|  alcohol dehydrogenase-like protein                      111   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890513.1|  hypothetical protein ARALYDRAFT_472482             114   1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_010477502.1|  PREDICTED: alcohol dehydrogenase-like 1            113   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010445220.1|  PREDICTED: alcohol dehydrogenase-like 5            112   2e-30   
ref|XP_003562679.1|  PREDICTED: alcohol dehydrogenase-like 2            104   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_008464877.1|  PREDICTED: alcohol dehydrogenase-like 7            125   3e-30   Cucumis melo [Oriental melon]
ref|XP_006472563.1|  PREDICTED: alcohol dehydrogenase-like 2-like...    102   3e-30   
gb|KFK44338.1|  hypothetical protein AALP_AA1G245100                    117   4e-30   Arabis alpina [alpine rockcress]
ref|XP_006433934.1|  hypothetical protein CICLE_v10001399mg             100   5e-30   Citrus clementina [clementine]
ref|XP_006472567.1|  PREDICTED: alcohol dehydrogenase-like 2-like       100   5e-30   Citrus sinensis [apfelsine]
gb|EYU36482.1|  hypothetical protein MIMGU_mgv1a013093mg                114   5e-30   Erythranthe guttata [common monkey flower]
gb|KDO81033.1|  hypothetical protein CISIN_1g016363mg                   102   5e-30   Citrus sinensis [apfelsine]
ref|XP_006433936.1|  hypothetical protein CICLE_v10001446mg             102   5e-30   Citrus clementina [clementine]
ref|XP_006433938.1|  hypothetical protein CICLE_v10001446mg             102   5e-30   
ref|XP_006433939.1|  hypothetical protein CICLE_v10001446mg             101   6e-30   
ref|XP_006433935.1|  hypothetical protein CICLE_v10001446mg             101   6e-30   
gb|KDO81034.1|  hypothetical protein CISIN_1g016363mg                   101   7e-30   Citrus sinensis [apfelsine]
ref|XP_010448936.1|  PREDICTED: alcohol dehydrogenase-like 5 isof...    110   7e-30   
ref|XP_010448937.1|  PREDICTED: alcohol dehydrogenase-like 5 isof...    110   7e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010448935.1|  PREDICTED: alcohol dehydrogenase-like 5 isof...    110   7e-30   
gb|KDO81038.1|  hypothetical protein CISIN_1g025173mg                   100   7e-30   Citrus sinensis [apfelsine]
ref|XP_010498711.1|  PREDICTED: alcohol dehydrogenase-like 1            111   8e-30   Camelina sativa [gold-of-pleasure]
gb|KDO81037.1|  hypothetical protein CISIN_1g025173mg                   100   9e-30   Citrus sinensis [apfelsine]
ref|XP_006849437.1|  hypothetical protein AMTR_s00024p00046470          102   1e-29   Amborella trichopoda
ref|XP_006405266.1|  hypothetical protein EUTSA_v10028003mg             117   1e-29   
ref|XP_004985403.1|  PREDICTED: alcohol dehydrogenase-like 2-like       102   1e-29   Setaria italica
gb|AAN64149.1|  Putative alcohol dehydrogenase                          116   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006434372.1|  hypothetical protein CICLE_v10001500mg             114   4e-29   Citrus clementina [clementine]
ref|XP_009414968.1|  PREDICTED: alcohol dehydrogenase 1-like            114   4e-29   
ref|XP_006472918.1|  PREDICTED: alcohol dehydrogenase-like              114   5e-29   Citrus sinensis [apfelsine]
ref|XP_008237686.1|  PREDICTED: alcohol dehydrogenase                   113   6e-29   Prunus mume [ume]
gb|AEL75214.1|  alcohol dehydrogenase                                   113   7e-29   Malus rockii
sp|P48977.1|ADH_MALDO  RecName: Full=Alcohol dehydrogenase              113   8e-29   Malus domestica [apple tree]
ref|XP_009360723.1|  PREDICTED: alcohol dehydrogenase-like              111   8e-29   Pyrus x bretschneideri [bai li]
gb|AEL75212.1|  alcohol dehydrogenase                                   113   8e-29   Pyrus sinkiangensis
ref|XP_008346611.1|  PREDICTED: alcohol dehydrogenase                   113   1e-28   Malus domestica [apple tree]
ref|XP_010245834.1|  PREDICTED: alcohol dehydrogenase 1-like            113   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_009416943.1|  PREDICTED: alcohol dehydrogenase 3-like            111   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEL75216.1|  alcohol dehydrogenase                                   112   1e-28   Pyrus sinkiangensis
gb|AEL75215.1|  alcohol dehydrogenase                                   112   1e-28   Pyrus communis
gb|AIU98500.1|  alcohol dehydrogenase                                   111   1e-28   Musa acuminata AAA Group [Cavendish banana]
ref|XP_006858450.1|  hypothetical protein AMTR_s00071p00086150          113   1e-28   Amborella trichopoda
gb|AEL75217.1|  alcohol dehydrogenase                                   112   1e-28   Pyrus sinkiangensis
gb|AEL75211.1|  alcohol dehydrogenase                                   112   1e-28   Pyrus communis
ref|XP_009360724.1|  PREDICTED: alcohol dehydrogenase                   112   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_008364888.1|  PREDICTED: alcohol dehydrogenase                   113   1e-28   
ref|XP_006382857.1|  hypothetical protein POPTR_0005s06160g             110   2e-28   
ref|XP_011022979.1|  PREDICTED: alcohol dehydrogenase-like isofor...    107   2e-28   Populus euphratica
ref|XP_002309899.2|  alcohol-dehydrogenase family protein               109   2e-28   
ref|XP_003523232.1|  PREDICTED: alcohol dehydrogenase-like              113   2e-28   Glycine max [soybeans]
ref|XP_010912627.1|  PREDICTED: alcohol dehydrogenase 3-like isof...    114   2e-28   Elaeis guineensis
gb|EYU23838.1|  hypothetical protein MIMGU_mgv1a008274mg                110   3e-28   Erythranthe guttata [common monkey flower]
ref|XP_011022977.1|  PREDICTED: alcohol dehydrogenase                   109   3e-28   Populus euphratica
ref|XP_008376596.1|  PREDICTED: alcohol dehydrogenase                   111   3e-28   
ref|XP_002674957.1|  predicted protein                                  105   3e-28   Naegleria gruberi strain NEG-M
emb|CAJ21172.1|  alcohol dehydrogenase                                  111   3e-28   Alnus glutinosa
ref|XP_006434370.1|  hypothetical protein CICLE_v10001502mg             111   3e-28   
ref|XP_011022978.1|  PREDICTED: alcohol dehydrogenase-like isofor...    106   4e-28   Populus euphratica
ref|XP_006434371.1|  hypothetical protein CICLE_v10001502mg             110   4e-28   Citrus clementina [clementine]
gb|AIU98497.1|  alcohol dehydrogenase                                   110   4e-28   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010025916.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    106   4e-28   Eucalyptus grandis [rose gum]
ref|XP_008465550.1|  PREDICTED: alcohol dehydrogenase-like              108   4e-28   Cucumis melo [Oriental melon]
ref|XP_010025906.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    106   4e-28   Eucalyptus grandis [rose gum]
ref|XP_006472917.1|  PREDICTED: alcohol dehydrogenase-like              110   5e-28   
ref|XP_010245833.1|  PREDICTED: alcohol dehydrogenase                   112   5e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010910557.1|  PREDICTED: alcohol dehydrogenase 1                 110   6e-28   Elaeis guineensis
gb|AEL75218.1|  alcohol dehydrogenase                                   110   6e-28   Malus domestica [apple tree]
ref|XP_010244039.1|  PREDICTED: alcohol dehydrogenase-like              108   6e-28   Nelumbo nucifera [Indian lotus]
ref|XP_011032323.1|  PREDICTED: alcohol dehydrogenase-like              107   7e-28   Populus euphratica
gb|KCW83078.1|  hypothetical protein EUGRSUZ_B00036                     105   7e-28   Eucalyptus grandis [rose gum]
ref|XP_010244042.1|  PREDICTED: alcohol dehydrogenase 3-like            112   7e-28   Nelumbo nucifera [Indian lotus]
ref|XP_006382856.1|  hypothetical protein POPTR_0005s06140g             107   7e-28   
ref|XP_010679876.1|  PREDICTED: alcohol dehydrogenase 3                 110   7e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010530231.1|  PREDICTED: alcohol dehydrogenase class-P-like      113   7e-28   Tarenaya hassleriana [spider flower]
ref|XP_010030360.1|  PREDICTED: uncharacterized protein LOC104420162    110   8e-28   
ref|XP_006629873.1|  PREDICTED: alcohol dehydrogenase class-3-like    99.4    8e-28   Lepisosteus oculatus
ref|XP_008786546.1|  PREDICTED: alcohol dehydrogenase 1                 110   8e-28   Phoenix dactylifera
ref|XP_007551129.1|  PREDICTED: alcohol dehydrogenase class-3         99.4    9e-28   Poecilia formosa
ref|XP_008419253.1|  PREDICTED: alcohol dehydrogenase class-3         99.4    9e-28   
gb|AAP96921.1|  alcohol dehydrogenase                                   110   9e-28   
ref|XP_004237730.1|  PREDICTED: alcohol dehydrogenase 1                 114   9e-28   
ref|NP_001268071.1|  alcohol dehydrogenase 3                            110   1e-27   
gb|ACZ48689.1|  alcohol dehydrogenase                                   110   1e-27   
dbj|BAA19621.1|  alcohol dehydrogenase                                  111   1e-27   
ref|XP_010244041.1|  PREDICTED: alcohol dehydrogenase 1                 111   1e-27   
ref|XP_006387822.1|  hypothetical protein POPTR_0542s00210g             110   1e-27   
ref|XP_006387823.1|  hypothetical protein POPTR_0542s00210g             110   1e-27   
ref|XP_007137712.1|  hypothetical protein PHAVU_009G149500g             110   1e-27   
ref|XP_010270469.1|  PREDICTED: alcohol dehydrogenase-like              109   1e-27   
ref|XP_005418198.1|  PREDICTED: alcohol dehydrogenase class-3           100   1e-27   
ref|XP_010791188.1|  PREDICTED: alcohol dehydrogenase class-3         97.4    1e-27   
ref|XP_004290568.1|  PREDICTED: alcohol dehydrogenase                   109   1e-27   
gb|KDP43056.1|  hypothetical protein JCGZ_25242                         110   1e-27   
ref|XP_003577715.1|  PREDICTED: alcohol dehydrogenase 3                 108   1e-27   
gb|AAB39597.1|  alcohol dehydrogenase B                                 113   1e-27   
ref|XP_007199938.1|  hypothetical protein PRUPE_ppa007099mg             109   1e-27   
ref|XP_005325817.1|  PREDICTED: alcohol dehydrogenase class-3           100   1e-27   
ref|XP_004144224.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    112   1e-27   
gb|AAM65556.1|  alcohol dehydrogenase                                   112   1e-27   
gb|AAF23554.1|AF110456_1  alcohol dehydrogenase                         112   2e-27   
gb|AHD24944.1|  alcohol dehydrogenase                                   110   2e-27   
ref|XP_006380371.1|  hypothetical protein POPTR_0007s03900g             107   2e-27   
emb|CAA80692.1|  alcohol dehydrogenase-1CN                              106   2e-27   
ref|XP_004144223.1|  PREDICTED: alcohol dehydrogenase-like 7-like...    112   2e-27   
gb|KDP43050.1|  hypothetical protein JCGZ_25236                         109   2e-27   
ref|XP_002309900.2|  hypothetical protein POPTR_0007s03910g             106   2e-27   
ref|XP_009389519.1|  PREDICTED: alcohol dehydrogenase 1                 110   2e-27   
ref|XP_004290567.1|  PREDICTED: alcohol dehydrogenase-like              110   2e-27   
ref|NP_177837.1|  alcohol dehydrogenase 1                               111   2e-27   
ref|XP_010912628.1|  PREDICTED: alcohol dehydrogenase 3-like isof...    111   2e-27   
ref|NP_001105410.1|  alcohol dehydrogenase 2                            108   2e-27   
ref|XP_002534157.1|  alcohol dehydrogenase, putative                    108   2e-27   
gb|KCW69233.1|  hypothetical protein EUGRSUZ_F02744                     108   2e-27   
gb|KCW54260.1|  hypothetical protein EUGRSUZ_I00224                     110   2e-27   
ref|XP_007048344.1|  Alcohol dehydrogenase 1                            108   2e-27   
gb|KCW69235.1|  hypothetical protein EUGRSUZ_F02744                     107   2e-27   
ref|XP_010062166.1|  PREDICTED: alcohol dehydrogenase                   107   2e-27   
gb|ACG28464.1|  alcohol dehydrogenase 2                                 108   2e-27   
gb|AHC69783.1|  alcohol dehydrogenase                                   110   3e-27   
ref|XP_008347230.1|  PREDICTED: alcohol dehydrogenase-like              112   3e-27   
ref|XP_006858451.1|  hypothetical protein AMTR_s00071p00087100          108   3e-27   
dbj|BAA22979.1|  alcohol dehydrogenase                                  111   3e-27   
ref|XP_006356298.1|  PREDICTED: alcohol dehydrogenase 1-like isof...    112   3e-27   
ref|XP_006356297.1|  PREDICTED: alcohol dehydrogenase 1-like isof...    112   3e-27   
gb|KCW69234.1|  hypothetical protein EUGRSUZ_F02744                     107   3e-27   
ref|XP_002309898.1|  hypothetical protein POPTR_0007s03880g             107   3e-27   
gb|AIB54159.1|  alcohol dehydrogenase 1                                 108   3e-27   
ref|XP_008277693.1|  PREDICTED: alcohol dehydrogenase class-3         97.1    3e-27   
gb|KCW69236.1|  hypothetical protein EUGRSUZ_F02744                     107   3e-27   
ref|XP_009099538.1|  PREDICTED: alcohol dehydrogenase class-3 iso...  99.4    3e-27   
ref|XP_004985404.1|  PREDICTED: alcohol dehydrogenase-like 5-like       117   3e-27   
gb|AAF44335.1|AF195866_1  alcohol dehydrogenase 6                       110   3e-27   
ref|XP_010649384.1|  PREDICTED: alcohol dehydrogenase 1                 108   3e-27   
ref|XP_008795241.1|  PREDICTED: alcohol dehydrogenase 3                 110   3e-27   
gb|ABK24000.1|  unknown                                                 103   3e-27   
gb|ACM17576.1|  alcohol dehydrogenase family-1                          110   3e-27   
dbj|BAG80940.1|  alcohol dehydrogenase 1                                110   3e-27   
gb|AAA32728.1|  alcohol dehydrogenase                                   111   3e-27   
gb|ACS49594.1|  alcohol dehydrogenase family-1                          110   3e-27   
ref|XP_009377703.1|  PREDICTED: alcohol dehydrogenase-like              107   3e-27   
dbj|BAB32569.1|  alcohol dehydrogenase                                  110   4e-27   
gb|AAL26325.1|AF399909_1  alcohol dehydrogenase                       97.1    4e-27   
ref|XP_002281334.1|  PREDICTED: alcohol dehydrogenase 1 isoform X2      109   4e-27   
gb|ACS49642.1|  alcohol dehydrogenase family-1                          110   4e-27   
gb|ACS49604.1|  alcohol dehydrogenase family-1                          110   4e-27   
emb|CAA80691.1|  alcohol dehydrogenase-1F                               106   4e-27   
dbj|BAB32568.1|  alcohol dehydrogenase                                  110   4e-27   
gb|ACS49664.1|  alcohol dehydrogenase family-1                          110   4e-27   
ref|XP_010679888.1|  PREDICTED: alcohol dehydrogenase 2 isoform X1      108   4e-27   
ref|XP_008799038.1|  PREDICTED: alcohol dehydrogenase 3-like            111   4e-27   
dbj|BAA19617.1|  alcohol dehydrogenase                                  110   4e-27   
ref|XP_006662818.1|  PREDICTED: alcohol dehydrogenase 1-like            110   4e-27   
dbj|BAA19620.1|  alcohol dehydrogenase                                  110   4e-27   
ref|XP_004979117.1|  PREDICTED: alcohol dehydrogenase 1-like            110   4e-27   
ref|XP_005800653.1|  PREDICTED: alcohol dehydrogenase class-3-like    97.4    4e-27   
tpg|DAA51229.1|  TPA: alcohol dehydrogenase1                            108   4e-27   
gb|EYU17406.1|  hypothetical protein MIMGU_mgv1a008160mg                107   4e-27   
emb|CAA27681.1|  alcohol dehydrogenase 1                                108   4e-27   
emb|CAN80915.1|  hypothetical protein VITISV_006227                     108   4e-27   
gb|ACM17575.1|  alcohol dehydrogenase family-2                          107   4e-27   
ref|NP_001105409.1|  alcohol dehydrogenase 1                            108   4e-27   
tpg|DAA51228.1|  TPA: alcohol dehydrogenase1                            108   4e-27   
gb|AAO24256.1|  alcohol dehydrogenase                                   106   4e-27   
ref|NP_001268083.1|  alcohol dehydrogenase 2                            109   5e-27   
ref|XP_010679896.1|  PREDICTED: alcohol dehydrogenase 2 isoform X2      108   5e-27   
gb|ACM17629.1|  alcohol dehydrogenase family-2                          107   5e-27   
ref|XP_009624852.1|  PREDICTED: alcohol dehydrogenase 1                 110   5e-27   
ref|XP_008648693.1|  PREDICTED: alcohol dehydrogenase 1 isoform X1      108   5e-27   
gb|ACS49581.1|  alcohol dehydrogenase family-2                          107   5e-27   
emb|CAN68504.1|  hypothetical protein VITISV_039578                     109   5e-27   
ref|XP_010025576.1|  PREDICTED: alcohol dehydrogenase 1-like            108   5e-27   
gb|KJB40463.1|  hypothetical protein B456_007G065000                    107   5e-27   
gb|AGO18324.1|  alcohol dehydrogenase class III                       97.8    5e-27   
ref|XP_006434377.1|  hypothetical protein CICLE_v10001382mg             110   5e-27   
ref|XP_007048342.1|  Alcohol dehydrogenase 1                            108   5e-27   
ref|XP_006434380.1|  hypothetical protein CICLE_v10001382mg             110   5e-27   
ref|XP_006434381.1|  hypothetical protein CICLE_v10001382mg             110   5e-27   
gb|KCW62294.1|  hypothetical protein EUGRSUZ_H04950                     108   5e-27   
ref|XP_003798568.1|  PREDICTED: alcohol dehydrogenase class-3           100   5e-27   
sp|P25141.1|ADH1_PETHY  RecName: Full=Alcohol dehydrogenase 1           109   6e-27   
gb|ADF80907.1|  alcohol dehydrogenase I                                 108   6e-27   
ref|XP_011022976.1|  PREDICTED: alcohol dehydrogenase-like              106   6e-27   
ref|XP_006804610.1|  PREDICTED: alcohol dehydrogenase class-3-like    97.1    6e-27   
ref|XP_006434378.1|  hypothetical protein CICLE_v10001382mg             110   6e-27   
ref|XP_006434379.1|  hypothetical protein CICLE_v10001382mg             110   6e-27   
gb|AAC79419.1|  alcohol dehydrogenase 3                                 111   6e-27   
ref|NP_571924.2|  alcohol dehydrogenase class-3                       96.3    6e-27   
ref|XP_006472922.1|  PREDICTED: alcohol dehydrogenase 1-like isof...    110   6e-27   
ref|NP_001234099.1|  alcohol dehydrogenase 2                            109   6e-27   
ref|XP_010519394.1|  PREDICTED: alcohol dehydrogenase class-P-like      111   6e-27   
ref|XP_011101784.1|  PREDICTED: alcohol dehydrogenase 3-like            107   6e-27   
emb|CDP12010.1|  unnamed protein product                                108   6e-27   
dbj|BAC87780.1|  alcohol dehydrogenase I                                110   6e-27   
dbj|BAC87774.1|  alcohol dehydrogenase I                                108   6e-27   
gb|ACO09512.1|  Alcohol dehydrogenase class 3                         97.4    6e-27   
gb|KJB40461.1|  hypothetical protein B456_007G065000                    106   6e-27   
gb|AIS71926.1|  alcohol dehydrogenase                                   110   6e-27   
dbj|BAC87767.1|  alcohol dehydrogenase I                                108   6e-27   
ref|XP_010025578.1|  PREDICTED: alcohol dehydrogenase 1-like            108   6e-27   
ref|NP_001067484.1|  Os11g0210300                                       108   6e-27   
gb|AAO24240.1|  alcohol dehydrogenase                                   107   6e-27   
emb|CBI37555.3|  unnamed protein product                                110   6e-27   
ref|XP_005148762.1|  PREDICTED: alcohol dehydrogenase class-3         99.4    6e-27   
dbj|BAC87763.1|  alcohol dehydrogenase I                                108   7e-27   
ref|XP_010649312.1|  PREDICTED: alcohol dehydrogenase 2 isoform X1      110   7e-27   
gb|AHH32692.1|  alcohol dehydrogenase                                   109   7e-27   
ref|XP_010537345.1|  PREDICTED: alcohol dehydrogenase class-P           110   7e-27   
dbj|BAC87770.1|  alcohol dehydrogenase I                                108   7e-27   
gb|AAO24258.1|  alcohol dehydrogenase                                   107   7e-27   
gb|AAF23538.1|AF110440_1  alcohol dehydrogenase                         112   7e-27   
gb|AGA15793.1|  alcohol dehydrogenase 1                                 108   7e-27   
ref|XP_010027682.1|  PREDICTED: alcohol dehydrogenase 1                 109   7e-27   
gb|ADH03830.1|  ADH1                                                    108   7e-27   
ref|XP_008444856.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    103   7e-27   
gb|ELW63369.1|  Alcohol dehydrogenase class-3                           100   7e-27   
ref|XP_004979116.1|  PREDICTED: alcohol dehydrogenase 2-like            107   8e-27   
ref|XP_011101747.1|  PREDICTED: alcohol dehydrogenase 1                 109   8e-27   
ref|XP_009404957.1|  PREDICTED: alcohol dehydrogenase 3-like            110   8e-27   
gb|KJB16319.1|  hypothetical protein B456_002G222900                    113   8e-27   
gb|AAO24257.1|  alcohol dehydrogenase                                   107   8e-27   
gb|ADH03821.1|  ADH1                                                    108   8e-27   
gb|KJB16315.1|  hypothetical protein B456_002G222900                    113   8e-27   
ref|XP_008444855.1|  PREDICTED: alcohol dehydrogenase-like 2 isof...    103   8e-27   
sp|P81601.1|ADHL_GADMO  RecName: Full=Alcohol dehydrogenase class...  97.4    8e-27   
emb|CDP12012.1|  unnamed protein product                                109   8e-27   
ref|XP_006390122.1|  hypothetical protein EUTSA_v10018716mg             110   8e-27   
gb|ABL74253.1|  alcohol dehydrogenase ADH3D                             107   8e-27   
ref|XP_010911728.1|  PREDICTED: alcohol dehydrogenase 2-like            110   8e-27   
gb|KJB16321.1|  hypothetical protein B456_002G222900                    113   8e-27   
gb|AAO24236.1|  alcohol dehydrogenase                                   107   8e-27   
gb|KHG15342.1|  Alcohol dehydrogenase 1                                 107   9e-27   
gb|ABO41830.1|  alcohol dehydrogenase A                                 113   9e-27   
gb|ACS49650.1|  alcohol dehydrogenase family-1                          109   9e-27   
dbj|BAH84777.1|  alcohol dehydrogenase 4                                107   9e-27   
gb|ABL74254.1|  alcohol dehydrogenase ADH2A                             107   9e-27   
dbj|BAJ86311.1|  predicted protein                                      107   9e-27   
gb|KJB16320.1|  hypothetical protein B456_002G222900                    113   9e-27   
ref|XP_002281363.1|  PREDICTED: alcohol dehydrogenase 1                 109   9e-27   
gb|EMT14681.1|  Alcohol dehydrogenase 3                                 107   9e-27   
gb|ABL74256.1|  alcohol dehydrogenase ADH2B                             107   9e-27   
sp|P10848.1|ADH3_HORVU  RecName: Full=Alcohol dehydrogenase 3           107   9e-27   
gb|ABL74255.1|  alcohol dehydrogenase ADH2D                             107   9e-27   
gb|AAO24252.1|  alcohol dehydrogenase                                   107   9e-27   
ref|XP_009347946.1|  PREDICTED: alcohol dehydrogenase 3-like            108   9e-27   
ref|NP_001268079.1|  alcohol dehydrogenase 1                            106   9e-27   
emb|CAN68505.1|  hypothetical protein VITISV_039579                     109   9e-27   
gb|ADF80905.1|  alcohol dehydrogenase I                                 106   9e-27   
gb|EMS66449.1|  Alcohol dehydrogenase 3                                 107   9e-27   
gb|KJB16316.1|  hypothetical protein B456_002G222900                    113   9e-27   
gb|ABL74266.1|  alcohol dehydrogenase ADH2A                             107   9e-27   
gb|ABL74260.1|  alcohol dehydrogenase ADH2                              107   9e-27   
ref|XP_011069785.1|  PREDICTED: alcohol dehydrogenase 3                 107   1e-26   
ref|XP_009806641.1|  PREDICTED: alcohol dehydrogenase class-3         97.8    1e-26   
gb|EMS65694.1|  Alcohol dehydrogenase 2                                 106   1e-26   
sp|P14219.1|ADH1_PENAM  RecName: Full=Alcohol dehydrogenase 1; Al...    108   1e-26   
ref|XP_007137528.1|  hypothetical protein PHAVU_009G134700g             105   1e-26   
ref|XP_009360726.1|  PREDICTED: alcohol dehydrogenase 1-like            108   1e-26   
gb|AFJ04795.1|  alcohol dehydrogenase 1                                 111   1e-26   
ref|XP_010025573.1|  PREDICTED: alcohol dehydrogenase 1-like            107   1e-26   
gb|ADF80914.1|  alcohol dehydrogenase I                                 106   1e-26   
gb|ADF80908.1|  alcohol dehydrogenase I                                 106   1e-26   
dbj|BAG80939.1|  alcohol dehydrogenase 1                                108   1e-26   
ref|NP_001098256.1|  class III alcohol dehydrogenase, chi subunit     95.9    1e-26   
gb|ADF80911.1|  alcohol dehydrogenase I                                 106   1e-26   
dbj|BAG80945.1|  alcohol dehydrogenase 1                                110   1e-26   
gb|ACS49629.1|  alcohol dehydrogenase family-2                          107   1e-26   
gb|AFJ04796.1|  alcohol dehydrogenase 1                                 111   1e-26   
emb|CBI19961.3|  unnamed protein product                                106   1e-26   
ref|XP_009377701.1|  PREDICTED: alcohol dehydrogenase 1-like            108   1e-26   
dbj|BAE00050.1|  alcohol dehydrogenase                                  105   1e-26   
emb|CAN68099.1|  hypothetical protein VITISV_043875                     106   1e-26   
gb|AAC34997.1|  putative alcohol dehydrogenase 1                        108   1e-26   
gb|ADI24330.1|  alcohol dehydrogenase 1                                 108   1e-26   
emb|CBB36483.1|  ADH1                                                   108   1e-26   
gb|AAB59302.1|  alcohol dehydrogenase                                   108   1e-26   
emb|CBB36460.1|  ADH1                                                   108   1e-26   
ref|XP_010471899.1|  PREDICTED: alcohol dehydrogenase class-P-like      111   1e-26   
gb|ABL74267.1|  alcohol dehydrogenase ADH2B                             106   1e-26   
gb|ACS49630.1|  alcohol dehydrogenase family-1                          108   1e-26   
gb|AAF23540.1|AF110442_1  alcohol dehydrogenase                         112   1e-26   
gb|ABL74268.1|  alcohol dehydrogenase ADH3                              107   1e-26   
emb|CDI66510.1|  Adh1                                                   108   1e-26   
ref|XP_005517533.1|  PREDICTED: alcohol dehydrogenase class-3         97.4    1e-26   
gb|AAO24238.1|  alcohol dehydrogenase                                   106   1e-26   
gb|AAA98984.1|  alcohol dehydrogenase 2d                                109   1e-26   
gb|AAF23545.1|AF110447_1  alcohol dehydrogenase                         110   1e-26   
gb|AIN39840.1|  hypothetical protein                                    107   1e-26   
ref|XP_008795240.1|  PREDICTED: alcohol dehydrogenase 3-like            107   1e-26   
gb|ACM17545.1|  alcohol dehydrogenase family-2                          105   1e-26   
gb|ACS49593.1|  alcohol dehydrogenase family-2                          105   1e-26   
gb|ABK26386.1|  unknown                                                 105   1e-26   
gb|EMS45891.1|  Alcohol dehydrogenase 3                                 106   1e-26   
ref|XP_004553666.1|  PREDICTED: alcohol dehydrogenase class-3-like    95.5    1e-26   
dbj|BAA07911.1|  alcohol dehydrogenases homologous                      106   1e-26   
ref|XP_010416639.1|  PREDICTED: alcohol dehydrogenase class-P           110   1e-26   
gb|ACS49663.1|  alcohol dehydrogenase family-2                          107   1e-26   
gb|ACM17638.1|  alcohol dehydrogenase family-2                          105   1e-26   
gb|ACM17531.1|  alcohol dehydrogenase family-2                          105   1e-26   
gb|KCW54253.1|  hypothetical protein EUGRSUZ_I00224                     107   2e-26   



>ref|XP_009762562.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana sylvestris]
Length=390

 Score =   158 bits (399),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            + KQ  I KTAGKPIRCRAAVARK GE LVIEEVIVAPPK+HEVR+KIICTSLC+SD+ F
Sbjct  3    STKQNGISKTAGKPIRCRAAVARKPGEALVIEEVIVAPPKAHEVRLKIICTSLCYSDITF  62

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WK+++FPGCFPRILGHEAFG++ESVGEDVE+ 
Sbjct  63   WKMKEFPGCFPRILGHEAFGIVESVGEDVEEL  94


 Score = 90.9 bits (224),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
             KEGDSVVPIFL DC EC+DCKS+KSNLC+KFPF V+PLLHRDETSRFT +
Sbjct  94   LKEGDSVVPIFLSDCKECVDCKSEKSNLCSKFPFEVSPLLHRDETSRFTTV  144



>ref|XP_009605587.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana tomentosiformis]
Length=391

 Score =   158 bits (399),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            +  Q    KTAGKPIRCRAAVARK GEPLVIEEVIVAPPK+HEVR+KIICTSLC+SD+ F
Sbjct  3    STNQNGFSKTAGKPIRCRAAVARKPGEPLVIEEVIVAPPKAHEVRLKIICTSLCYSDITF  62

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WK+++FPGCFPRILGHEAFG++ESVGEDVE+ 
Sbjct  63   WKMKEFPGCFPRILGHEAFGIVESVGEDVEEL  94


 Score = 90.9 bits (224),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
             KEGDSVVPIFL DC EC+DCKS+KSNLC+KFPF V+PLLHRDETSRFT +
Sbjct  94   LKEGDSVVPIFLSDCKECVDCKSEKSNLCSKFPFEVSPLLHRDETSRFTTV  144



>ref|XP_004238410.1| PREDICTED: alcohol dehydrogenase-like 7 [Solanum lycopersicum]
Length=390

 Score =   161 bits (408),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            Q+ I KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPK+HEVR+KIICTSLCH+D+  WKL
Sbjct  6    QSGISKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKAHEVRLKIICTSLCHTDITLWKL  65

Query  425  QQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            ++FPGCFPRILGHEAFGV+ESVGEDV++ 
Sbjct  66   KEFPGCFPRILGHEAFGVVESVGEDVDEL  94


 Score = 85.9 bits (211),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
             KEGDSVVPIFLPDC +C+DCKSKKSNLC+KFP + + LLHRD+TSRFT+
Sbjct  94   LKEGDSVVPIFLPDCMDCVDCKSKKSNLCSKFPIQSSLLLHRDDTSRFTN  143



>gb|AAB33481.2| alcohol dehydrogenase ADH [Solanum lycopersicum]
Length=390

 Score =   161 bits (407),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            Q+ I KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPK+HEVR+KIICTSLCH+D+  WKL
Sbjct  6    QSGISKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKAHEVRLKIICTSLCHTDITLWKL  65

Query  425  QQFPGCFPRILGHEAFGVIESVGEDVE  505
            ++FPGCFPRILGHEAFGV+ESVGEDV+
Sbjct  66   KEFPGCFPRILGHEAFGVVESVGEDVD  92


 Score = 85.9 bits (211),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
             KEGDSVVPIFLPDC +C+DCKSKKSNLC+KFP + + LLHRD+TSRFT+
Sbjct  94   LKEGDSVVPIFLPDCMDCVDCKSKKSNLCSKFPIQSSLLLHRDDTSRFTN  143



>gb|AAB33480.2| alcohol dehydrogenase ADH [Solanum lycopersicum]
Length=389

 Score =   154 bits (388),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPIRC+AAVARKAGEPLVIEEVIVAPPK+HEVRVKIICTSLCH+D+  WKL++FPGCF
Sbjct  11   AGKPIRCKAAVARKAGEPLVIEEVIVAPPKAHEVRVKIICTSLCHTDITLWKLKEFPGCF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEAFGV+ESVGEDV++ 
Sbjct  71   PRILGHEAFGVVESVGEDVDEL  92


 Score = 89.0 bits (219),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
             KEGDSVVPIFLPDC +C+DCKSKKSNLC+KFP +V+PLLHR++TSRF++
Sbjct  92   LKEGDSVVPIFLPDCMDCVDCKSKKSNLCSKFPIQVSPLLHRNDTSRFSN  141



>ref|XP_006342106.1| PREDICTED: alcohol dehydrogenase-like 7-like [Solanum tuberosum]
Length=388

 Score =   148 bits (374),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 66/82 (80%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPIRC+AAVARKAGEPLVIEEVIVAPPK+HEVR+KIICTSLC++D+  W++++FPGC 
Sbjct  11   AGKPIRCKAAVARKAGEPLVIEEVIVAPPKAHEVRLKIICTSLCYTDIIVWRMKEFPGCL  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEAFGV+ESVGEDV +F
Sbjct  71   PRILGHEAFGVVESVGEDVNEF  92


 Score = 94.4 bits (233),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            FKEGDSVVPIFLPDC +C+DCKSKKSNLC+KFPF+ +PLLHRD+TSRFT+
Sbjct  92   FKEGDSVVPIFLPDCMDCVDCKSKKSNLCSKFPFQASPLLHRDDTSRFTN  141



>ref|XP_004238409.1| PREDICTED: alcohol dehydrogenase-like 7 [Solanum lycopersicum]
Length=389

 Score =   153 bits (386),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPIRC+AAVARKAGEPLVIEEVIVAPPK+HEVR+KIICTSLCH+D+  WKL++FPGCF
Sbjct  11   AGKPIRCKAAVARKAGEPLVIEEVIVAPPKAHEVRLKIICTSLCHTDITLWKLKEFPGCF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEAFGV+ESVGEDV++ 
Sbjct  71   PRILGHEAFGVVESVGEDVDEL  92


 Score = 89.0 bits (219),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
             KEGDSVVPIFLPDC +C+DCKSKKSNLC+KFP +V+PLLHR++TSRF++
Sbjct  92   LKEGDSVVPIFLPDCMDCVDCKSKKSNLCSKFPIQVSPLLHRNDTSRFSN  141



>ref|XP_004253128.1| PREDICTED: alcohol dehydrogenase-like 7 [Solanum lycopersicum]
Length=389

 Score =   159 bits (402),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            A  QA + KTAGKPI CRAAVARKAGEPLVIEEVIVAPPK+ EVR+KI+CTSLCHSDV F
Sbjct  2    AATQAELSKTAGKPIHCRAAVARKAGEPLVIEEVIVAPPKACEVRIKIVCTSLCHSDVTF  61

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WKL+ FPGCFPRILGHEAFG++ESVGE+V+D 
Sbjct  62   WKLKDFPGCFPRILGHEAFGIVESVGENVQDL  93


 Score = 80.9 bits (198),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
             KEGDSV+PIFLPDCTEC+DC SKKSN C++F F+V+P + RD TSRFT +
Sbjct  93   LKEGDSVIPIFLPDCTECIDCTSKKSNSCSQFQFKVSPWMLRDGTSRFTTV  143



>ref|XP_006342549.1| PREDICTED: alcohol dehydrogenase-like 7-like [Solanum tuberosum]
Length=389

 Score =   157 bits (397),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            A  QA + KTAGKPI CRAAVARKAGEPLVIEEVIVAPPKS EVR+KIICTSLCHSDV F
Sbjct  2    AATQAELSKTAGKPIHCRAAVARKAGEPLVIEEVIVAPPKSCEVRIKIICTSLCHSDVTF  61

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WKL+ FPG FPRILGHEAFG++ESVGE+V+D 
Sbjct  62   WKLKDFPGSFPRILGHEAFGIVESVGENVQDL  93


 Score = 82.4 bits (202),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
             KEGDSV+PIFLPDCTEC+DC SKKSN C+KF F+V+P + RD+TSRFT
Sbjct  93   LKEGDSVIPIFLPDCTECIDCTSKKSNNCSKFQFKVSPWMLRDDTSRFT  141



>ref|XP_009774475.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana sylvestris]
Length=388

 Score =   155 bits (393),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 1/92 (1%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            A  QA + KTAGKPIRC+AAVARKAGEPLVIEEVIVAPPK+HEVR+KIICTSLCHSD  F
Sbjct  2    ATTQAELNKTAGKPIRCKAAVARKAGEPLVIEEVIVAPPKAHEVRLKIICTSLCHSDFTF  61

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WKL++ P CFPRI GHEAFGV+ESVGEDVED 
Sbjct  62   WKLKE-PACFPRIFGHEAFGVVESVGEDVEDL  92


 Score = 80.9 bits (198),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
             KEGDSVVPIFLPDCTEC+DC SKKSN+C+KF F+ +P + RD TSRFT
Sbjct  92   LKEGDSVVPIFLPDCTECIDCTSKKSNVCSKFQFKGSPYMLRDGTSRFT  140



>ref|XP_009613178.1| PREDICTED: alcohol dehydrogenase-like 7 [Nicotiana tomentosiformis]
Length=389

 Score =   156 bits (394),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            A  QA + KTAGKPIRC+AAVARKAGEPLVIEEVIVAPPK+ EVR+KIICTSLCHSD  F
Sbjct  2    ATTQAELNKTAGKPIRCKAAVARKAGEPLVIEEVIVAPPKAREVRLKIICTSLCHSDFTF  61

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WKL++FP CFPRI GHEAFGV+ESVGEDV++ 
Sbjct  62   WKLKEFPACFPRIFGHEAFGVVESVGEDVQEL  93


 Score = 78.6 bits (192),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
             KEGD VVPIFLPDCTEC+DC SKKSN+C+KF F+ +P + RD TSRFT
Sbjct  93   LKEGDPVVPIFLPDCTECIDCTSKKSNVCSKFQFKGSPYMPRDGTSRFT  141



>emb|CDP07305.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   139 bits (349),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +TAGKPIRCRAAVAR+AGEPLVIEEVIVAPPKS EVR+KIICTSLC SD+ FW+L+  P 
Sbjct  10   RTAGKPIRCRAAVAREAGEPLVIEEVIVAPPKSREVRIKIICTSLCFSDITFWRLKVPPA  69

Query  440  CFPRILGHEAFGVIESVGEDVEDF  511
            CFPRILGHEA GV+ESV EDV + 
Sbjct  70   CFPRILGHEAVGVVESVAEDVHEL  93


 Score = 80.1 bits (196),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD+V+PIFLPDC EC+DC+S KSNLC+KFPF V  ++ RD TSRFTDL
Sbjct  96   GDTVLPIFLPDCAECMDCQSNKSNLCSKFPFHVASMMPRDGTSRFTDL  143



>ref|XP_002285917.2| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera]
 emb|CBI18887.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   137 bits (345),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EK A   +T GKPIRCRAAV+RKAGEPLV+EEV+VAPP + EVR++IICTSLCHSD+ FW
Sbjct  9    EKVAGESQTRGKPIRCRAAVSRKAGEPLVMEEVMVAPPMAGEVRIRIICTSLCHSDLTFW  68

Query  419  KLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            KL++ P CFPRILGHEA GV+ESVGE+V +
Sbjct  69   KLKEPPACFPRILGHEAVGVVESVGENVTE  98


 Score = 80.9 bits (198),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+PIF+PDC EC+DC+S+KSNLC+KFPF ++P L R ++SRFTDL
Sbjct  101  EGDTVLPIFIPDCGECMDCRSEKSNLCSKFPFEISPWLPRHKSSRFTDL  149



>ref|XP_010101303.1| Alcohol dehydrogenase-like 7 [Morus notabilis]
 gb|EXB88238.1| Alcohol dehydrogenase-like 7 [Morus notabilis]
Length=390

 Score =   137 bits (346),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EK++   +TAGKPIRCRAA++R AGEPLVIEE+ VAPP   EVR++IICTSLCHSDV FW
Sbjct  3    EKKSSSHETAGKPIRCRAAISRVAGEPLVIEEIFVAPPMPREVRIRIICTSLCHSDVTFW  62

Query  419  KLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            K++ FPG FPRILGHEA G++ESVGE V++
Sbjct  63   KMKDFPGVFPRILGHEAIGIVESVGEGVDE  92


 Score = 78.2 bits (191),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTDL  662
            EGD+V+PIFLPDC EC DCKSKKSNLC+K PF+V+P + R D+T+RF DL
Sbjct  95   EGDTVIPIFLPDCRECADCKSKKSNLCSKLPFKVSPFMPRHDQTTRFIDL  144



>gb|KDP36844.1| hypothetical protein JCGZ_08135 [Jatropha curcas]
Length=395

 Score =   136 bits (343),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 3/90 (3%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            A  ++PI   +G PIRC+AA+ RK GEPLVIEE++VAPP  HEVR++IICTSLCHSD+ F
Sbjct  2    AGDKSPI---SGNPIRCKAAICRKPGEPLVIEEILVAPPNRHEVRIRIICTSLCHSDIIF  58

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVE  505
            WKL+ FP  FPRILGHEA GV+ESVGEDV+
Sbjct  59   WKLKDFPAVFPRILGHEAIGVVESVGEDVD  88


 Score = 79.0 bits (193),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD V+P F+ DC EC+DCKSKKSNLC+K PF+V+P + R E+SRFTDL
Sbjct  91   KEGDVVIPTFMSDCGECIDCKSKKSNLCSKLPFKVSPWMPRYESSRFTDL  140



>ref|XP_002510634.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF52821.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=386

 Score =   133 bits (335),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             + G PIRC+AAV RK GEPLVIEE++VAPP  HEVR++IICTSLC SD+ FW+L+ FP 
Sbjct  7    SSVGTPIRCKAAVCRKPGEPLVIEEILVAPPNRHEVRIQIICTSLCQSDITFWRLKDFPA  66

Query  440  CFPRILGHEAFGVIESVGEDVEDF  511
             FPRILGHEA GV+ESVGEDV++F
Sbjct  67   VFPRILGHEAVGVVESVGEDVKEF  90


 Score = 81.6 bits (200),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            FKEGD+V+P FLPDC +C DC SKKSNLC+K PF+V+P + R ETSRFTDL
Sbjct  90   FKEGDTVIPTFLPDCGDCTDCISKKSNLCSKLPFKVSPWMPRYETSRFTDL  140



>ref|XP_008387882.1| PREDICTED: alcohol dehydrogenase-like 7 [Malus domestica]
Length=391

 Score =   137 bits (346),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            GKPIRCRAAV+RKAGEPLV+EE++VAPP  HEVR++IICTSLCHSD+ FWK++ FP  FP
Sbjct  14   GKPIRCRAAVSRKAGEPLVLEEILVAPPMPHEVRIRIICTSLCHSDITFWKMKDFPAIFP  73

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA GV+ESVGEDV +
Sbjct  74   RILGHEAVGVVESVGEDVNE  93


 Score = 77.4 bits (189),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+P+C EC+DCKS KS+LCTK PF+++P + R ETSRFTDL
Sbjct  96   EGDTVIPTFMPECGECVDCKSTKSHLCTKLPFKLSPFMPRHETSRFTDL  144



>ref|XP_009334355.1| PREDICTED: alcohol dehydrogenase-like 7 [Pyrus x bretschneideri]
Length=391

 Score =   137 bits (345),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            GKPIRCRAAV+RKAGEPL++EE++VAPP  HEVR++IICTSLCHSD+ FWK++ FP  FP
Sbjct  14   GKPIRCRAAVSRKAGEPLILEEILVAPPMPHEVRIRIICTSLCHSDITFWKMKDFPAIFP  73

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA GV+ESVGEDV +
Sbjct  74   RILGHEAVGVVESVGEDVNE  93


 Score = 77.4 bits (189),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+P+C EC+DCKS KS+LCTK PF+++P + R ETSRFTDL
Sbjct  96   EGDTVIPTFMPECGECVDCKSTKSHLCTKLPFKLSPFMPRHETSRFTDL  144



>ref|XP_010666439.1| PREDICTED: alcohol dehydrogenase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=388

 Score =   140 bits (352),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
            G T GKPIRC+AA+AR+AG+PL+IEEVIVAPPK+HEVR+KI+CTSLC+SD+ FWKL+  P
Sbjct  9    GLTKGKPIRCKAAIAREAGQPLLIEEVIVAPPKAHEVRIKILCTSLCYSDITFWKLKDPP  68

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
            GCFPRILGHEA G++ESVGE+V +
Sbjct  69   GCFPRILGHEAVGIVESVGEEVNE  92


 Score = 73.9 bits (180),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            + GD V+P+F+ DC EC DCKS +SNLC+KFPF V+P + R+E+SRFTDL
Sbjct  94   EAGDFVIPVFIADCGECKDCKSSESNLCSKFPFTVSPWMPREESSRFTDL  143



>ref|XP_007223044.1| hypothetical protein PRUPE_ppa006932mg [Prunus persica]
 gb|EMJ24243.1| hypothetical protein PRUPE_ppa006932mg [Prunus persica]
Length=389

 Score =   139 bits (350),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            GKPIRCRAAV+RK GEPLV+EE+IVAPP  HEVR++IICTSLCHSD+ FWK++ FPG FP
Sbjct  12   GKPIRCRAAVSRKPGEPLVMEEIIVAPPMPHEVRIRIICTSLCHSDIIFWKMKDFPGIFP  71

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA G++ESVGEDV +
Sbjct  72   RILGHEAIGIVESVGEDVNE  91


 Score = 74.3 bits (181),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+  C EC DC+S KSNLCTK PF+V+P + R ETSRFTDL
Sbjct  94   EGDTVIPTFMSQCGECADCRSTKSNLCTKLPFKVSPFMPRYETSRFTDL  142



>ref|XP_002285916.1| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera]
 ref|XP_010664091.1| PREDICTED: alcohol dehydrogenase-like 7 [Vitis vinifera]
 emb|CBI18886.3| unnamed protein product [Vitis vinifera]
Length=384

 Score =   133 bits (334),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
            G+T GKPIRCRAAV  KAGEPLV+EEV+VAPP + EVR++IICTSLC+SD+ FWKL+  P
Sbjct  4    GETRGKPIRCRAAVCWKAGEPLVMEEVMVAPPLAGEVRIRIICTSLCYSDITFWKLKDPP  63

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
            GCFPRILGHEA GV+ESVGE+V +
Sbjct  64   GCFPRILGHEAVGVVESVGENVSE  87


 Score = 80.1 bits (196),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD V+PIFLPDC EC DC+S+KSNLC+KFPF+V+P + R E+SRFTDL
Sbjct  90   EGDIVLPIFLPDCGECTDCRSEKSNLCSKFPFKVSPWMPRYESSRFTDL  138



>ref|XP_011099657.1| PREDICTED: alcohol dehydrogenase-like 7 [Sesamum indicum]
Length=383

 Score =   133 bits (335),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T+GKPIRCRAA+ARKAGEPLVIEEVIVAPPK+ EVR+KIIC+SLCHSD+ F KL+  P C
Sbjct  6    TSGKPIRCRAAIARKAGEPLVIEEVIVAPPKAGEVRIKIICSSLCHSDITFLKLKDPPAC  65

Query  443  FPRILGHEAFGVIESVGEDVEDF  511
            FPRILGHE+ GV+ESVG+ V  F
Sbjct  66   FPRILGHESVGVVESVGDGVTAF  88


 Score = 79.0 bits (193),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F EGD+VVPIFLPDC EC DC S KSNLC+ FPF+V+P +H D +SRFTDL
Sbjct  88   FVEGDTVVPIFLPDCAECRDCTSNKSNLCSTFPFKVSPWMH-DGSSRFTDL  137



>ref|XP_010061139.1| PREDICTED: alcohol dehydrogenase-like 7 [Eucalyptus grandis]
 gb|KCW68036.1| hypothetical protein EUGRSUZ_F01715 [Eucalyptus grandis]
Length=381

 Score =   135 bits (341),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            TAGKPIRCRAAV+RK GEPLVIEEV+V PP  HEVR++IICTSLCHSD+ FWK++  PGC
Sbjct  10   TAGKPIRCRAAVSRKPGEPLVIEEVMVDPPMPHEVRIRIICTSLCHSDITFWKMKDPPGC  69

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRI GHEA G++ES+GE+V++
Sbjct  70   FPRIFGHEAVGIVESIGENVDE  91


 Score = 75.9 bits (185),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD VVP F+ DC EC DCKSKKSNLC+K PF+V+P + R ETSRF DL
Sbjct  94   EGDVVVPTFMSDCGECADCKSKKSNLCSKLPFKVSPWMPRYETSRFKDL  142



>ref|XP_008221165.1| PREDICTED: alcohol dehydrogenase-like 7 [Prunus mume]
 ref|XP_008221166.1| PREDICTED: alcohol dehydrogenase-like 7 [Prunus mume]
 ref|XP_008221167.1| PREDICTED: alcohol dehydrogenase-like 7 [Prunus mume]
Length=389

 Score =   139 bits (349),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            GKPIRCRAAV+RK GEPLV+EE+IVAPP  HEVR++IICTSLCHSD+ FWK++ FPG FP
Sbjct  12   GKPIRCRAAVSRKPGEPLVMEEIIVAPPMPHEVRIRIICTSLCHSDIIFWKMKDFPGIFP  71

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA G++ESVGEDV +
Sbjct  72   RILGHEAIGIVESVGEDVNE  91


 Score = 72.8 bits (177),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+  C EC DC+S KSNLCTK PF+V+P + R +TSRFTDL
Sbjct  94   EGDTVIPTFMSQCGECADCRSTKSNLCTKLPFKVSPFMPRYDTSRFTDL  142



>gb|KCW68037.1| hypothetical protein EUGRSUZ_F01715 [Eucalyptus grandis]
Length=277

 Score =   135 bits (341),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 73/82 (89%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            TAGKPIRCRAAV+RK GEPLVIEEV+V PP  HEVR++IICTSLCHSD+ FWK++  PGC
Sbjct  10   TAGKPIRCRAAVSRKPGEPLVIEEVMVDPPMPHEVRIRIICTSLCHSDITFWKMKDPPGC  69

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRI GHEA G++ES+GE+V++
Sbjct  70   FPRIFGHEAVGIVESIGENVDE  91


 Score = 75.9 bits (185),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD VVP F+ DC EC DCKSKKSNLC+K PF+V+P + R ETSRF DL
Sbjct  94   EGDVVVPTFMSDCGECADCKSKKSNLCSKLPFKVSPWMPRYETSRFKDL  142



>ref|XP_002865545.1| hypothetical protein ARALYDRAFT_494804 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41804.1| hypothetical protein ARALYDRAFT_494804 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   133 bits (335),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ KPIRC+AAV+RKAGEPLV+EE++VAPP+ +EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSRKPIRCKAAVSRKAGEPLVMEEIMVAPPQPYEVRIRIICTALCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
             CFPRILGHEA GV+ESVGE+V++
Sbjct  70   ACFPRILGHEAIGVVESVGENVKE  93


 Score = 76.6 bits (187),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+PDC EC+DCKS+KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  96   EGDTVLPTFMPDCGECVDCKSQKSNLCSKFPFKVSPWMPRYENSSRFTDL  145



>ref|XP_007017962.1| Zinc-binding alcohol dehydrogenase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY15187.1| Zinc-binding alcohol dehydrogenase family protein isoform 1 [Theobroma 
cacao]
Length=389

 Score =   135 bits (339),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            KTAGKPIRC+AAV+R+ GEPLVIEE++VAPP  +EVR++IICTSLCHSD+ FWKL+  P 
Sbjct  9    KTAGKPIRCKAAVSREPGEPLVIEEIMVAPPSPYEVRIRIICTSLCHSDIIFWKLKVPPA  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
            CFPRILGHEA GV+ESVGE+V++
Sbjct  69   CFPRILGHEAVGVVESVGENVDE  91


 Score = 74.7 bits (182),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD V+P FL DC EC DC+S+KSNLC+KFPFRV P + R + SRFTDL
Sbjct  94   EGDVVIPTFLSDCGECADCRSEKSNLCSKFPFRVHPWMPRYDASRFTDL  142



>ref|XP_010482004.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=390

 Score =   134 bits (336),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ KPIRC+AAV RKAGEPLV+EE++VAPP+++EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSPKPIRCKAAVCRKAGEPLVMEEIMVAPPQAYEVRIRIICTTLCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
             CFPRILGHEA G++ESVGE+V++
Sbjct  70   ACFPRILGHEAIGIVESVGENVKE  93


 Score = 75.9 bits (185),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+PDC EC+DCKS KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  96   EGDTVLPTFMPDCGECVDCKSHKSNLCSKFPFKVSPWMPRYENSSRFTDL  145



>gb|EYU17538.1| hypothetical protein MIMGU_mgv1a007994mg [Erythranthe guttata]
Length=388

 Score =   134 bits (336),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  MDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHS  403
            MD+ A       KTAGKPI+CRAAV+RKAGEPLVIEEV+VAPP S E R+KIICTSLC+S
Sbjct  1    MDATALHST---KTAGKPIKCRAAVSRKAGEPLVIEEVMVAPPNSGEARIKIICTSLCYS  57

Query  404  DVFFWKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            DV F KL+  PGCFPRILGHEA GV+ES+G+ V + 
Sbjct  58   DVTFLKLKDPPGCFPRILGHEAVGVVESIGDGVSEL  93


 Score = 76.3 bits (186),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD V+PIF+PDC EC DC SKKSNLC+KFPF V+P +H D +SRF+DL
Sbjct  95   EGDFVIPIFIPDCAECEDCTSKKSNLCSKFPFTVSPWMH-DGSSRFSDL  142



>gb|EYU17539.1| hypothetical protein MIMGU_mgv1a007994mg [Erythranthe guttata]
Length=386

 Score =   133 bits (335),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 66/96 (69%), Positives = 77/96 (80%), Gaps = 3/96 (3%)
 Frame = +2

Query  224  MDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHS  403
            MD+ A       KTAGKPI+CRAAV+RKAGEPLVIEEV+VAPP S E R+KIICTSLC+S
Sbjct  1    MDATALHST---KTAGKPIKCRAAVSRKAGEPLVIEEVMVAPPNSGEARIKIICTSLCYS  57

Query  404  DVFFWKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            DV F KL+  PGCFPRILGHEA GV+ES+G+ V + 
Sbjct  58   DVTFLKLKDPPGCFPRILGHEAVGVVESIGDGVSEL  93


 Score = 76.3 bits (186),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 1/49 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD V+PIF+PDC EC DC SKKSNLC+KFPF V+P +H D +SRF+DL
Sbjct  95   EGDFVIPIFIPDCAECEDCTSKKSNLCSKFPFTVSPWMH-DGSSRFSDL  142



>ref|XP_004501981.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cicer arietinum]
Length=390

 Score =   129 bits (325),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            G+PIRC+AAVARKAGE LVIEE++VAPP   EVR++I+CTSLCHSD+  WK+Q+ PGCFP
Sbjct  14   GQPIRCKAAVARKAGEALVIEEIMVAPPMPREVRIRILCTSLCHSDITLWKMQEPPGCFP  73

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA GV+ESVG+DV +
Sbjct  74   RILGHEAVGVVESVGKDVTE  93


 Score = 80.1 bits (196),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD V+PIFLPDC ECLDCKS KSNLCT FPF+++P + R E++RFTDL
Sbjct  96   KGDVVIPIFLPDCGECLDCKSTKSNLCTDFPFKISPWMPRHESTRFTDL  144



>ref|XP_004291254.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=389

 Score =   137 bits (344),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
            G + GKPIRCRAAV RK GEPLVIEE++VAPP  HEVR++II TSLCHSD+ FWK++ FP
Sbjct  7    GGSRGKPIRCRAAVCRKPGEPLVIEEIVVAPPMPHEVRIRIIYTSLCHSDLIFWKMKDFP  66

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
            G FPRILGHEA GV+ESVGEDV +
Sbjct  67   GIFPRILGHEAIGVVESVGEDVNE  90


 Score = 72.4 bits (176),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+ +C EC DCKS KSNLC+K PF+V+P + R  TSRFTDL
Sbjct  93   EGDTVIPTFMAECGECRDCKSTKSNLCSKLPFKVSPFMPRYGTSRFTDL  141



>ref|XP_010493542.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=446

 Score =   134 bits (337),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ KPIRC+AAV RKAGEPLV+EE++VAPP+++EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSPKPIRCKAAVCRKAGEPLVMEEIMVAPPQAYEVRIRIICTALCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
             CFPRILGHEA G++ESVGE+V++
Sbjct  70   ACFPRILGHEAIGIVESVGENVKE  93


 Score = 73.2 bits (178),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+ DC EC+DCKS KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  96   EGDTVLPTFMSDCGECVDCKSHKSNLCSKFPFKVSPWMPRYENSSRFTDL  145



>ref|NP_199040.1| alcohol dehydrogenase-like 7 [Arabidopsis thaliana]
 sp|Q9FH04.1|ADHL7_ARATH RecName: Full=Alcohol dehydrogenase-like 7 [Arabidopsis thaliana]
 dbj|BAB10198.1| alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAL91221.1| alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAM91227.1| alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AED94788.1| alcohol dehydrogenase-like 7 [Arabidopsis thaliana]
Length=390

 Score =   132 bits (332),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ KPIRC+AAV+RKAGEPLV+EE++VAPP+  EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSHKPIRCKAAVSRKAGEPLVMEEIMVAPPQPFEVRIRIICTALCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
             CFPRILGHEA GV+ESVGE+V++
Sbjct  70   ACFPRILGHEAIGVVESVGENVKE  93


 Score = 75.1 bits (183),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTDL  662
            EGD+V+P F+PDC +C+DCKS KSNLC+KFPF+V+P + R D +SRFTDL
Sbjct  96   EGDTVLPTFMPDCGDCVDCKSHKSNLCSKFPFKVSPWMPRYDNSSRFTDL  145



>ref|XP_010509865.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=392

 Score =   134 bits (336),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 76/84 (90%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ KPIRC+AAV RKAGEPLV+EE++VAPP+++EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSPKPIRCKAAVCRKAGEPLVMEEIMVAPPQAYEVRIRIICTTLCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
             CFPRILGHEA G++ESVGE+V++
Sbjct  70   ACFPRILGHEAIGIVESVGENVKE  93


 Score = 72.8 bits (177),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+ DC EC+DCKS KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  96   EGDTVLPTFMSDCGECVDCKSHKSNLCSKFPFKVSPWMPRYENSSRFTDL  145



>ref|XP_008464876.1| PREDICTED: alcohol dehydrogenase-like 7 [Cucumis melo]
Length=388

 Score =   125 bits (313),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 2/88 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            E  AP+ +    PIRCRAAV RK GEPLVIEE+IVAPP   EVR++IICTSLC SD+ FW
Sbjct  3    ENSAPVAQI--HPIRCRAAVCRKPGEPLVIEEIIVAPPMPREVRIRIICTSLCQSDITFW  60

Query  419  KLQQFPGCFPRILGHEAFGVIESVGEDV  502
            KL+  PG  PRILGHEAFGV+ESVG+DV
Sbjct  61   KLKDPPGIVPRILGHEAFGVVESVGKDV  88


 Score = 81.3 bits (199),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGDSV+PIF+PDC EC DC SKKSNLC+KFPF++ P + R  TSRFTDL
Sbjct  92   KEGDSVIPIFMPDCAECADCLSKKSNLCSKFPFKIAPGMPRCGTSRFTDL  141



>ref|XP_010493867.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=392

 Score =   133 bits (334),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ KPIRC+AAV RKAGEPLV+EE++VAPP+++EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSPKPIRCKAAVCRKAGEPLVMEEIMVAPPQAYEVRIRIICTTLCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVE  505
             CFPRILGHEA G++ESVGE+V+
Sbjct  70   ACFPRILGHEAIGIVESVGENVK  92


 Score = 72.0 bits (175),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD V+P F+ DC EC+DCKS KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  96   EGDIVLPTFMSDCGECVDCKSHKSNLCSKFPFKVSPWMPRYENSSRFTDL  145



>gb|KDO85026.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=362

 Score =   136 bits (342),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 68.6 bits (166),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>ref|XP_006435310.1| hypothetical protein CICLE_v10001457mg [Citrus clementina]
 gb|ESR48550.1| hypothetical protein CICLE_v10001457mg [Citrus clementina]
Length=388

 Score =   136 bits (342),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 68.6 bits (166),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>ref|XP_006435311.1| hypothetical protein CICLE_v10001457mg [Citrus clementina]
 gb|ESR48551.1| hypothetical protein CICLE_v10001457mg [Citrus clementina]
 gb|KDO85027.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=280

 Score =   136 bits (343),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 68.2 bits (165),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>ref|XP_006473751.1| PREDICTED: alcohol dehydrogenase-like 7-like [Citrus sinensis]
 gb|KDO85023.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=388

 Score =   136 bits (342),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 68.2 bits (165),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>gb|KDO85024.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=385

 Score =   136 bits (342),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 68.2 bits (165),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>gb|KDO85028.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=243

 Score =   135 bits (341),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 68.2 bits (165),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>gb|KDO85029.1| hypothetical protein CISIN_1g016507mg [Citrus sinensis]
Length=217

 Score =   135 bits (341),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            + P  KTAGKPI+CRAA+A   GEPLVI+EVIV PP SHEVRV+IICTSLCHSDV FWK+
Sbjct  4    EKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKM  63

Query  425  QQFPGCFPRILGHEAFGVIESVGED  499
            + FP  FPRILGHEA GV+ESVGE+
Sbjct  64   KDFPAVFPRILGHEAIGVVESVGEN  88


 Score = 67.8 bits (164),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P FL DCTEC+ C+SKK NLC+ FPF+++P + RD+TSRF DL
Sbjct  99   IPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDL  142



>ref|XP_010442151.1| PREDICTED: alcohol dehydrogenase-like 7 [Camelina sativa]
Length=392

 Score =   130 bits (327),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
             K++ K IRC+AAV RKAGEPLV+EE++VAPP+++EVR++IICT+LCHSDV FWKLQ  P
Sbjct  10   NKSSPKRIRCKAAVCRKAGEPLVMEEIMVAPPQAYEVRIRIICTTLCHSDVTFWKLQVPP  69

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
             CFPRILGHEA G++ESVGE+V++
Sbjct  70   ACFPRILGHEAIGIVESVGENVKE  93


 Score = 72.4 bits (176),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+ DC EC+DCKS KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  96   EGDTVLPTFMHDCGECVDCKSHKSNLCSKFPFKVSPWMPRYENSSRFTDL  145



>ref|XP_006280555.1| hypothetical protein CARUB_v10026496mg, partial [Capsella rubella]
 gb|EOA13453.1| hypothetical protein CARUB_v10026496mg, partial [Capsella rubella]
Length=412

 Score =   129 bits (324),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 1/95 (1%)
 Frame = +2

Query  218  LEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLC  397
             EM++     +   K   KPIRC+AAV RKAGEPLV+EE++VAPP+ +EVR+++ICT+LC
Sbjct  20   FEMEN-GNSSSGDNKATPKPIRCKAAVCRKAGEPLVMEEIMVAPPQPYEVRIRVICTALC  78

Query  398  HSDVFFWKLQQFPGCFPRILGHEAFGVIESVGEDV  502
            HSDV FWKLQ  P CFPRILGHE+ GV+ESVGE+V
Sbjct  79   HSDVTFWKLQVPPACFPRILGHESIGVVESVGENV  113


 Score = 72.8 bits (177),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+ DC EC+DCKS KSNLC+KFPF+V+P + R E +SRFTDL
Sbjct  118  EGDTVLPTFIADCGECVDCKSHKSNLCSKFPFKVSPWMPRYENSSRFTDL  167



>ref|XP_010272993.1| PREDICTED: alcohol dehydrogenase-like 7 [Nelumbo nucifera]
Length=388

 Score =   125 bits (315),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            E    +  T GK IRC+AAV R +GEPLVIEE+ VAPPK+ EVR+KIICTSLCHSDV FW
Sbjct  2    ENGNSVASTVGKAIRCKAAVCRSSGEPLVIEEIEVAPPKAGEVRIKIICTSLCHSDVTFW  61

Query  419  KLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            KL++  G FPRI GHEA GV+ESVGE+V++
Sbjct  62   KLKEPHGIFPRIFGHEAVGVVESVGENVKE  91


 Score = 76.3 bits (186),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD VVP+FL +C EC DCKSKKSN+C+KFPF V P L RD TSRF D
Sbjct  93   KEGDMVVPVFLANCEECRDCKSKKSNICSKFPFGVVPGLPRDGTSRFRD  141



>ref|XP_010666441.1| PREDICTED: alcohol dehydrogenase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=382

 Score =   133 bits (335),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            + GKPI C+AAVAR+AG+PLVIEEVIVAPP  HEVRVKI+CTSLCHSD+  W L + PG 
Sbjct  4    SVGKPIHCKAAVAREAGKPLVIEEVIVAPPSVHEVRVKILCTSLCHSDLTLWNLNEPPGY  63

Query  443  FPRILGHEAFGVIESVGEDVEDF  511
            FPRILGHEA G++ESVGEDV++F
Sbjct  64   FPRILGHEAVGIVESVGEDVKEF  86


 Score = 68.2 bits (165),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F +GD V+P+FL +C EC DCK +KSNLC+  PF+++ L+ RDET RFT+
Sbjct  86   FAKGDFVMPVFLANCGECGDCKHRKSNLCSTLPFKLSNLMPRDETGRFTN  135



>ref|XP_004491172.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X1 [Cicer 
arietinum]
Length=388

 Score =   120 bits (302),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            +PIRC+AAV RKAGE L+IEE+ VAPP  HE R++IICTSLC+SD+ FWK+Q+ P  FPR
Sbjct  13   QPIRCKAAVCRKAGEALIIEEIFVAPPMPHEARIRIICTSLCYSDITFWKMQEPPAIFPR  72

Query  452  ILGHEAFGVIESVGEDVED  508
            ILGHEA GV+ESVGE+V +
Sbjct  73   ILGHEAIGVVESVGEEVTE  91


 Score = 80.1 bits (196),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIF+PDC EC+DCKSKKSNLC+KFPF ++P + R ++SRFTDL
Sbjct  94   KGDIVVPIFMPDCEECIDCKSKKSNLCSKFPFNISPRMLRHDSSRFTDL  142



>ref|XP_004491173.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X2 [Cicer 
arietinum]
Length=359

 Score =   120 bits (302),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            +PIRC+AAV RKAGE L+IEE+ VAPP  HE R++IICTSLC+SD+ FWK+Q+ P  FPR
Sbjct  13   QPIRCKAAVCRKAGEALIIEEIFVAPPMPHEARIRIICTSLCYSDITFWKMQEPPAIFPR  72

Query  452  ILGHEAFGVIESVGEDVED  508
            ILGHEA GV+ESVGE+V +
Sbjct  73   ILGHEAIGVVESVGEEVTE  91


 Score = 79.7 bits (195),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIF+PDC EC+DCKSKKSNLC+KFPF ++P + R ++SRFTDL
Sbjct  94   KGDIVVPIFMPDCEECIDCKSKKSNLCSKFPFNISPRMLRHDSSRFTDL  142



>ref|XP_004491174.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X3 [Cicer 
arietinum]
Length=320

 Score =   120 bits (302),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            +PIRC+AAV RKAGE L+IEE+ VAPP  HE R++IICTSLC+SD+ FWK+Q+ P  FPR
Sbjct  13   QPIRCKAAVCRKAGEALIIEEIFVAPPMPHEARIRIICTSLCYSDITFWKMQEPPAIFPR  72

Query  452  ILGHEAFGVIESVGEDVED  508
            ILGHEA GV+ESVGE+V +
Sbjct  73   ILGHEAIGVVESVGEEVTE  91


 Score = 79.7 bits (195),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIF+PDC EC+DCKSKKSNLC+KFPF ++P + R ++SRFTDL
Sbjct  94   KGDIVVPIFMPDCEECIDCKSKKSNLCSKFPFNISPRMLRHDSSRFTDL  142



>ref|XP_010266957.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X2 [Nelumbo nucifera]
Length=375

 Score =   132 bits (331),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            Q P   T G+PIRCRAA+AR+AG PL IEEV+VAPPK+HEVR+KIICTSLC SD+ +WK+
Sbjct  23   QLPKTGTRGRPIRCRAAIAREAGVPLTIEEVVVAPPKAHEVRIKIICTSLCQSDITYWKM  82

Query  425  QQFPGCFPRILGHEAFGVIESVGEDVED  508
            +  P  FPRILGHEA GV+ESVGE+V++
Sbjct  83   KDPPAVFPRILGHEAIGVVESVGENVKE  110


 Score = 68.9 bits (167),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD V+P F+ DC EC  CKS KSN C K PF+V+P + RD T+RFTD
Sbjct  112  KEGDVVIPTFIADCQECEHCKSPKSNKCAKLPFKVSPWMPRDGTTRFTD  160



>ref|XP_010667181.1| PREDICTED: alcohol dehydrogenase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=382

 Score =   134 bits (337),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T GKPI C+AAVAR+AG+PLVIEEVIVAPP  HEVR+KI+CTSLCHSD+  W L++ PG 
Sbjct  4    TVGKPIHCKAAVAREAGKPLVIEEVIVAPPSVHEVRIKILCTSLCHSDLTLWNLKEPPGY  63

Query  443  FPRILGHEAFGVIESVGEDVEDF  511
            FPRILGHEA G++ESVGEDV++F
Sbjct  64   FPRILGHEAVGIVESVGEDVKEF  86


 Score = 65.9 bits (159),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F EGD V+P+FL +C +C DCK +KSN C+  PF+++ L+ RDET RFT+
Sbjct  86   FAEGDFVMPVFLANCGDCGDCKHRKSNQCSTLPFKLSNLMPRDETGRFTN  135



>ref|XP_011034915.1| PREDICTED: alcohol dehydrogenase-like 7 [Populus euphratica]
Length=398

 Score =   126 bits (317),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPIRC+AAVARK GEPLVIEE+IVAPP  HEVRV+IICTSLC SDV FWKL+  P  F
Sbjct  10   AGKPIRCKAAVARKPGEPLVIEEIIVAPPSHHEVRVRIICTSLCQSDVTFWKLKDLPAIF  69

Query  446  PRILGHEAFGVIES  487
            PRILGHEA GV+ES
Sbjct  70   PRILGHEAIGVVES  83


 Score = 73.9 bits (180),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P+FLPDC +C DCKSKKSNLC+K PF+++P + RD+TSRFTDL
Sbjct  98   IPVFLPDCGDCADCKSKKSNLCSKLPFQLSPWMPRDKTSRFTDL  141



>ref|XP_004144283.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
Length=676

 Score =   127 bits (319),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T  +PIRCRAAV RK GEPLVIEE+IVAPP   EVR++IICTSLCHSD+ FWKL+  PG 
Sbjct  9    TGLQPIRCRAAVCRKPGEPLVIEEIIVAPPMPREVRIRIICTSLCHSDLTFWKLKDPPGI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA GV+ESVG+DV +
Sbjct  69   FPRILGHEAIGVVESVGKDVHE  90


 Score = 72.8 bits (177),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD+V+P F+ DC EC DC S KSNLCTKFPF V+P   R  TSRFTDL
Sbjct  92   KEGDTVIPTFMADCGECKDCLSNKSNLCTKFPFSVSPGTPRYGTSRFTDL  141


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD V+P F+ +C EC DC S KSNLC+K PF+++  + +  TSRFTDL
Sbjct  400  KQGDFVIPTFMAECEECRDCTSSKSNLCSKQPFKLSQGMPQCGTSRFTDL  449



>ref|XP_010266956.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Nelumbo nucifera]
Length=407

 Score =   131 bits (330),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            Q P   T G+PIRCRAA+AR+AG PL IEEV+VAPPK+HEVR+KIICTSLC SD+ +WK+
Sbjct  23   QLPKTGTRGRPIRCRAAIAREAGVPLTIEEVVVAPPKAHEVRIKIICTSLCQSDITYWKM  82

Query  425  QQFPGCFPRILGHEAFGVIESVGEDVED  508
            +  P  FPRILGHEA GV+ESVGE+V++
Sbjct  83   KDPPAVFPRILGHEAIGVVESVGENVKE  110


 Score = 68.6 bits (166),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD V+P F+ DC EC  CKS KSN C K PF+V+P + RD T+RFTD
Sbjct  112  KEGDVVIPTFIADCQECEHCKSPKSNKCAKLPFKVSPWMPRDGTTRFTD  160



>ref|XP_002465730.1| hypothetical protein SORBIDRAFT_01g044590 [Sorghum bicolor]
 gb|EER92728.1| hypothetical protein SORBIDRAFT_01g044590 [Sorghum bicolor]
Length=337

 Score =   135 bits (339),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPL IEE++V PPK HEVR++IICTSLCHSDV FW+++ FPG FPR
Sbjct  7    KPIRCKAAVCRAAGEPLAIEEIVVDPPKEHEVRIRIICTSLCHSDVTFWRMKDFPGIFPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEAFGV+ESVGE VE+F
Sbjct  67   IFGHEAFGVVESVGEHVEEF  86


 Score = 65.1 bits (157),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C+EC+DC+S +SN+C+K+ F V P + RD T+RF+ 
Sbjct  86   FAAGDAVVPTFLGQCSECVDCRSARSNMCSKYRFAVRPGMPRDGTTRFSG  135



>ref|XP_009101606.1| PREDICTED: alcohol dehydrogenase-like 7 [Brassica rapa]
Length=389

 Score =   134 bits (336),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            K++ KPIRC+AAV RKAGEPLV+EE++VAPP+ HEVR++IICT+LCHSD+ FWKLQ  P 
Sbjct  10   KSSLKPIRCKAAVCRKAGEPLVMEEILVAPPQPHEVRIRIICTALCHSDITFWKLQVPPA  69

Query  440  CFPRILGHEAFGVIESVGEDVED  508
            CFPRILGHEA GV+ESVGE+V +
Sbjct  70   CFPRILGHEAIGVVESVGENVTE  92


 Score = 65.5 bits (158),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            GD+V+P F+ DC +C+DCKS KSNLC++ PF+V+P + R E +SRFTDL
Sbjct  96   GDTVLPTFMADCGDCVDCKSPKSNLCSRLPFKVSPWMPRYENSSRFTDL  144



>gb|KGN47563.1| hypothetical protein Csa_6G361250 [Cucumis sativus]
Length=386

 Score =   127 bits (318),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T  +PIRCRAAV RK GEPLVIEE+IVAPP   EVR++IICTSLCHSD+ FWKL+  PG 
Sbjct  9    TGLQPIRCRAAVCRKPGEPLVIEEIIVAPPMPREVRIRIICTSLCHSDLTFWKLKDPPGI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA GV+ESVG+DV +
Sbjct  69   FPRILGHEAIGVVESVGKDVHE  90


 Score = 72.4 bits (176),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD+V+P F+ DC EC DC S KSNLCTKFPF V+P   R  TSRFTDL
Sbjct  92   KEGDTVIPTFMADCGECKDCLSNKSNLCTKFPFSVSPGTPRYGTSRFTDL  141



>gb|KFK32944.1| hypothetical protein AALP_AA6G309700 [Arabis alpina]
Length=391

 Score =   130 bits (326),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            K A KPIRC+AAV+RKAGE LV+EE++VAPP+ +EVR++IICT+LCHSDV FWKLQ  P 
Sbjct  12   KCALKPIRCKAAVSRKAGEALVMEEIMVAPPQPYEVRIRIICTALCHSDVTFWKLQVPPA  71

Query  440  CFPRILGHEAFGVIESVGEDVED  508
            CFPRILGHEA GV+ESVGE+V +
Sbjct  72   CFPRILGHEAIGVVESVGENVTE  94


 Score = 69.7 bits (169),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 41/50 (82%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            EGD+V+P F+ DC +C DCKS +SNLC+KFPF+V+P + R E +SRFTDL
Sbjct  97   EGDTVLPTFMADCGDCADCKSHRSNLCSKFPFQVSPWMPRYENSSRFTDL  146



>ref|XP_006649531.1| PREDICTED: alcohol dehydrogenase-like 7-like [Oryza brachyantha]
Length=383

 Score =   134 bits (336),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  275  PIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPRI  454
            PIRC+AAV R AGEPL +EE++V PP++HEVR+KI+CTSLCHSDV FW++Q FPG FPRI
Sbjct  10   PIRCKAAVCRAAGEPLAVEEIVVDPPRAHEVRIKIVCTSLCHSDVTFWRMQDFPGVFPRI  69

Query  455  LGHEAFGVIESVGEDVEDF  511
             GHEAFGV+ESVGE VE F
Sbjct  70   FGHEAFGVVESVGEQVEGF  88


 Score = 65.1 bits (157),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  CTEC+DC S++SN+C+K+ F V P L R + SRF D
Sbjct  88   FAAGDAVVPTFLGQCTECVDCGSERSNMCSKYRFAVRPGLPRGDGSRFRD  137



>emb|CDY39423.1| BnaAnng05540D [Brassica napus]
Length=389

 Score =   133 bits (334),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            K++ KPIRC+AAV RKAGEPLV+EE++VAPP+ HEVR++IICT+LCHSD+ FWKLQ  P 
Sbjct  10   KSSLKPIRCKAAVCRKAGEPLVMEEILVAPPQPHEVRIRIICTALCHSDITFWKLQVPPA  69

Query  440  CFPRILGHEAFGVIESVGEDVED  508
            CFPRILGHEA GV+ESVGE V +
Sbjct  70   CFPRILGHEAIGVVESVGESVTE  92


 Score = 65.5 bits (158),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            GD+V+P F+ DC +C+DCKS KSNLC++ PF+V+P + R E +SRFTDL
Sbjct  96   GDTVLPTFMADCGDCVDCKSPKSNLCSRLPFKVSPWMPRYENSSRFTDL  144



>ref|XP_004291243.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=394

 Score =   130 bits (327),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            G PIRCRAAV+RK GEPLVIEE+IVAPP  HEVRV+I+ TSLCHSD+ FWK++ FP  FP
Sbjct  14   GNPIRCRAAVSRKPGEPLVIEEIIVAPPMPHEVRVRIVYTSLCHSDITFWKMKDFPAVFP  73

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA GV+ESVGE+V +
Sbjct  74   RILGHEAIGVVESVGEEVTE  93


 Score = 68.2 bits (165),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFR-VTPLLHRDETSRFTDL  662
            EGD+V+P  + +C EC+DC+S KSNLC+K PF+ ++P + R ETSRFTDL
Sbjct  96   EGDTVIPTLISECGECVDCRSTKSNLCSKLPFKQISPFMPRHETSRFTDL  145



>gb|KHN26031.1| Alcohol dehydrogenase-like 7 [Glycine soja]
Length=387

 Score =   117 bits (293),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            + G+PIRC+AA+ RK G PL IEE+IVAPP  HE R+++ICTSLCHSDV FWK++  P  
Sbjct  9    SEGQPIRCKAAICRKPGSPLSIEEIIVAPPMPHEARIRVICTSLCHSDVTFWKMEVPPAI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
             PRILGHEA GV+ES+GEDV +
Sbjct  69   CPRILGHEAVGVVESLGEDVTE  90


 Score = 80.9 bits (198),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIFLPDC EC+DCKS KSNLC+KFPF V+P + R  TSRFTDL
Sbjct  93   KGDVVVPIFLPDCGECIDCKSSKSNLCSKFPFEVSPWMPRHATSRFTDL  141



>ref|XP_011459084.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=391

 Score =   132 bits (331),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            GKPIRCRAAV RK GEPLVIEE++VAPP  HEVR++II TSLCHSD+ FWK++ FPG FP
Sbjct  11   GKPIRCRAAVCRKPGEPLVIEEIVVAPPMPHEVRIRIIYTSLCHSDIVFWKMKDFPGIFP  70

Query  449  RILGHEAFGVIESVGEDVED  508
             ILGHEA GV+ESVGEDV +
Sbjct  71   IILGHEAIGVVESVGEDVNE  90


 Score = 66.2 bits (160),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 2/51 (4%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLC--TKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+ +C EC DCKS KSNLC  ++ PF+V+P + R  TSRFTDL
Sbjct  93   EGDTVIPTFMAECGECRDCKSTKSNLCSSSELPFKVSPFMPRYGTSRFTDL  143



>ref|NP_001049222.1| Os03g0189400 [Oryza sativa Japonica Group]
 gb|ABF94387.1| oxidoreductase, zinc-binding dehydrogenase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11136.1| Os03g0189400 [Oryza sativa Japonica Group]
 dbj|BAG90560.1| unnamed protein product [Oryza sativa Japonica Group]
Length=381

 Score =   135 bits (339),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            +PIRC+AAV R AGEPL +EE++V PPK+HEVR+KI+CTSLCHSDV FW++Q FPG FPR
Sbjct  7    QPIRCKAAVCRAAGEPLAVEEIVVDPPKAHEVRIKIVCTSLCHSDVTFWRMQDFPGVFPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEAFGV+ESVGE VE F
Sbjct  67   IFGHEAFGVVESVGEHVEGF  86


 Score = 62.8 bits (151),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD VVP FL  CTEC+DC S++SN+C+ + F V P + RD T+RF D
Sbjct  86   FAAGDPVVPTFLGQCTECVDCASERSNVCSTYRFAVRPGMPRDGTARFRD  135



>gb|EMS67660.1| Alcohol dehydrogenase-like 7 [Triticum urartu]
Length=371

 Score =   134 bits (336),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRCRAAV R AGEPL +EEV+V PPK+HE+R+KI+CTSLCHSDV FW+++ FPG FPR
Sbjct  7    KPIRCRAAVCRAAGEPLAVEEVVVDPPKAHELRLKIVCTSLCHSDVTFWRMKDFPGVFPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEAFGV+ESVGE VE F
Sbjct  67   IFGHEAFGVVESVGEHVEGF  86


 Score = 63.9 bits (154),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C+EC DC+S +SN+C+K+ F V P + RD+T+RF D
Sbjct  86   FAAGDAVVPTFLAQCSECADCRSPRSNVCSKYRFAVRPGMPRDDTTRFHD  135



>ref|XP_002301931.2| alcohol dehydrogenase family protein [Populus trichocarpa]
 gb|EEE81204.2| alcohol dehydrogenase family protein [Populus trichocarpa]
Length=398

 Score =   123 bits (309),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPI C+AAVARK GEPLVIEE+IVAPP  HEVRV+IICTSLC SDV FWKL+  P  F
Sbjct  10   AGKPILCKAAVARKPGEPLVIEEIIVAPPSHHEVRVRIICTSLCQSDVTFWKLKDLPAVF  69

Query  446  PRILGHEAFGVIES  487
            PRILGHEA GV+ES
Sbjct  70   PRILGHEAIGVVES  83


 Score = 73.6 bits (179),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P+FLPDC +C DCKSKKSNLC+K PF+V+P + RD+TSRFT+L
Sbjct  98   IPVFLPDCGDCADCKSKKSNLCSKLPFQVSPWMPRDKTSRFTNL  141



>dbj|BAK06271.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=381

 Score =   133 bits (334),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPL +EEV+V PPK+HE+R+KI+CTSLCHSDV FW+++ FPG FPR
Sbjct  7    KPIRCKAAVCRAAGEPLAVEEVVVDPPKAHELRLKIVCTSLCHSDVTFWRMKDFPGVFPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEAFGV+ES+GE VE F
Sbjct  67   IFGHEAFGVVESIGEHVEGF  86


 Score = 63.9 bits (154),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C EC DC S +SN+C+K+ F V P + RD+T+RF D
Sbjct  86   FAAGDAVVPTFLAQCAECADCMSSRSNVCSKYRFAVRPGMPRDDTTRFRD  135



>ref|XP_006386151.1| hypothetical protein POPTR_0002s01480g [Populus trichocarpa]
 gb|ERP63948.1| hypothetical protein POPTR_0002s01480g [Populus trichocarpa]
Length=445

 Score =   123 bits (308),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPI C+AAVARK GEPLVIEE+IVAPP  HEVRV+IICTSLC SDV FWKL+  P  F
Sbjct  10   AGKPILCKAAVARKPGEPLVIEEIIVAPPSHHEVRVRIICTSLCQSDVTFWKLKDLPAVF  69

Query  446  PRILGHEAFGVIES  487
            PRILGHEA GV+ES
Sbjct  70   PRILGHEAIGVVES  83


 Score = 73.2 bits (178),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +3

Query  531  VPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +P+FLPDC +C DCKSKKSNLC+K PF+V+P + RD+TSRFT+L
Sbjct  98   IPVFLPDCGDCADCKSKKSNLCSKLPFQVSPWMPRDKTSRFTNL  141



>ref|XP_003545495.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform 1 [Glycine 
max]
Length=387

 Score =   115 bits (288),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            + G+PIRC+AA+ RK G PL IEE+IVAPP   E R+++ICTSLCHSDV FWK++  P  
Sbjct  9    SEGQPIRCKAAICRKPGSPLSIEEIIVAPPMPREARIRVICTSLCHSDVTFWKMEVPPAI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
             PRILGHEA GV+ESVGEDV +
Sbjct  69   CPRILGHEAVGVVESVGEDVTE  90


 Score = 80.9 bits (198),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIFLPDC EC+DCKS KSNLC+KFPF V+P + R  TSRFTDL
Sbjct  93   KGDVVVPIFLPDCGECIDCKSSKSNLCSKFPFEVSPWMPRHATSRFTDL  141



>gb|KHN41317.1| Alcohol dehydrogenase-like 7 [Glycine soja]
Length=397

 Score =   124 bits (311),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +2

Query  233  KAEKQAPI--GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            K +KQAP+    T G+PIRC+AAV+R+AGEPLVIE++IVAPPK  E R++IIC+SLCHSD
Sbjct  2    KDDKQAPVPASTTEGQPIRCKAAVSRRAGEPLVIEDIIVAPPKPREARIRIICSSLCHSD  61

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            +    LQ  P  FPRILGHEA GV+ESVG+DV +
Sbjct  62   ITLRNLQDPPAIFPRILGHEATGVVESVGKDVTE  95


 Score = 71.2 bits (173),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            +GD V+P+ LP+C EC+DCKS KSN CT FPF+V+P + RD T+RFT 
Sbjct  98   KGDVVIPVILPECGECIDCKSTKSNRCTNFPFKVSPWMPRDGTTRFTG  145



>ref|XP_003555362.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform 1 [Glycine 
max]
Length=392

 Score =   124 bits (311),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 2/94 (2%)
 Frame = +2

Query  233  KAEKQAPI--GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            K +KQAP+    T G+PIRC+AAV+R+AGEPLVIE++IVAPPK  E R++IIC+SLCHSD
Sbjct  2    KDDKQAPVPASTTEGQPIRCKAAVSRRAGEPLVIEDIIVAPPKPREARIRIICSSLCHSD  61

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            +    LQ  P  FPRILGHEA GV+ESVG+DV +
Sbjct  62   ITLRNLQDPPAIFPRILGHEATGVVESVGKDVTE  95


 Score = 71.2 bits (173),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            +GD V+P+ LP+C EC+DCKS KSN CT FPF+V+P + RD T+RFT
Sbjct  98   KGDVVIPVILPECGECIDCKSTKSNRCTNFPFKVSPWMPRDGTTRFT  144



>gb|KJB11818.1| hypothetical protein B456_002G1197001, partial [Gossypium raimondii]
Length=361

 Score =   126 bits (317),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = +2

Query  227  DSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            D K+  Q     +AGKPIRC+AA+ R+AGEPLVIEE++VAPP  +EVR++IICTSLC+SD
Sbjct  3    DGKSSSQ-----SAGKPIRCKAAICREAGEPLVIEEIMVAPPCPYEVRIRIICTSLCYSD  57

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            + FWKL   P C PRILGHEA GV+ESVGE+V +
Sbjct  58   ITFWKLTVPPACVPRILGHEAVGVVESVGENVNE  91


 Score = 68.2 bits (165),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD V+P FL +C EC DC SK+SNLC+KFPF++ P + R E SRFTDL
Sbjct  95   GDVVIPTFLSECGECEDCCSKRSNLCSKFPFKIHPWMPRYENSRFTDL  142



>gb|KJB11817.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=385

 Score =   126 bits (317),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = +2

Query  227  DSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            D K+  Q     +AGKPIRC+AA+ R+AGEPLVIEE++VAPP  +EVR++IICTSLC+SD
Sbjct  3    DGKSSSQ-----SAGKPIRCKAAICREAGEPLVIEEIMVAPPCPYEVRIRIICTSLCYSD  57

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            + FWKL   P C PRILGHEA GV+ESVGE+V +
Sbjct  58   ITFWKLTVPPACVPRILGHEAVGVVESVGENVNE  91


 Score = 68.2 bits (165),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD V+P FL +C EC DC SK+SNLC+KFPF++ P + R E SRFTDL
Sbjct  95   GDVVIPTFLSECGECEDCCSKRSNLCSKFPFKIHPWMPRYENSRFTDL  142



>gb|KJB11814.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
 gb|KJB11815.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=388

 Score =   126 bits (317),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = +2

Query  227  DSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            D K+  Q     +AGKPIRC+AA+ R+AGEPLVIEE++VAPP  +EVR++IICTSLC+SD
Sbjct  3    DGKSSSQ-----SAGKPIRCKAAICREAGEPLVIEEIMVAPPCPYEVRIRIICTSLCYSD  57

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            + FWKL   P C PRILGHEA GV+ESVGE+V +
Sbjct  58   ITFWKLTVPPACVPRILGHEAVGVVESVGENVNE  91


 Score = 68.2 bits (165),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD V+P FL +C EC DC SK+SNLC+KFPF++ P + R E SRFTDL
Sbjct  95   GDVVIPTFLSECGECEDCCSKRSNLCSKFPFKIHPWMPRYENSRFTDL  142



>gb|KJB11813.1| hypothetical protein B456_002G1197001 [Gossypium raimondii]
Length=341

 Score =   126 bits (316),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 5/94 (5%)
 Frame = +2

Query  227  DSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            D K+  Q     +AGKPIRC+AA+ R+AGEPLVIEE++VAPP  +EVR++IICTSLC+SD
Sbjct  3    DGKSSSQ-----SAGKPIRCKAAICREAGEPLVIEEIMVAPPCPYEVRIRIICTSLCYSD  57

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            + FWKL   P C PRILGHEA GV+ESVGE+V +
Sbjct  58   ITFWKLTVPPACVPRILGHEAVGVVESVGENVNE  91


 Score = 68.2 bits (165),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD V+P FL +C EC DC SK+SNLC+KFPF++ P + R E SRFTDL
Sbjct  95   GDVVIPTFLSECGECEDCCSKRSNLCSKFPFKIHPWMPRYENSRFTDL  142



>emb|CDY64947.1| BnaCnng45600D [Brassica napus]
Length=389

 Score =   128 bits (322),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            K++ KPIRC+AAV RKAGEPLV+EE++V PP+  EVR++IICT+LCHSD+ FWKLQ  P 
Sbjct  10   KSSLKPIRCKAAVCRKAGEPLVMEEILVEPPQPFEVRIRIICTALCHSDITFWKLQVPPA  69

Query  440  CFPRILGHEAFGVIESVGEDVED  508
            CFPRILGHEA GV+ESVGE+V +
Sbjct  70   CFPRILGHEAIGVVESVGENVTE  92


 Score = 65.5 bits (158),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 1/49 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDE-TSRFTDL  662
            GD+V+P F+ DC +C+DCKS KSNLC++ PF+V+P + R E +SRFTDL
Sbjct  96   GDTVLPTFMADCGDCVDCKSPKSNLCSRLPFKVSPWMPRYENSSRFTDL  144



>ref|XP_008804784.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Phoenix dactylifera]
Length=381

 Score =   128 bits (321),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV+R AGEPL IEEV VAPPK+HE R+KI+CTSLCHSD+ FW+++ FPG +PR
Sbjct  7    KPIRCKAAVSRAAGEPLQIEEVEVAPPKAHEARIKIVCTSLCHSDLTFWRMKDFPGVYPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEA GV+ESVGE VE+ 
Sbjct  67   IFGHEAVGVVESVGEGVEEL  86


 Score = 65.5 bits (158),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            GD+VVP FL  C +C+DC+S++SNLC+K PF + P + RD T+RFTD
Sbjct  89   GDTVVPTFLAQCKDCVDCRSERSNLCSKLPFNLIPGMPRDGTTRFTD  135



>ref|XP_008804785.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X2 [Phoenix dactylifera]
Length=327

 Score =   128 bits (321),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV+R AGEPL IEEV VAPPK+HE R+KI+CTSLCHSD+ FW+++ FPG +PR
Sbjct  7    KPIRCKAAVSRAAGEPLQIEEVEVAPPKAHEARIKIVCTSLCHSDLTFWRMKDFPGVYPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEA GV+ESVGE VE+ 
Sbjct  67   IFGHEAVGVVESVGEGVEEL  86


 Score = 65.5 bits (158),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            GD+VVP FL  C +C+DC+S++SNLC+K PF + P + RD T+RFTD
Sbjct  89   GDTVVPTFLAQCKDCVDCRSERSNLCSKLPFNLIPGMPRDGTTRFTD  135



>ref|XP_010530336.1| PREDICTED: alcohol dehydrogenase-like 7 [Tarenaya hassleriana]
Length=391

 Score =   129 bits (325),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 76/95 (80%), Gaps = 5/95 (5%)
 Frame = +2

Query  227  DSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSD  406
            +S AEK     KT  KPIRC+AAV RKAGE LV+EE++VAPP+ +EVRV+IICT+LCHSD
Sbjct  5    NSSAEK-----KTVRKPIRCKAAVCRKAGEALVMEEIVVAPPEPYEVRVRIICTALCHSD  59

Query  407  VFFWKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            V FWKL   PGC PRILGHEA GV+ESVG++V + 
Sbjct  60   VTFWKLDMPPGCVPRILGHEAIGVVESVGDNVTNL  94


 Score = 63.9 bits (154),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 40/51 (78%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
              EGD+V+P F+ DC EC DC S ++NLC++FPF+V+P + R +++SRFTD
Sbjct  94   LSEGDTVLPTFMADCGECHDCISTRTNLCSRFPFKVSPWMPRYEDSSRFTD  144



>gb|ACG35040.1| alcohol dehydrogenase 1 [Zea mays]
Length=382

 Score =   125 bits (314),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            E Q P      KPIRC+AAV R AGEPL IEEV+V  PK+HEVR++IICTSLCHSDV FW
Sbjct  2    ENQGP------KPIRCKAAVCRAAGEPLAIEEVVVDTPKAHEVRIRIICTSLCHSDVTFW  55

Query  419  KLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            +++  P   PRI GHEAFGV+ESVGE V++F
Sbjct  56   RMKDLPDNIPRIFGHEAFGVVESVGEQVDEF  86


 Score = 67.8 bits (164),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C+EC+DC+S +SN+C+K+ F V P + RD T+RFTD
Sbjct  86   FAAGDAVVPTFLGQCSECVDCRSARSNMCSKYRFAVRPGMPRDGTTRFTD  135



>ref|NP_001132441.1| putative alcohol dehydrogenase superfamily protein [Zea mays]
 gb|ACF81280.1| unknown [Zea mays]
 tpg|DAA43804.1| TPA: putative alcohol dehydrogenase superfamily protein [Zea 
mays]
Length=382

 Score =   125 bits (314),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 70/91 (77%), Gaps = 6/91 (7%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            E Q P      KPIRC+AAV R AGEPL IEEV+V  PK+HEVR++IICTSLCHSDV FW
Sbjct  2    ENQGP------KPIRCKAAVCRAAGEPLAIEEVVVDTPKAHEVRIRIICTSLCHSDVTFW  55

Query  419  KLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            +++  P   PRI GHEAFGV+ESVGE V++F
Sbjct  56   RMKDLPDNIPRIFGHEAFGVVESVGEQVDEF  86


 Score = 67.8 bits (164),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C+EC+DC+S +SN+C+K+ F V P + RD T+RFTD
Sbjct  86   FAAGDAVVPTFLGQCSECVDCRSARSNMCSKYRFAVRPGMPRDGTTRFTD  135



>ref|XP_003617079.1| Alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AET00038.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=391

 Score =   120 bits (302),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            + IRC+AAV RK GEPL+IEE+ VAPP  HE R++IICTSLCHSD+ FWK+Q+ P  FPR
Sbjct  16   QSIRCKAAVCRKPGEPLIIEEIFVAPPMPHEARIRIICTSLCHSDIIFWKMQEPPAIFPR  75

Query  452  ILGHEAFGVIESVGEDVED  508
            ILGHEA GV+ESVGE V +
Sbjct  76   ILGHEAIGVVESVGEGVTE  94


 Score = 72.4 bits (176),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD V+PIF+ DC EC+DCKS KSNLC+KFPF V P + R +T+RFT+L
Sbjct  97   KGDIVIPIFMADCEECIDCKSTKSNLCSKFPFDVKPWMLRYDTTRFTNL  145



>ref|XP_004158271.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
Length=384

 Score =   122 bits (306),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             +A  PIRCRAAV R  GEPLVIE++IVAPP   EVR++IICTSLC SD+ FWKL+  PG
Sbjct  4    NSAIHPIRCRAAVCRNPGEPLVIEDIIVAPPMPREVRIRIICTSLCQSDIAFWKLKDLPG  63

Query  440  CFPRILGHEAFGVIESVGEDV  502
              PRILGHEAFG++ESVG+DV
Sbjct  64   IVPRILGHEAFGIVESVGKDV  84


 Score = 70.5 bits (171),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGDSV+PIF+ DC EC DC S+KSNLC+KFP ++   + R  TSRFTDL
Sbjct  88   KEGDSVIPIFMADCGECADCLSEKSNLCSKFPVKIALGMPRCGTSRFTDL  137



>ref|XP_004144219.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
 gb|KGN47564.1| hypothetical protein Csa_6G361260 [Cucumis sativus]
Length=384

 Score =   122 bits (306),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             +A  PIRCRAAV R  GEPLVIE++IVAPP   EVR++IICTSLC SD+ FWKL+  PG
Sbjct  4    NSAIHPIRCRAAVCRNPGEPLVIEDIIVAPPMPREVRIRIICTSLCQSDIAFWKLKDLPG  63

Query  440  CFPRILGHEAFGVIESVGEDV  502
              PRILGHEAFG++ESVG+DV
Sbjct  64   IVPRILGHEAFGIVESVGKDV  84


 Score = 70.5 bits (171),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGDSV+PIF+ DC EC DC S+KSNLC+KFP ++   + R  TSRFTDL
Sbjct  88   KEGDSVIPIFMADCGECADCLSEKSNLCSKFPVKIALGMPRCGTSRFTDL  137



>ref|XP_004985405.1| PREDICTED: alcohol dehydrogenase-like 7-like [Setaria italica]
Length=381

 Score =   128 bits (322),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPL IEE++V PPK++EVR++++CTS+CHSDV FW+++ FPG FPR
Sbjct  7    KPIRCKAAVCRAAGEPLAIEEIVVDPPKAYEVRIRVVCTSVCHSDVTFWRMKDFPGVFPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEAFGV+ESVGE  E F
Sbjct  67   IFGHEAFGVVESVGEHAEGF  86


 Score = 64.3 bits (155),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C+EC+DC+S +SN+C++F F V P + RD  +RF D
Sbjct  86   FAAGDAVVPTFLGQCSECVDCRSPRSNMCSRFRFAVRPGMLRDGATRFAD  135



>gb|ACU19225.1| unknown [Glycine max]
Length=188

 Score =   112 bits (280),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T G+ IRC+AA+ RKAGEPL IEE+IVAPP   E R++IIC+SLC +D+ F  +Q  P  
Sbjct  9    TEGQSIRCKAAICRKAGEPLSIEEIIVAPPMPGEARIRIICSSLCQTDISFRNMQDHPAI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
            +PRILGHEA GV+ESVGEDV +
Sbjct  69   YPRILGHEAIGVVESVGEDVTE  90


 Score = 80.5 bits (197),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIFLPDC EC+DCKS KSNLC+KFPF V+P + R  TSRFTDL
Sbjct  93   KGDVVVPIFLPDCGECIDCKSSKSNLCSKFPFEVSPWMPRYATSRFTDL  141



>ref|XP_003519482.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X1 [Glycine 
max]
Length=387

 Score =   112 bits (279),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T G+ IRC+AA+ RKAGEPL IEE+IVAPP   E R++IIC+SLC +D+ F  +Q  P  
Sbjct  9    TEGQSIRCKAAICRKAGEPLSIEEIIVAPPMPGEARIRIICSSLCQTDISFRNMQDHPAI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
            +PRILGHEA GV+ESVGEDV +
Sbjct  69   YPRILGHEAIGVVESVGEDVTE  90


 Score = 80.5 bits (197),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIFLPDC EC+DCKS KSNLC+KFPF V+P + R  TSRFTDL
Sbjct  93   KGDVVVPIFLPDCGECIDCKSSKSNLCSKFPFEVSPWMPRYATSRFTDL  141



>ref|XP_003601300.1| Alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AES71551.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=386

 Score =   112 bits (279),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            GKPIRC+AAVAR+ GE LVIEE++VAPP   EVR++IIC+S+CH D+ F  +Q  PG FP
Sbjct  10   GKPIRCKAAVARRPGESLVIEEIMVAPPMPREVRIRIICSSICHIDLTFSDMQDPPGFFP  69

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA GV+ESVG++V +
Sbjct  70   RILGHEAIGVVESVGKNVTE  89


 Score = 80.1 bits (196),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD V+PIFLPDC EC+DCKS KSNLCT FPF+V+P + R E +RFTDL
Sbjct  92   KGDVVIPIFLPDCGECIDCKSTKSNLCTNFPFKVSPWMPRHENTRFTDL  140



>ref|XP_008219143.1| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 7 
[Prunus mume]
Length=390

 Score =   130 bits (328),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            ++ GKPIRCRAAV+RK GEPLVIEE++VAPP  HEVR++IICTSLC +D+ FWK++ FP 
Sbjct  12   ESRGKPIRCRAAVSRKPGEPLVIEEIMVAPPMPHEVRIRIICTSLCQTDLSFWKMKDFPA  71

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRILGHEA GV+ SVGEDV +
Sbjct  72   IFPRILGHEAIGVVXSVGEDVNE  94


 Score = 60.8 bits (146),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F+ +C EC DCKS +SNLC KFP R +  + R  TSRFTDL
Sbjct  97   EGDTVIPTFVSECGECADCKSTRSNLCAKFP-RPSNFMPRYGTSRFTDL  144



>ref|XP_007141577.1| hypothetical protein PHAVU_008G207700g, partial [Phaseolus vulgaris]
 gb|ESW13571.1| hypothetical protein PHAVU_008G207700g, partial [Phaseolus vulgaris]
Length=384

 Score =   112 bits (280),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T G+P+RC+AA+ RK G  L IEE+IVAPP   E R++IICTSLCH+DV FW +Q  P  
Sbjct  6    TEGQPLRCKAAICRKPGSSLSIEEIIVAPPLPREARIRIICTSLCHTDVTFWNMQVPPET  65

Query  443  FPRILGHEAFGVIESVGEDVED  508
             PRILGHEA GV+ESVGEDV +
Sbjct  66   SPRILGHEAVGVVESVGEDVTE  87


 Score = 76.6 bits (187),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIFLPDC EC+DCKS KSNLC+KFPF   P + RD TSRF +L
Sbjct  90   KGDVVVPIFLPDCGECIDCKSSKSNLCSKFPFEFAPGMPRDGTSRFKNL  138



>ref|XP_007141579.1| hypothetical protein PHAVU_008G2078000g [Phaseolus vulgaris]
 gb|ESW13573.1| hypothetical protein PHAVU_008G2078000g [Phaseolus vulgaris]
Length=389

 Score =   111 bits (277),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T G+P+RC+AA+ RK G PL IE +IVAPP   E R+++ICT+LCH+D+ FW LQ  P  
Sbjct  9    TEGQPLRCKAAICRKPGSPLSIEGIIVAPPLPREARIRVICTTLCHTDLTFWNLQVSPEN  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
             PRILGHEA GV+ESVGEDV +
Sbjct  69   SPRILGHEAVGVVESVGEDVTE  90


 Score = 77.0 bits (188),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD V+PIFLPDC EC+DCKS KSNLC+KFPF  +P + RD TSRF +L
Sbjct  93   KGDVVIPIFLPDCGECIDCKSSKSNLCSKFPFEFSPWMPRDGTSRFKNL  141



>emb|CDP15696.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   125 bits (315),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            TAGKPIRC+AA+ARKAGEPLV+EEV VAPPK+ EVR+KI+CTSLCHSDV FWK    P  
Sbjct  10   TAGKPIRCKAAMARKAGEPLVMEEVEVAPPKAWEVRIKILCTSLCHSDVTFWKTPAGPAS  69

Query  443  -FPRILGHEAFGVIESVGEDVEDF*G  517
             FPRI GHEA GV+ESVGE+VE+  G
Sbjct  70   FFPRIFGHEAAGVVESVGENVEEVKG  95


 Score = 62.0 bits (149),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K GD V+PIF  +C EC DCKS+K N C+KFP +    + RD TSRFTD+
Sbjct  94   KGGDLVLPIFQRNCGECRDCKSEKGNACSKFPVQFYEGMPRDGTSRFTDM  143



>ref|XP_003519481.1| PREDICTED: alcohol dehydrogenase-like 7-like [Glycine max]
Length=386

 Score =   110 bits (275),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  T G+PIRC+AAV RKAGEPL IEE++VAPP   E R++IIC+SLC +D+ F  +Q  
Sbjct  5    LATTEGQPIRCKAAVCRKAGEPLGIEEIMVAPPMPGEARIRIICSSLCRTDISFRNMQGP  64

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P  FP ILGHEA GV+ESVGEDV +
Sbjct  65   PANFPTILGHEAIGVVESVGEDVTE  89


 Score = 74.3 bits (181),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIF+ +C EC+DCKS KSNLC+KFPF+++P + R  TSRF DL
Sbjct  92   KGDMVVPIFIAECGECIDCKSSKSNLCSKFPFKLSPWMPRHATSRFVDL  140



>emb|CDP09729.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   129 bits (325),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            KTAGKPIRCRAAVARKAGEPLVIEE+IVAPPK+ E+RV+++C++LC SD+ FW+L++  G
Sbjct  9    KTAGKPIRCRAAVARKAGEPLVIEEIIVAPPKARELRVRVLCSALCFSDIHFWRLKEPHG  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             +PRI GHE  GV+ESVGE VED
Sbjct  69   YYPRIFGHETVGVVESVGEGVED  91


 Score = 54.7 bits (130),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KVGDTVIPSFLAYCGECPDCISIKSNQCSKLRFELSPYI-RDGTSRFSD  140



>ref|XP_007141581.1| hypothetical protein PHAVU_008G207900g [Phaseolus vulgaris]
 gb|ESW13575.1| hypothetical protein PHAVU_008G207900g [Phaseolus vulgaris]
Length=388

 Score =   110 bits (275),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFP  448
            G+P+RC+AA+ RK G PL IEE+IVAPP   EVR+++ICT+LCH+D+ +W LQ  P   P
Sbjct  11   GQPLRCKAAICRKPGSPLSIEEIIVAPPLPREVRIRVICTTLCHTDLTYWNLQVSPENSP  70

Query  449  RILGHEAFGVIESVGEDVED  508
            RILGHEA GV+ESVGE V +
Sbjct  71   RILGHEAVGVVESVGEGVTE  90


 Score = 73.6 bits (179),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD VVP+FL +C EC+DCKS KSNLC+KFPF  +P + RD TSRF +L
Sbjct  92   KKGDVVVPVFLSECGECIDCKSSKSNLCSKFPFEFSPGMPRDGTSRFKNL  141



>emb|CDP09728.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   128 bits (322),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            KTAGKPIRCRAAVARKAGEPLVIEE+ VAPPK+ E+RV+++C++LC SD+ FW+L++  G
Sbjct  9    KTAGKPIRCRAAVARKAGEPLVIEEITVAPPKARELRVRVLCSALCFSDIHFWRLEEPHG  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             +PRI GHE  GV+ESVGE VED
Sbjct  69   YYPRIFGHETVGVVESVGEGVED  91


 Score = 54.7 bits (130),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KVGDTVIPSFLAYCGECPDCISIKSNQCSKLRFELSPYI-RDGTSRFSD  140



>ref|XP_004291255.1| PREDICTED: alcohol dehydrogenase-like 7 [Fragaria vesca subsp. 
vesca]
Length=393

 Score =   116 bits (291),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
            G + GK IRCRAAV R+  EPLVIEE+IVAPP   EVR+++I TS+CHSD+ FW+++ F 
Sbjct  7    GGSRGKSIRCRAAVCRRPSEPLVIEEIIVAPPMPREVRIRVISTSVCHSDILFWRIKDFA  66

Query  437  GC-FPRILGHEAFGVIESVGEDVED  508
               FPRILGHEA GV+ESVGEDV +
Sbjct  67   AAMFPRILGHEAVGVVESVGEDVNE  91


 Score = 66.6 bits (161),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPF---RVTPLLHRDETSRFTDL  662
            EGD+V+P FL +C EC DCKS KSNLC+K PF   R  P + R  TSRFTDL
Sbjct  94   EGDTVIPTFLAECGECRDCKSPKSNLCSKLPFKSSRTAPFMPRYGTSRFTDL  145



>emb|CDP09731.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   127 bits (320),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            KTAGKPIRCRAAVARKAGEPLVIEE+ VAPPK+ E+RV+++C++LC SD+ FW+L++  G
Sbjct  9    KTAGKPIRCRAAVARKAGEPLVIEEITVAPPKARELRVRVLCSALCFSDIHFWRLKEPHG  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             +PRI GHE  GV+ESVGE +ED
Sbjct  69   YYPRIFGHETVGVVESVGEGIED  91


 Score = 55.1 bits (131),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KVGDTVIPSFLAYCGECPDCTSIKSNQCSKLRFELSPYI-RDGTSRFSD  140



>ref|XP_004238532.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X1 [Solanum lycopersicum]
Length=387

 Score =   129 bits (323),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            TAGKPIRC+AAV RKAGEPL+IEE+ VAPP S EVR+KI+CTSLCHSDV FWKL   P  
Sbjct  9    TAGKPIRCKAAVCRKAGEPLIIEEIEVAPPTSWEVRIKILCTSLCHSDVTFWKLSDGPVS  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRILGHEA GV+ESVGE+VE+
Sbjct  69   AFPRILGHEATGVVESVGENVEE  91


 Score = 53.9 bits (128),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD V+P+F  +C EC DCK  K N+C+KFP      + RD +SRF D
Sbjct  93   KEGDIVIPVFQRNCGECRDCKCPKGNICSKFPEDFLCGMPRDGSSRFKD  141



>ref|XP_006363285.1| PREDICTED: alcohol dehydrogenase-like 1-like isoform X2 [Solanum 
tuberosum]
Length=387

 Score =   128 bits (322),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-  436
            +TAGKPIRC+AAV RKAGEPL+IEE+ VAPP S EVR+KI+CTSLCHSDV FWKL   P 
Sbjct  8    ETAGKPIRCQAAVCRKAGEPLIIEEIEVAPPTSWEVRIKILCTSLCHSDVTFWKLSAGPV  67

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
              FPRILGHEA GV+ESVGE+VE+
Sbjct  68   SAFPRILGHEAAGVVESVGENVEE  91


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD V+P+F  +C EC DCK  K N+C+KFP      + RD +SRF D
Sbjct  93   KEGDIVIPVFQRNCGECRDCKCPKGNICSKFPEDFYCGMPRDGSSRFKD  141



>ref|XP_006363284.1| PREDICTED: alcohol dehydrogenase-like 1-like isoform X1 [Solanum 
tuberosum]
Length=387

 Score =   128 bits (322),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-  436
            +TAGKPIRC+AAV RKAGEPL+IEE+ VAPP S EVR+KI+CTSLCHSDV FWKL   P 
Sbjct  8    ETAGKPIRCQAAVCRKAGEPLIIEEIEVAPPTSWEVRIKILCTSLCHSDVTFWKLSAGPV  67

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
              FPRILGHEA GV+ESVGE+VE+
Sbjct  68   SAFPRILGHEAAGVVESVGENVEE  91


 Score = 53.9 bits (128),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD V+P+F  +C EC DCK  K N+C+KFP      + RD +SRF D
Sbjct  93   KEGDIVIPVFQRNCGECRDCKCPKGNICSKFPEDFYCGMPRDGSSRFKD  141



>gb|KJB64118.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=323

 Score =   121 bits (303),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 60.1 bits (144),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>emb|CDP04608.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   125 bits (314),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             TAGKPI C+AAVARKAGE LVIEE+IVAPPK+HE+RV+++C++LC SD+ FW+L++  G
Sbjct  9    NTAGKPIHCKAAVARKAGEALVIEEIIVAPPKAHELRVRVLCSALCFSDIHFWRLKEPHG  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             +PRI GHE  GV+ESVGE VED
Sbjct  69   YYPRIFGHETVGVVESVGEGVED  91


 Score = 55.5 bits (132),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KVGDTVIPSFLAYCGECPDCTSLKSNQCSKLRFELSPYI-RDGTSRFSD  140



>emb|CDP15616.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   125 bits (314),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            +   +  T GKPI CRAAVARKAGEPLVIEE+IVAPPK+ E+RV+++C++LC SD+ FW+
Sbjct  3    QNQEVSNTVGKPIHCRAAVARKAGEPLVIEEIIVAPPKARELRVRVLCSALCFSDIHFWR  62

Query  422  LQQFPGCFPRILGHEAFGVIESVGEDVED  508
            L++  G +PRI GHE  GV+ESVGE VED
Sbjct  63   LKEPHGYYPRIFGHETVGVVESVGEGVED  91


 Score = 55.5 bits (132),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KVGDTVIPSFLAYCGECPDCTSIKSNQCSKLRFELSPYI-RDGTSRFSD  140



>ref|XP_003602833.1| Alcohol dehydrogenase-like protein [Medicago truncatula]
 gb|AES73084.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=391

 Score =   117 bits (294),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+AA+ +K+GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  13   GKPIRCKAAICKKSGEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMNSSAPTAR  72

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA G++ESVGE+VE+
Sbjct  73   FPRILGHEAVGLVESVGENVEE  94


 Score = 63.2 bits (152),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FLP+C EC+DC S KSN CTKF  +    + RD TSRF D+
Sbjct  96   KEGDLVVPVFLPNCGECIDCGSTKSNNCTKFGNKPIRDMPRDGTSRFRDM  145



>gb|KEH35715.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=327

 Score =   117 bits (294),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 68/82 (83%), Gaps = 2/82 (2%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+AA+ +K+GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  13   GKPIRCKAAICKKSGEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMNSSAPTAR  72

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA G++ESVGE+VE+
Sbjct  73   FPRILGHEAVGLVESVGENVEE  94


 Score = 62.8 bits (151),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FLP+C EC+DC S KSN CTKF  +    + RD TSRF D+
Sbjct  96   KEGDLVVPVFLPNCGECIDCGSTKSNNCTKFGNKPIRDMPRDGTSRFRDM  145



>gb|KJB64119.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=350

 Score =   120 bits (302),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 59.7 bits (143),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>gb|KJB64122.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=383

 Score =   120 bits (302),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 59.7 bits (143),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>gb|KJB64120.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=386

 Score =   120 bits (302),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 59.7 bits (143),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>gb|KJB64115.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=254

 Score =   120 bits (301),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 60.1 bits (144),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>gb|KJB64124.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=243

 Score =   120 bits (301),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 60.1 bits (144),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>emb|CDP09730.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   125 bits (313),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            +   +  T GKPI CRAAVARKAGEPLVIEE+IVAPPK+ E+RV+++C++LC SD+ FW+
Sbjct  3    QNQEVSNTVGKPIHCRAAVARKAGEPLVIEEIIVAPPKARELRVRVLCSALCFSDIHFWR  62

Query  422  LQQFPGCFPRILGHEAFGVIESVGEDVED  508
            L++  G +PRI GHE  GV+ESVGE +ED
Sbjct  63   LKEPHGYYPRIFGHETVGVVESVGEGIED  91


 Score = 55.1 bits (131),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KVGDTVIPSFLAYCGECPDCTSIKSNQCSKLRFELSPYI-RDGTSRFSD  140



>emb|CDP15613.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   124 bits (311),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            +   +  T GKPI CRAAVARKAGEPLVIEE+IVAPPK+ E+RV+++C++LC SD+ FW+
Sbjct  3    QNQEVSNTVGKPIHCRAAVARKAGEPLVIEEIIVAPPKARELRVRVLCSALCFSDIHFWR  62

Query  422  LQQFPGCFPRILGHEAFGVIESVGEDVED  508
            L++  G +PRI GHE  GV+ESVGE V+D
Sbjct  63   LKEPHGYYPRIFGHETVGVVESVGEGVQD  91


 Score = 55.8 bits (133),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD+V+P FL  C EC DC S KSN C+K  F ++P + RD TSRF+D
Sbjct  93   KAGDTVIPSFLAYCGECPDCTSIKSNQCSKLRFELSPYI-RDGTSRFSD  140



>gb|KJB64123.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=333

 Score =   120 bits (301),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 72/92 (78%), Gaps = 2/92 (2%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EKQ   G TAGK IRC+AAV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV FW
Sbjct  2    EKQNRSG-TAGKVIRCKAAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTFW  60

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   KISIGPFALFPRIFGHEAVGVVESVGEHVEEF  92


 Score = 59.7 bits (143),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  142



>ref|XP_006363286.1| PREDICTED: alcohol dehydrogenase-like 1-like [Solanum tuberosum]
Length=388

 Score =   126 bits (316),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +TAGKPIRC+AAV RKAGEPL+IEE+ VAPP S EVR+KI+CTSLC SD+ FWKL   P 
Sbjct  8    QTAGKPIRCKAAVCRKAGEPLIIEEIEVAPPSSWEVRIKILCTSLCQSDLSFWKLSTGPA  67

Query  440  -CFPRILGHEAFGVIESVGEDVED  508
              FPRILGHEA GV+ESVGE+VE+
Sbjct  68   SAFPRILGHEAAGVVESVGENVEE  91


 Score = 53.1 bits (126),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD VVP+F  +C EC DCKS+K N C+KF       + RD +SRF D
Sbjct  93   KTGDIVVPVFKSNCGECRDCKSQKGNGCSKFSVEYPCGMPRDGSSRFKD  141



>ref|XP_002465729.1| hypothetical protein SORBIDRAFT_01g044580 [Sorghum bicolor]
 gb|EER92727.1| hypothetical protein SORBIDRAFT_01g044580 [Sorghum bicolor]
Length=384

 Score =   120 bits (302),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPI C+AAV R AGEPL +EE++V PPK++E+R+++ICTSLCH+DV FWK +  P  FPR
Sbjct  8    KPIHCKAAVCRAAGEPLTVEEIVVDPPKAYEIRIRVICTSLCHTDVTFWKAKVAP-VFPR  66

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVGE VEDF
Sbjct  67   ILGHEAYGVVESVGEHVEDF  86


 Score = 57.4 bits (137),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C+ C  C S+ SN+C   PF + P + RD T+RF D
Sbjct  86   FAAGDTVVPTFLGQCSHCGSCTSEHSNMCDSVPFVIGPGMRRDGTTRFRD  135



>gb|KGN47562.1| hypothetical protein Csa_6G361240 [Cucumis sativus]
Length=387

 Score =   117 bits (294),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +G   GKPIRCRAAV RKAGE L++E+++VAPP  HEVR++IICTSLCH+D+ +WK++  
Sbjct  5    LGMNGGKPIRCRAAVCRKAGEALMMEDIMVAPPLPHEVRIRIICTSLCHTDIKYWKMKDP  64

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            PG  PRI GHEA G +ESVG +V +
Sbjct  65   PGIVPRIFGHEAVGEVESVGVEVSE  89


 Score = 60.5 bits (145),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD V+P F+ +C EC DC S KSNLC+K PF+++  + +  TSRFTDL
Sbjct  91   KQGDFVIPTFMAECEECRDCTSSKSNLCSKQPFKLSQGMPQCGTSRFTDL  140



>dbj|BAJ90549.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88426.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   119 bits (299),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 3/87 (3%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQ---  430
            ++   PIRC+AAV+R  GEPLV+EE++V PPK+HE+R+K+ICTSLCH+D+ FW+ ++   
Sbjct  4    QSLAAPIRCKAAVSRAKGEPLVVEEIVVDPPKAHEIRMKVICTSLCHTDITFWRGKEDFP  63

Query  431  FPGCFPRILGHEAFGVIESVGEDVEDF  511
             P  FPRILGHEA+GV+ESVGE VE F
Sbjct  64   IPPVFPRILGHEAYGVVESVGEQVEGF  90


 Score = 57.8 bits (138),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C  C  C S  SN+C+  PF V P + RD T+RF D
Sbjct  90   FAVGDTVVPTFLGQCDSCGSCASAGSNMCSALPFVVGPGMRRDGTTRFRD  139



>gb|KHG05239.1| hypothetical protein F383_30798 [Gossypium arboreum]
Length=386

 Score =   113 bits (283),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            TAGK IRC+AAV R  GEPL+IEE+ V PPK+ E+R+KI+CTSLCH+DV +WK+   P  
Sbjct  9    TAGKAIRCKAAVCRNPGEPLMIEEIEVEPPKAWEIRIKILCTSLCHTDVTYWKMSTGPFA  68

Query  440  CFPRILGHEAFGVIESVGEDVEDF  511
             FP I GHEA GV+ESVGE VE+F
Sbjct  69   FFPMIFGHEAVGVVESVGEHVEEF  92


 Score = 63.9 bits (154),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F   + P + RD+TSRF  +
Sbjct  92   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGGELVPAMPRDKTSRFKGM  142



>ref|XP_010098631.1| Alcohol dehydrogenase-like 2 [Morus notabilis]
 gb|EXB75370.1| Alcohol dehydrogenase-like 2 [Morus notabilis]
Length=390

 Score =   113 bits (283),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +TAGK IRC+AA+ R  G+PLVIEE+ V PP++ EVR+KI+CTSLCHSDV FWK+   P 
Sbjct  10   ETAGKVIRCKAAICRSPGQPLVIEEIEVDPPQAWEVRIKILCTSLCHSDVTFWKINAGPA  69

Query  440  C-FPRILGHEAFGVIESVGEDVED  508
              FPRI GHEA G++ES GE+VE+
Sbjct  70   SVFPRIFGHEAVGMVESAGENVEE  93


 Score = 63.5 bits (153),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 38/51 (75%), Gaps = 1/51 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPL-LHRDETSRFTDL  662
            KEGD VVP+FLP+C EC DCKSKKSN C+ F +    L + RD++SRF D+
Sbjct  95   KEGDIVVPVFLPNCKECRDCKSKKSNNCSVFKYNKYSLNMPRDQSSRFRDM  145



>ref|XP_008464880.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X3 [Cucumis melo]
Length=380

 Score =   116 bits (290),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 8/111 (7%)
 Frame = +2

Query  176  EREKCVWLCVLYLVLEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPK  355
            E EK   L ++  V+E  S        G   GKPIRCRAAV RKAGE L++E+++V+PP 
Sbjct  16   ELEKIFVLLLILSVMEHKS--------GMNGGKPIRCRAAVCRKAGEALMMEDIMVSPPM  67

Query  356  SHEVRVKIICTSLCHSDVFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
              EVR++IICTSLCH+D+ +WK++  PG  PRILGHEA G +ESVG +V +
Sbjct  68   PREVRIRIICTSLCHTDIKYWKMKDPPGIVPRILGHEAVGEVESVGVEVSE  118


 Score = 60.8 bits (146),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD V+P F+ +C EC DC S KSNLC+K PF+++  + +  TSRFTDL
Sbjct  120  KQGDFVIPTFMAECGECRDCTSSKSNLCSKQPFKLSQGMPQCGTSRFTDL  169



>ref|XP_008464878.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Cucumis melo]
Length=416

 Score =   115 bits (289),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 77/111 (69%), Gaps = 8/111 (7%)
 Frame = +2

Query  176  EREKCVWLCVLYLVLEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPK  355
            E EK   L ++  V+E  S        G   GKPIRCRAAV RKAGE L++E+++V+PP 
Sbjct  16   ELEKIFVLLLILSVMEHKS--------GMNGGKPIRCRAAVCRKAGEALMMEDIMVSPPM  67

Query  356  SHEVRVKIICTSLCHSDVFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
              EVR++IICTSLCH+D+ +WK++  PG  PRILGHEA G +ESVG +V +
Sbjct  68   PREVRIRIICTSLCHTDIKYWKMKDPPGIVPRILGHEAVGEVESVGVEVSE  118


 Score = 60.5 bits (145),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD V+P F+ +C EC DC S KSNLC+K PF+++  + +  TSRFTDL
Sbjct  120  KQGDFVIPTFMAECGECRDCTSSKSNLCSKQPFKLSQGMPQCGTSRFTDL  169



>ref|XP_010676005.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=385

 Score =   114 bits (284),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-  436
            +TAGKPI C+AAV RKAGE L+IE++ VAPP++ EVR+KI+CTSLCH+DV FWK+   P 
Sbjct  11   ETAGKPIICKAAVCRKAGEALIIEDIEVAPPQAWEVRIKILCTSLCHTDVSFWKIDSGPT  70

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
              FP+I GHEA G++ES+GE VE+
Sbjct  71   ANFPKIFGHEAVGIVESIGEHVEE  94


 Score = 62.8 bits (151),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD+VVP+FL DC EC DCKS KSN+CTKF  +    + R++  RF D+
Sbjct  96   KEGDTVVPVFLADCGECRDCKSSKSNVCTKFENKKHSGMPRNKGYRFKDM  145



>ref|XP_010675994.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010676000.1| PREDICTED: alcohol dehydrogenase-like 2 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   113 bits (283),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-  436
            +TAGKPI C+AAV RKAGE L+IE++ VAPP++ EVR+KI+CTSLCH+DV FWK+   P 
Sbjct  11   ETAGKPIICKAAVCRKAGEALIIEDIEVAPPQAWEVRIKILCTSLCHTDVSFWKIDSGPT  70

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
              FP+I GHEA G++ES+GE VE+
Sbjct  71   ANFPKIFGHEAVGIVESIGEHVEE  94


 Score = 62.8 bits (151),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD+VVP+FL DC EC DCKS KSN+CTKF  +    + R++  RF D+
Sbjct  96   KEGDTVVPVFLADCGECRDCKSSKSNVCTKFENKKHSGMPRNKGYRFKDM  145



>ref|XP_006575597.1| PREDICTED: alcohol dehydrogenase-like 7-like isoform X2 [Glycine 
max]
Length=380

 Score = 95.5 bits (236),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 7/82 (9%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T G+ IRC+       GEPL IEE+IVAPP   E R++IIC+SLC +D+ F  +Q  P  
Sbjct  9    TEGQSIRCK-------GEPLSIEEIIVAPPMPGEARIRIICSSLCQTDISFRNMQDHPAI  61

Query  443  FPRILGHEAFGVIESVGEDVED  508
            +PRILGHEA GV+ESVGEDV +
Sbjct  62   YPRILGHEAIGVVESVGEDVTE  83


 Score = 80.5 bits (197),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD VVPIFLPDC EC+DCKS KSNLC+KFPF V+P + R  TSRFTDL
Sbjct  86   KGDVVVPIFLPDCGECIDCKSSKSNLCSKFPFEVSPWMPRYATSRFTDL  134



>ref|XP_007018718.1| GroES-like zinc-binding dehydrogenase family protein isoform 
2 [Theobroma cacao]
 gb|EOY15943.1| GroES-like zinc-binding dehydrogenase family protein isoform 
2 [Theobroma cacao]
Length=387

 Score =   114 bits (286),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            TAGK IRC+AAV+R  GE LVIEE+ V PPKS EVRVKI+CTSLCHSD+ FWK+   P  
Sbjct  9    TAGKAIRCKAAVSRNPGEALVIEEIEVEPPKSWEVRVKILCTSLCHSDITFWKMSTGPFA  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRI GHEA GV+ESVGE V++
Sbjct  69   IFPRIFGHEAVGVVESVGEHVKE  91


 Score = 61.2 bits (147),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F P C EC DCKS+K N C+ F +R+ P + RD TSRF  +
Sbjct  93   QEGDLVLPVFHPHCRECRDCKSQKGNGCSVFGYRLNPDMPRDATSRFKGM  142



>ref|XP_007224791.1| hypothetical protein PRUPE_ppa023795mg [Prunus persica]
 gb|EMJ25990.1| hypothetical protein PRUPE_ppa023795mg [Prunus persica]
Length=371

 Score =   117 bits (292),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +2

Query  290  AAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPRILGHEA  469
            AAV+RK GEPLVIEE++VAPP  HEVR++IICTSLC +D+ FWK++ FP  FPRILGHEA
Sbjct  3    AAVSRKPGEPLVIEEIMVAPPMPHEVRIRIICTSLCQTDLSFWKMKDFPAIFPRILGHEA  62

Query  470  FGVIESVGEDVED  508
             GV+ESVGEDV +
Sbjct  63   IGVVESVGEDVNE  75


 Score = 59.3 bits (142),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 1/49 (2%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD+V+P F  +C EC DCKS +SNLC KFP R +  + R  TSRFTDL
Sbjct  78   EGDTVIPTFKSECGECADCKSTRSNLCAKFP-RPSIFMPRYGTSRFTDL  125



>ref|XP_008464879.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X2 [Cucumis melo]
Length=387

 Score =   115 bits (287),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +2

Query  257  GKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP  436
            G   GKPIRCRAAV RKAGE L++E+++V+PP   EVR++IICTSLCH+D+ +WK++  P
Sbjct  6    GMNGGKPIRCRAAVCRKAGEALMMEDIMVSPPMPREVRIRIICTSLCHTDIKYWKMKDPP  65

Query  437  GCFPRILGHEAFGVIESVGEDVED  508
            G  PRILGHEA G +ESVG +V +
Sbjct  66   GIVPRILGHEAVGEVESVGVEVSE  89


 Score = 60.8 bits (146),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD V+P F+ +C EC DC S KSNLC+K PF+++  + +  TSRFTDL
Sbjct  91   KQGDFVIPTFMAECGECRDCTSSKSNLCSKQPFKLSQGMPQCGTSRFTDL  140



>ref|XP_007018717.1| GroES-like zinc-binding dehydrogenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY15942.1| GroES-like zinc-binding dehydrogenase family protein isoform 
1 [Theobroma cacao]
Length=406

 Score =   114 bits (286),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            TAGK IRC+AAV+R  GE LVIEE+ V PPKS EVRVKI+CTSLCHSD+ FWK+   P  
Sbjct  9    TAGKAIRCKAAVSRNPGEALVIEEIEVEPPKSWEVRVKILCTSLCHSDITFWKMSTGPFA  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRI GHEA GV+ESVGE V++
Sbjct  69   IFPRIFGHEAVGVVESVGEHVKE  91


 Score = 61.2 bits (147),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F P C EC DCKS+K N C+ F +R+ P + RD TSRF  +
Sbjct  93   QEGDLVLPVFHPHCRECRDCKSQKGNGCSVFGYRLNPDMPRDATSRFKGM  142



>ref|XP_007018720.1| GroES-like zinc-binding dehydrogenase family protein isoform 
4 [Theobroma cacao]
 gb|EOY15945.1| GroES-like zinc-binding dehydrogenase family protein isoform 
4 [Theobroma cacao]
Length=369

 Score =   114 bits (286),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            TAGK IRC+AAV+R  GE LVIEE+ V PPKS EVRVKI+CTSLCHSD+ FWK+   P  
Sbjct  9    TAGKAIRCKAAVSRNPGEALVIEEIEVEPPKSWEVRVKILCTSLCHSDITFWKMSTGPFA  68

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRI GHEA GV+ESVGE V++
Sbjct  69   IFPRIFGHEAVGVVESVGEHVKE  91


 Score = 61.2 bits (147),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F P C EC DCKS+K N C+ F +R+ P + RD TSRF  +
Sbjct  93   QEGDLVLPVFHPHCRECRDCKSQKGNGCSVFGYRLNPDMPRDATSRFKGM  142



>ref|XP_004158272.1| PREDICTED: alcohol dehydrogenase-like 7-like [Cucumis sativus]
Length=381

 Score =   115 bits (287),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
              GKPIRCRAAV RKAGE L++E+++VAPP  HEVR++IICTSLCH+D+ +WK++  PG 
Sbjct  2    NGGKPIRCRAAVCRKAGEALMMEDIMVAPPLPHEVRIRIICTSLCHTDIKYWKMKDPPGI  61

Query  443  FPRILGHEAFGVIESVGEDVED  508
             PRI GHEA G +ESVG +V +
Sbjct  62   VPRIFGHEAVGEVESVGVEVSE  83


 Score = 60.5 bits (145),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            K+GD V+P F+ +C EC DC S KSNLC+K PF+++  + +  TSRFTDL
Sbjct  85   KQGDFVIPTFMAECEECRDCTSSKSNLCSKQPFKLSQGMPQCGTSRFTDL  134



>ref|XP_004501694.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X2 [Cicer 
arietinum]
Length=390

 Score =   113 bits (282),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+AA+ +K+GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  12   GKPIRCKAAICKKSGEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMDSSAPAAK  71

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FP ILGHEA GV+ESVGE VE+
Sbjct  72   FPIILGHEAVGVVESVGEHVEE  93


 Score = 62.0 bits (149),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FL +C EC DC+S+KSN+C+KF       + RD TSRF D+
Sbjct  95   KEGDLVVPVFLANCGECRDCESRKSNMCSKFGSGAIRDMPRDGTSRFRDM  144



>ref|XP_004501693.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X1 [Cicer 
arietinum]
Length=389

 Score =   113 bits (282),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+AA+ +K+GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  12   GKPIRCKAAICKKSGEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMDSSAPAAK  71

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FP ILGHEA GV+ESVGE VE+
Sbjct  72   FPIILGHEAVGVVESVGEHVEE  93


 Score = 62.0 bits (149),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FL +C EC DC+S+KSN+C+KF       + RD TSRF D+
Sbjct  95   KEGDLVVPVFLANCGECRDCESRKSNMCSKFGSGAIRDMPRDGTSRFRDM  144



>gb|KJB64121.1| hypothetical protein B456_010G038400 [Gossypium raimondii]
Length=387

 Score =   115 bits (288),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCR-AAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            EKQ   G TAGK IRC+ +AV R  GEPLVIEE++V PPK+ E+R+KI+CTSLCHSDV F
Sbjct  2    EKQNRSG-TAGKVIRCKGSAVCRNPGEPLVIEEIMVDPPKAWEIRIKILCTSLCHSDVTF  60

Query  416  WKLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            WK+   P   FPRI GHEA GV+ESVGE VE+F
Sbjct  61   WKISIGPFALFPRIFGHEAVGVVESVGEHVEEF  93


 Score = 59.7 bits (143),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            F+EGD VVP+F P+C EC DCKS+K N C+ F  ++   + RD TSRF  +
Sbjct  93   FQEGDMVVPVFRPNCRECRDCKSQKGNGCSIFGDKLVAEMPRDGTSRFKGM  143



>tpg|DAA43802.1| TPA: putative alcohol dehydrogenase superfamily protein [Zea 
mays]
Length=264

 Score =   117 bits (294),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 7/92 (8%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            AE ++P      KPI C+AAV R AGEPL IEE++V PPK++E+R+++ICTSLCH+D+ F
Sbjct  2    AEDRSP------KPIHCKAAVCRAAGEPLTIEEIVVDPPKAYEIRIRVICTSLCHTDITF  55

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WK +  P  FPRILGHEA+GV+ESVGE VE F
Sbjct  56   WKAKVAP-VFPRILGHEAYGVVESVGEHVEGF  86


 Score = 57.0 bits (136),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C  C  C S+ SN+C   PF + P + RD T+RF D
Sbjct  86   FAAGDTVVPTFLGQCERCASCASEHSNVCDAVPFVIGPGMRRDGTTRFRD  135



>ref|NP_001141131.1| uncharacterized protein LOC100273217 [Zea mays]
 gb|ACF85487.1| unknown [Zea mays]
 tpg|DAA43803.1| TPA: putative alcohol dehydrogenase superfamily protein [Zea 
mays]
Length=383

 Score =   117 bits (294),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 7/92 (8%)
 Frame = +2

Query  236  AEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFF  415
            AE ++P      KPI C+AAV R AGEPL IEE++V PPK++E+R+++ICTSLCH+D+ F
Sbjct  2    AEDRSP------KPIHCKAAVCRAAGEPLTIEEIVVDPPKAYEIRIRVICTSLCHTDITF  55

Query  416  WKLQQFPGCFPRILGHEAFGVIESVGEDVEDF  511
            WK +  P  FPRILGHEA+GV+ESVGE VE F
Sbjct  56   WKAKVAP-VFPRILGHEAYGVVESVGEHVEGF  86


 Score = 56.6 bits (135),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C  C  C S+ SN+C   PF + P + RD T+RF D
Sbjct  86   FAAGDTVVPTFLGQCERCASCASEHSNVCDAVPFVIGPGMRRDGTTRFRD  135



>ref|XP_004501695.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X3 [Cicer 
arietinum]
Length=302

 Score =   112 bits (281),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 2/82 (2%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+AA+ +K+GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  12   GKPIRCKAAICKKSGEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMDSSAPAAK  71

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FP ILGHEA GV+ESVGE VE+
Sbjct  72   FPIILGHEAVGVVESVGEHVEE  93


 Score = 62.0 bits (149),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FL +C EC DC+S+KSN+C+KF       + RD TSRF D+
Sbjct  95   KEGDLVVPVFLANCGECRDCESRKSNMCSKFGSGAIRDMPRDGTSRFRDM  144



>ref|XP_010916712.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X1 [Elaeis guineensis]
Length=383

 Score =   111 bits (277),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPL IEEV VAPPK+HE R+KI+CTSLCHSD+ FW+L+ FPG +PR
Sbjct  9    KPIRCKAAVCRAAGEPLQIEEVEVAPPKAHEARIKIVCTSLCHSDLTFWRLKDFPGVYPR  68

Query  452  ILGHEA  469
            I GHEA
Sbjct  69   IFGHEA  74


 Score = 62.8 bits (151),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  522  DSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            D+VVP FL  C +C+DC+S++SNLC+K PF + P + RD T+RFTD
Sbjct  92   DTVVPTFLAHCKDCVDCRSERSNLCSKLPFNLIPGMPRDRTTRFTD  137



>ref|XP_004238533.1| PREDICTED: alcohol dehydrogenase-like 1 [Solanum lycopersicum]
Length=384

 Score =   122 bits (306),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GC  442
            AGKPI+C+AAV RKAGEPL+IEE+ VAPP S EVR+KI+CTSLC SD+ FWKL   P   
Sbjct  6    AGKPIKCKAAVCRKAGEPLIIEEIEVAPPSSWEVRIKILCTSLCQSDLSFWKLSTGPSSA  65

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA GV+ESVGE+VE+
Sbjct  66   FPRILGHEAAGVVESVGENVEE  87


 Score = 51.6 bits (122),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD VVP+F  +C EC DCKS+K N C+KF       + +D +SRF D
Sbjct  89   KTGDIVVPVFKRNCGECRDCKSQKGNGCSKFSVEYRCGMPKDGSSRFKD  137



>ref|XP_010916713.1| PREDICTED: alcohol dehydrogenase-like 7 isoform X2 [Elaeis guineensis]
Length=329

 Score =   111 bits (277),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPL IEEV VAPPK+HE R+KI+CTSLCHSD+ FW+L+ FPG +PR
Sbjct  9    KPIRCKAAVCRAAGEPLQIEEVEVAPPKAHEARIKIVCTSLCHSDLTFWRLKDFPGVYPR  68

Query  452  ILGHEA  469
            I GHEA
Sbjct  69   IFGHEA  74


 Score = 62.4 bits (150),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  522  DSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            D+VVP FL  C +C+DC+S++SNLC+K PF + P + RD T+RFTD
Sbjct  92   DTVVPTFLAHCKDCVDCRSERSNLCSKLPFNLIPGMPRDRTTRFTD  137



>gb|EMT04315.1| Alcohol dehydrogenase-like protein 2 [Aegilops tauschii]
Length=365

 Score =   114 bits (286),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 68/82 (83%), Gaps = 3/82 (4%)
 Frame = +2

Query  275  PIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQ---FPGCF  445
            PIRC+AAV+R  G PLVIE+++V PPK++E+R+K+ICTSLCH+D+ FW+ ++    P  F
Sbjct  8    PIRCKAAVSRAKGAPLVIEDIVVDPPKAYEIRMKVICTSLCHTDITFWRGKEDFPLPPVF  67

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA+GV+ESVGE VE F
Sbjct  68   PRILGHEAYGVVESVGERVEGF  89


 Score = 58.5 bits (140),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C  C  C S  SN+C+  PF V P + RD T+RF D
Sbjct  89   FAVGDTVVPTFLGQCDSCAGCASAGSNMCSALPFVVGPGMRRDGTTRFRD  138



>ref|XP_007018721.1| GroES-like zinc-binding dehydrogenase family protein isoform 
5, partial [Theobroma cacao]
 gb|EOY15946.1| GroES-like zinc-binding dehydrogenase family protein isoform 
5, partial [Theobroma cacao]
Length=303

 Score =   112 bits (280),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GC  442
            AGK IRC+AAV+R  GE LVIEE+ V PPKS EVRVKI+CTSLCHSD+ FWK+   P   
Sbjct  1    AGKAIRCKAAVSRNPGEALVIEEIEVEPPKSWEVRVKILCTSLCHSDITFWKMSTGPFAI  60

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRI GHEA GV+ESVGE V++
Sbjct  61   FPRIFGHEAVGVVESVGEHVKE  82


 Score = 60.8 bits (146),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F P C EC DCKS+K N C+ F +R+ P + RD TSRF  +
Sbjct  84   QEGDLVLPVFHPHCRECRDCKSQKGNGCSVFGYRLNPDMPRDATSRFKGM  133



>ref|XP_006828009.1| hypothetical protein AMTR_s00008p00243660 [Amborella trichopoda]
 gb|ERM95425.1| hypothetical protein AMTR_s00008p00243660 [Amborella trichopoda]
Length=386

 Score =   109 bits (273),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 65/83 (78%), Gaps = 1/83 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +T GKPIRC+AAV    GE LVIEE+ VAPP+  EVR+K+ICTSLCHSD  FW+L+  P 
Sbjct  4    QTKGKPIRCKAAVCWNPGEALVIEEIEVAPPEQWEVRIKVICTSLCHSDFTFWQLKGQPD  63

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRI GHEA GV+ESVGE V++
Sbjct  64   -FPRIFGHEAVGVVESVGEGVDE  85


 Score = 63.5 bits (153),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP FLP+C +C DCKS KSN+C K  F+VT  + R  T+RF+ L
Sbjct  87   KEGDLVVPFFLPECGDCADCKSPKSNICGKVIFKVTGGMIRSGTTRFSAL  136



>ref|XP_007141580.1| hypothetical protein PHAVU_008G2078000g, partial [Phaseolus vulgaris]
 gb|ESW13574.1| hypothetical protein PHAVU_008G2078000g, partial [Phaseolus vulgaris]
Length=371

 Score = 95.9 bits (237),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +2

Query  293  AVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPRILGHEAF  472
            A+ RK G PL IE +IVAPP   E R+++ICT+LCH+D+ FW LQ  P   PRILGHEA 
Sbjct  1    AICRKPGSPLSIEGIIVAPPLPREARIRVICTTLCHTDLTFWNLQVSPENSPRILGHEAV  60

Query  473  GVIESVGEDVED  508
            GV+ESVGEDV +
Sbjct  61   GVVESVGEDVTE  72


 Score = 77.0 bits (188),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +GD V+PIFLPDC EC+DCKS KSNLC+KFPF  +P + RD TSRF +L
Sbjct  75   KGDVVIPIFLPDCGECIDCKSSKSNLCSKFPFEFSPWMPRDGTSRFKNL  123



>ref|XP_002890514.1| hypothetical protein ARALYDRAFT_472484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66773.1| hypothetical protein ARALYDRAFT_472484 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   123 bits (308),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
            +A +  T GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KI+CTSLCH+DV FWKL
Sbjct  3    KASLSSTEGKPIRCKAAILRKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKL  62

Query  425  QQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            +  P   FPRILGHEA GV+ES+G +V+ F
Sbjct  63   ESGPLARFPRILGHEAVGVVESIGANVDGF  92


 Score = 49.3 bits (116),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            FK+GD V+P+F P C EC +CKS KSN CT++         R   TSRF D
Sbjct  92   FKQGDVVLPVFQPQCEECKECKSPKSNWCTRYTNDFLSNTRRYGMTSRFKD  142



>ref|XP_010664347.1| PREDICTED: alcohol dehydrogenase-like 1 [Vitis vinifera]
 emb|CBI19197.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   109 bits (272),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +TAGK I C+AA+ ++ GE LVIEE+ VAPP++ E+R+KI+CTSLCH+DV FWK+   P 
Sbjct  8    ETAGKAITCKAAICKEPGEALVIEEIEVAPPEAWEIRIKILCTSLCHTDVTFWKMNDGPE  67

Query  440  -CFPRILGHEAFGVIESVGEDVED  508
              FP+ILGHEA GV+ESVGE VE+
Sbjct  68   RSFPKILGHEAVGVVESVGEHVEE  91


 Score = 62.8 bits (151),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FLP C EC DC S KSNLCTKF  +    + RD +SRF ++
Sbjct  93   KEGDLVVPVFLPSCKECRDCTSTKSNLCTKFGSKFYQGMPRDGSSRFRNM  142



>ref|XP_006828005.1| hypothetical protein AMTR_s00008p00242230 [Amborella trichopoda]
 gb|ERM95421.1| hypothetical protein AMTR_s00008p00242230 [Amborella trichopoda]
Length=387

 Score =   105 bits (261),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +T GKPIRC+AAV    GE LVIEE+ VAPP+ +EVR+K+ICTSLCHSD+ +   +  P 
Sbjct  4    QTKGKPIRCKAAVCWNPGEVLVIEEIEVAPPQGYEVRIKVICTSLCHSDITYRNRKDLPL  63

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FP I GHEA GV+ESVGE V++
Sbjct  64   PFPLIFGHEAVGVVESVGEGVDE  86


 Score = 67.4 bits (163),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP FLP+C +C DCKS KSNLCTK PF++   + R  T+RF+ L
Sbjct  88   KEGDLVVPFFLPECGDCTDCKSPKSNLCTKVPFQIAGSMIRSGTTRFSAL  137



>ref|XP_003558622.1| PREDICTED: alcohol dehydrogenase-like 7 [Brachypodium distachyon]
Length=382

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPLV+EE++V PPK+HEVR+KI+CTSLCHSDV FW+++ FPG FPR
Sbjct  8    KPIRCKAAVCRAAGEPLVVEEIVVEPPKAHEVRIKIVCTSLCHSDVTFWRMKDFPGVFPR  67

Query  452  ILGHEAFGVIESVGEDVEDF  511
            I GHEAFGV+ESVGE VE F
Sbjct  68   IFGHEAFGVVESVGEHVEGF  87


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +3

Query  441  VFQESWATKLLGL*RV*EKMLRIFKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVT  620
            VF   +  +  G+     + +  F  GD+VVP FL  C EC DCKS +SN+C+K+ F V 
Sbjct  64   VFPRIFGHEAFGVVESVGEHVEGFAAGDAVVPTFLAQCGECPDCKSSRSNVCSKYRFMVR  123

Query  621  PLLHRDETSRFTD  659
            P + RDET+RF D
Sbjct  124  PGMPRDETTRFVD  136



>ref|NP_173660.1| alcohol dehydrogenase-like 2 [Arabidopsis thaliana]
 sp|Q9SK87.1|ADHL2_ARATH RecName: Full=Alcohol dehydrogenase-like 2 [Arabidopsis thaliana]
 gb|AAF18533.1|AC006551_19 Very similar to alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAT71918.1| At1g22440 [Arabidopsis thaliana]
 gb|AAU15136.1| At1g22440 [Arabidopsis thaliana]
 gb|AEE30242.1| alcohol dehydrogenase-like 2 [Arabidopsis thaliana]
Length=386

 Score =   123 bits (309),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            T GKPIRC+AA+ RKAGEPLVIEE+ V PP+++EVR+KI+CTSLCH+DV FWKL   P  
Sbjct  7    TEGKPIRCKAAILRKAGEPLVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKLDSGPLA  66

Query  440  CFPRILGHEAFGVIESVGEDVEDF  511
             FPRILGHEA GV+ES+GE V+ F
Sbjct  67   RFPRILGHEAVGVVESIGEKVDGF  90


 Score = 47.4 bits (111),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            FK+GD V+P+F P C EC +C S KSN CTK+         R   TSRF D
Sbjct  90   FKQGDVVLPVFHPQCEECKECISPKSNWCTKYTNDYLSNTRRYGMTSRFKD  140



>gb|KFK44339.1| hypothetical protein AALP_AA1G245200 [Arabis alpina]
Length=389

 Score =   120 bits (302),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
             K        GKPIRC+AAV RKAGEP V+EEV V PP+++EVR+KI+CTSLCH+DV FW
Sbjct  2    NKTTSFSINKGKPIRCKAAVCRKAGEPFVMEEVQVDPPEAYEVRIKILCTSLCHTDVTFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRILGHEA GV+ES+GE+V+ F
Sbjct  62   KIDSGPLARFPRILGHEAVGVVESIGENVDGF  93


 Score = 49.7 bits (117),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            FK+GD V+P+F P C EC DCKS KSN C++F 
Sbjct  93   FKQGDIVLPVFHPQCEECKDCKSSKSNWCSRFA  125



>gb|EEC74659.1| hypothetical protein OsI_10323 [Oryza sativa Indica Group]
Length=379

 Score =   115 bits (289),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 2/80 (3%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R A EPL++EE++V PPK++E+R+KIICTSLCH+DV  W   +    FPR
Sbjct  7    KPIRCKAAVCRAASEPLIVEEIVVDPPKAYEIRIKIICTSLCHTDVTLW--HKVDPAFPR  64

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVGE+VE F
Sbjct  65   ILGHEAYGVVESVGENVEGF  84


 Score = 54.7 bits (130),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP F+  C  C  C ++ +N CT  PF + P + RD T+RF D
Sbjct  84   FAAGDTVVPTFMGQCDSCASCAAEWTNQCTAVPFTMGPGMRRDGTTRFWD  133



>ref|XP_006416200.1| hypothetical protein EUTSA_v10007878mg [Eutrema salsugineum]
 gb|ESQ34553.1| hypothetical protein EUTSA_v10007878mg [Eutrema salsugineum]
Length=389

 Score =   120 bits (302),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPIRC+AAV RKAGE LVIEE+ V PP+++EVR+KI+CTSLCH+DV FWK+   P   F
Sbjct  11   GKPIRCKAAVCRKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKIDSGPLARF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE+VE F
Sbjct  71   PRILGHEAVGVVESIGENVEGF  92


 Score = 49.7 bits (117),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            FK+GD V+P+F P C EC DCKS KSN C +F 
Sbjct  92   FKQGDVVLPVFHPQCEECKDCKSSKSNWCARFA  124



>ref|XP_006416199.1| hypothetical protein EUTSA_v10007889mg [Eutrema salsugineum]
 gb|ESQ34552.1| hypothetical protein EUTSA_v10007889mg [Eutrema salsugineum]
Length=387

 Score =   121 bits (304),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC-F  445
            GKPIRC+AAV RKAGE LVIEE+ V PP+++EVR+KI+CTSLCH+D+ FWKL   P   F
Sbjct  10   GKPIRCKAAVCRKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDLTFWKLDSGPAARF  69

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE+V+ F
Sbjct  70   PRILGHEAVGVVESIGENVDGF  91


 Score = 48.1 bits (113),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            FK+GD V+P+F P C +C DCKS KSN C +F 
Sbjct  91   FKQGDVVLPVFHPQCEDCKDCKSSKSNWCARFA  123



>gb|KDP41414.1| hypothetical protein JCGZ_15821 [Jatropha curcas]
Length=388

 Score =   113 bits (282),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            I  TAGK IRC+AA+ R  G+PL+IEE+ V PPK+ EVR++IICTSLCHSDV FW +   
Sbjct  6    IAATAGKTIRCKAAICRSPGQPLLIEEIEVNPPKAWEVRIRIICTSLCHSDVTFWNMNPG  65

Query  434  P-GCFPRILGHEAFGVIESVGEDVED  508
            P   FPRI GHEA GV+ESVGE VE+
Sbjct  66   PVSNFPRIFGHEAAGVVESVGEYVEE  91


 Score = 55.8 bits (133),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 1/51 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPL-LHRDETSRFTDL  662
            KEG+ V+P+F P C EC DCKS KSN C+KF        + RD TSRF D+
Sbjct  93   KEGEFVLPVFAPSCGECRDCKSSKSNNCSKFKVGAGEFGMPRDGTSRFRDM  143



>ref|XP_010477503.1| PREDICTED: alcohol dehydrogenase-like 2 [Camelina sativa]
Length=388

 Score =   120 bits (301),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            ++A    T GKPIRC+AA+ RKAGEPLV+EE+ V PP+++EVR+KI+CTSLCH+D+ F K
Sbjct  2    EKASFSSTQGKPIRCKAAILRKAGEPLVMEEIQVDPPRAYEVRIKILCTSLCHTDLTFSK  61

Query  422  LQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            L   P   FPRILGHEA GV+ES+GE+V+ F
Sbjct  62   LDNGPLARFPRILGHEAVGVVESIGENVDGF  92


 Score = 48.5 bits (114),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FKEGD V+P+F P C EC DCKS KSN C  F
Sbjct  92   FKEGDVVLPVFHPQCEECKDCKSPKSNWCKSF  123



>ref|XP_003561960.1| PREDICTED: alcohol dehydrogenase-like 2 [Brachypodium distachyon]
Length=387

 Score =   112 bits (281),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 67/83 (81%), Gaps = 3/83 (4%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQ---FPGC  442
            KPIRC+AAV R  G PLVIE++ V  PK++E+R+KIICTSLCH+D+ FW++++    P  
Sbjct  7    KPIRCKAAVCRANGAPLVIEDIFVDAPKAYEIRIKIICTSLCHTDLTFWRVKEEFGIPPL  66

Query  443  FPRILGHEAFGVIESVGEDVEDF  511
            FPRILGHEA+GV+ESVGE VE +
Sbjct  67   FPRILGHEAYGVVESVGERVEGY  89


 Score = 55.8 bits (133),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            +  GD+VVP FL  C  C  C S+ +N+C+  PF + P + RD T+RF D
Sbjct  89   YAAGDTVVPTFLGQCESCSSCASEGNNMCSAVPFALGPGMRRDGTTRFRD  138



>ref|XP_010498712.1| PREDICTED: alcohol dehydrogenase-like 2 [Camelina sativa]
Length=388

 Score =   120 bits (302),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            ++A    T GKPIRC+AA+ RKAGEPLVIEE+ V PP+++EVR+KI+CTSLCH+D+ F K
Sbjct  2    EKASFSSTQGKPIRCKAAILRKAGEPLVIEEIQVDPPRAYEVRIKILCTSLCHTDLTFSK  61

Query  422  LQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            L   P   FPRILGHEA GV+ES+GE+V+ F
Sbjct  62   LDSGPLARFPRILGHEAVGVVESIGENVDGF  92


 Score = 47.0 bits (110),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C  F
Sbjct  92   FKQGDVVLPVFHPHCEECKDCKSPKSNWCKSF  123



>ref|XP_007017963.1| Zinc-binding alcohol dehydrogenase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY15188.1| Zinc-binding alcohol dehydrogenase family protein isoform 2 [Theobroma 
cacao]
Length=354

 Score = 92.8 bits (229),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  338  IVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPRILGHEAFGVIESVGEDVED  508
            +VAPP  +EVR++IICTSLCHSD+ FWKL+  P CFPRILGHEA GV+ESVGE+V++
Sbjct  1    MVAPPSPYEVRIRIICTSLCHSDIIFWKLKVPPACFPRILGHEAVGVVESVGENVDE  57


 Score = 74.7 bits (182),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +3

Query  516  EGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            EGD V+P FL DC EC DC+S+KSNLC+KFPFRV P + R + SRFTDL
Sbjct  60   EGDVVIPTFLSDCGECADCRSEKSNLCSKFPFRVHPWMPRYDASRFTDL  108



>emb|CDX91678.1| BnaC08g05970D [Brassica napus]
Length=390

 Score =   118 bits (296),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K + +    GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KI+CTSLCH+DV FW
Sbjct  2    DKTSSVSIHEGKPIRCKAALCRKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDVAFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            KL+  P   FPRILGHEA GV+ES+GE V+ F
Sbjct  62   KLEWGPLARFPRILGHEAVGVVESIGELVDGF  93


 Score = 48.9 bits (115),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C++F
Sbjct  93   FKQGDVVLPVFHPHCEECRDCKSPKSNWCSRF  124



>ref|XP_009145341.1| PREDICTED: alcohol dehydrogenase-like 1 [Brassica rapa]
Length=389

 Score =   117 bits (294),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K +      GKPIRC+AA+ RKAGE LV+EE+ V PP+++EVR+KIICTSLCH+DV FW
Sbjct  2    DKTSSFSIQKGKPIRCKAALCRKAGEALVMEEIQVDPPQAYEVRIKIICTSLCHTDVTFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            KL   P   FPRILGHE+ G++ES+GE V+ F
Sbjct  62   KLDSGPLARFPRILGHESVGLVESIGEHVDGF  93


 Score = 50.1 bits (118),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPF-RVTPLLHRDETSRFTD  659
            FK+GD V+P+F P+C EC DCKS KSN C ++    ++        SRF D
Sbjct  93   FKQGDVVLPVFHPNCEECKDCKSSKSNWCARYANDSISNTRRYGMASRFKD  143



>emb|CDY21362.1| BnaA09g30650D [Brassica napus]
Length=390

 Score =   117 bits (293),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K +      GKPIRC+AA+ RKAGE LV+EE+ V PP+++EVR+KIICTSLCH+DV FW
Sbjct  2    DKTSSFSIQKGKPIRCKAALCRKAGEALVMEEIQVDPPQAYEVRIKIICTSLCHTDVTFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            KL   P   FPRILGHE+ G++ES+GE V+ F
Sbjct  62   KLDSGPLARFPRILGHESVGLVESIGEHVDGF  93


 Score = 50.1 bits (118),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPF-RVTPLLHRDETSRFTD  659
            FK+GD V+P+F P+C EC DCKS KSN C ++    ++        SRF D
Sbjct  93   FKQGDVVLPVFHPNCEECKDCKSSKSNWCARYANDSISNTRRYGMASRFKD  143



>emb|CDY00452.1| BnaC07g13740D [Brassica napus]
Length=390

 Score =   117 bits (293),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC-F  445
            GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KIICTSLCH+D+ +WKL   P   F
Sbjct  12   GKPIRCKAAICRKAGEALVIEEIQVDPPQAYEVRIKIICTSLCHTDITYWKLTHGPRAKF  71

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            P+ILGHEA GV+ES+GE V+ F
Sbjct  72   PKILGHEAVGVVESIGEHVDGF  93


 Score = 49.7 bits (117),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C +F
Sbjct  93   FKQGDVVLPVFYPQCEECKDCKSPKSNWCARF  124



>ref|XP_009103237.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X1 [Brassica 
rapa]
Length=389

 Score =   117 bits (293),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC-F  445
            GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KIICTSLCH+D+ +WKL   P   F
Sbjct  12   GKPIRCKAAICRKAGEALVIEEIQVDPPQAYEVRIKIICTSLCHTDITYWKLTHGPRAKF  71

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            P+ILGHEA GV+ES+GE V+ F
Sbjct  72   PKILGHEAVGVVESIGEHVDGF  93


 Score = 49.7 bits (117),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C +F
Sbjct  93   FKQGDVVLPVFYPQCEECKDCKSPKSNWCARF  124



>ref|XP_009103238.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X2 [Brassica 
rapa]
Length=358

 Score =   117 bits (292),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC-F  445
            GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KIICTSLCH+D+ +WKL   P   F
Sbjct  12   GKPIRCKAAICRKAGEALVIEEIQVDPPQAYEVRIKIICTSLCHTDITYWKLTHGPRAKF  71

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            P+ILGHEA GV+ES+GE V+ F
Sbjct  72   PKILGHEAVGVVESIGEHVDGF  93


 Score = 49.7 bits (117),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C +F
Sbjct  93   FKQGDVVLPVFYPQCEECKDCKSPKSNWCARF  124



>gb|KEH35713.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=384

 Score =   103 bits (257),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 9/82 (11%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+       GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  13   GKPIRCK-------GEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMNSSAPTAR  65

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA G++ESVGE+VE+
Sbjct  66   FPRILGHEAVGLVESVGENVEE  87


 Score = 63.2 bits (152),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FLP+C EC+DC S KSN CTKF  +    + RD TSRF D+
Sbjct  89   KEGDLVVPVFLPNCGECIDCGSTKSNNCTKFGNKPIRDMPRDGTSRFRDM  138



>gb|KEH35714.1| zinc-binding alcohol dehydrogenase family protein [Medicago truncatula]
Length=320

 Score =   103 bits (257),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 9/82 (11%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF--PGC  442
            GKPIRC+       GEPLVIEEV + PPKS EVR+KI+CTSLCHSDV FWK+        
Sbjct  13   GKPIRCK-------GEPLVIEEVELDPPKSWEVRIKILCTSLCHSDVTFWKMNSSAPTAR  65

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRILGHEA G++ESVGE+VE+
Sbjct  66   FPRILGHEAVGLVESVGENVEE  87


 Score = 62.8 bits (151),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KEGD VVP+FLP+C EC+DC S KSN CTKF  +    + RD TSRF D+
Sbjct  89   KEGDLVVPVFLPNCGECIDCGSTKSNNCTKFGNKPIRDMPRDGTSRFRDM  138



>emb|CDY71245.1| BnaAnng36660D [Brassica napus]
Length=253

 Score =   116 bits (291),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC-F  445
            GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KIICTSLCH+D+ +WKL   P   F
Sbjct  12   GKPIRCKAAICRKAGEALVIEEIQVDPPQAYEVRIKIICTSLCHTDITYWKLTHGPRAKF  71

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            P+ILGHEA GV+ES+GE V+ F
Sbjct  72   PKILGHEAVGVVESIGEHVDGF  93


 Score = 49.7 bits (117),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C +F
Sbjct  93   FKQGDVVLPVFYPQCEECKDCKSPKSNWCARF  124



>ref|XP_010459997.1| PREDICTED: alcohol dehydrogenase-like 2 [Camelina sativa]
Length=388

 Score =   120 bits (302),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 1/91 (1%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            ++A    T GKPIRC+AA+ RKAGEPLVIEE+ V PP+++EVR+KI+CTSLCH+D+ F K
Sbjct  2    EEASFSSTQGKPIRCKAAILRKAGEPLVIEEIQVDPPRAYEVRIKILCTSLCHTDLTFSK  61

Query  422  LQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            L   P   FPRILGHEA GV+ES+GE+V+ F
Sbjct  62   LDSGPLARFPRILGHEAVGVVESIGENVDGF  92


 Score = 45.4 bits (106),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK GD V+P+F P C EC DCKS KSN C  F
Sbjct  92   FKLGDVVLPVFHPQCEECKDCKSPKSNWCKSF  123



>gb|ABF94389.1| oxidoreductase, zinc-binding dehydrogenase family protein, expressed 
[Oryza sativa Japonica Group]
Length=293

 Score =   113 bits (283),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R A EPL++EE++V PPK++E+R+KIICTSLCH+DV  W   +    FPR
Sbjct  7    KPIRCKAAVCRAASEPLIVEEIVVDPPKAYEIRIKIICTSLCHTDVTLW--HKVDPAFPR  64

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVGE+VE  
Sbjct  65   ILGHEAYGVVESVGENVEGL  84


 Score = 52.8 bits (125),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
               GD+VVP F+  C  C  C ++ +N CT  PF + P + RD T+RF D
Sbjct  84   LAAGDTVVPTFMGQCDSCASCAAEWTNQCTAVPFTMGPGMRRDGTTRFWD  133



>ref|NP_001049223.1| Os03g0189600 [Oryza sativa Japonica Group]
 gb|ABF94388.1| oxidoreductase, zinc-binding dehydrogenase family protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11137.1| Os03g0189600 [Oryza sativa Japonica Group]
 dbj|BAG88176.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89916.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58468.1| hypothetical protein OsJ_09718 [Oryza sativa Japonica Group]
Length=379

 Score =   113 bits (283),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R A EPL++EE++V PPK++E+R+KIICTSLCH+DV  W   +    FPR
Sbjct  7    KPIRCKAAVCRAASEPLIVEEIVVDPPKAYEIRIKIICTSLCHTDVTLW--HKVDPAFPR  64

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVGE+VE  
Sbjct  65   ILGHEAYGVVESVGENVEGL  84


 Score = 52.4 bits (124),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
               GD+VVP F+  C  C  C ++ +N CT  PF + P + RD T+RF D
Sbjct  84   LAAGDTVVPTFMGQCDSCASCAAEWTNQCTAVPFTMGPGMRRDGTTRFWD  133



>ref|XP_009110138.1| PREDICTED: alcohol dehydrogenase-like 2 [Brassica rapa]
Length=389

 Score =   117 bits (294),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K + I    GKPIRC+AA+ +KAGE LVIEE+ V PP+++EVR+KI+CTSLCH+DV FW
Sbjct  2    DKTSSISIHEGKPIRCKAALCKKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            KL + P   FPRILGHEA GV+ES+G+ V  F
Sbjct  62   KLDRGPLARFPRILGHEAVGVVESIGDHVNGF  93


 Score = 48.1 bits (113),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C+++
Sbjct  93   FKQGDVVLPVFHPHCEECRDCKSPKSNWCSRY  124



>ref|XP_009409158.1| PREDICTED: alcohol dehydrogenase-like 7 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009409159.1| PREDICTED: alcohol dehydrogenase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=382

 Score =   117 bits (292),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             +A KPIRCRAAV R  GEPL IEEV+VAPPK++EVR+KIICTSLCHSDV  W ++  P 
Sbjct  4    SSAPKPIRCRAAVCRAGGEPLQIEEVVVAPPKAYEVRIKIICTSLCHSDVTIWSIKD-PA  62

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FP+I GHEA GV+ESVGE VE+
Sbjct  63   GFPKIFGHEAVGVVESVGEHVEE  85


 Score = 48.5 bits (114),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVT-PLLHRDETSRFTD  659
            GD V+P  L  C +C+DC+S +SN+CT  P  +   ++ RD TSRFTD
Sbjct  89   GDMVLPFCLAHCGDCVDCRSVRSNVCTGVPLGLLDGVMPRDGTSRFTD  136



>emb|CDP01100.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   117 bits (294),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 1/81 (1%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-G  439
            TAGKPIRCRAAV R AGEPLVIEE+ VAPPKS EVRVKIICTSLCH D+ FW+ +  P  
Sbjct  9    TAGKPIRCRAAVCRGAGEPLVIEEIQVAPPKSGEVRVKIICTSLCHGDISFWRSESGPFS  68

Query  440  CFPRILGHEAFGVIESVGEDV  502
             FP I GHEA G +ESVGE+V
Sbjct  69   FFPGIFGHEAAGTVESVGENV  89


 Score = 48.1 bits (113),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            K GD VVP+   +C EC DCK  K N CTKFP      + RD +SRF D
Sbjct  93   KAGDLVVPVVQRNCGECRDCKF-KGNACTKFPAASLNAMPRDGSSRFLD  140



>gb|ABF94390.1| oxidoreductase, zinc-binding dehydrogenase family protein, expressed 
[Oryza sativa Japonica Group]
Length=241

 Score =   112 bits (281),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R A EPL++EE++V PPK++E+R+KIICTSLCH+DV  W   +    FPR
Sbjct  7    KPIRCKAAVCRAASEPLIVEEIVVDPPKAYEIRIKIICTSLCHTDVTLW--HKVDPAFPR  64

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVGE+VE  
Sbjct  65   ILGHEAYGVVESVGENVEGL  84


 Score = 52.8 bits (125),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
               GD+VVP F+  C  C  C ++ +N CT  PF + P + RD T+RF D
Sbjct  84   LAAGDTVVPTFMGQCDSCASCAAEWTNQCTAVPFTMGPGMRRDGTTRFWD  133



>gb|EEC82469.1| hypothetical protein OsI_26910 [Oryza sativa Indica Group]
Length=390

 Score =   110 bits (275),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +   A K IRCRAAV+R AG+PL +EEV VAPP++HEVR+KI+CTS+CH+D+ FW+++  
Sbjct  4    MNTAAAKSIRCRAAVSRVAGQPLEMEEVEVAPPRAHEVRIKILCTSICHTDITFWRME--  61

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
             G  P ILGHEA GV+ESVGE V++
Sbjct  62   -GNHPSILGHEAVGVVESVGEHVQE  85


 Score = 54.7 bits (130),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD VVP+F   C+EC DC S +SNLC+K P  V  L+ RD T+RF+ +
Sbjct  89   GDMVVPVFAAQCSECPDCLSDRSNLCSKLP-NVAGLMPRDRTTRFSSV  135



>gb|EMT16703.1| Alcohol dehydrogenase-like protein 7 [Aegilops tauschii]
Length=419

 Score =   116 bits (290),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             TA KPIRC+AAV + AG+PL +EEV VAPP++HEVR+KI+CTSLCH+DV FW+L+ FP 
Sbjct  10   NTATKPIRCKAAVCKVAGQPLEMEEVEVAPPRAHEVRIKILCTSLCHTDVTFWRLKGFPP  69

Query  440  CFPRILGHEAFGVIESVGEDVED  508
              P ILGHEA GV+ESVG+ V +
Sbjct  70   RHPSILGHEAAGVVESVGDHVHE  92


 Score = 48.5 bits (114),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            GD+VVP+FL  C +C DC S +SN+C+  P    P + RD T+RF+
Sbjct  96   GDTVVPVFLAQCGDCPDCLSDRSNICSGLPAG-RPGMPRDGTTRFS  140



>gb|AAN64150.1| Putative alcohol dehydrogenase [Oryza sativa Japonica Group]
Length=360

 Score =   112 bits (281),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 2/80 (3%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R A EPL++EE++V PPK++E+R+KIICTSLCH+DV  W   +    FPR
Sbjct  7    KPIRCKAAVCRAASEPLIVEEIVVDPPKAYEIRIKIICTSLCHTDVTLW--HKVDPAFPR  64

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVGE+VE  
Sbjct  65   ILGHEAYGVVESVGENVEGL  84


 Score = 52.0 bits (123),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
               GD+VVP F+  C  C  C ++ +N CT  PF + P + RD T+RF D
Sbjct  84   LAAGDTVVPTFMGQCDSCASCAAEWTNQCTAVPFTMGPGMRRDGTTRFWD  133



>ref|XP_009409164.1| PREDICTED: alcohol dehydrogenase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=382

 Score =   116 bits (291),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 1/83 (1%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             +A KPIRCRAAV R  GEPL IE+V+VAPP+++EVR+KIICTSLCHSDV  W ++  P 
Sbjct  4    SSAPKPIRCRAAVCRAGGEPLQIEDVVVAPPRAYEVRIKIICTSLCHSDVTIWSIKD-PA  62

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRI GHEA GV+ESVGE VE+
Sbjct  63   GFPRIFGHEAVGVVESVGEHVEE  85


 Score = 47.8 bits (112),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVT-PLLHRDETSRFTD  659
            GD V+  FL  C +C+DC+S +SN+C+  P  +   ++ RD TSRFTD
Sbjct  89   GDMVLSCFLAHCGDCVDCRSVRSNVCSGVPLGLQEGVMPRDGTSRFTD  136



>emb|CDY04816.1| BnaC05g17730D [Brassica napus]
Length=390

 Score =   114 bits (285),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K +      GKPIRC+AA+ RKA E LV+EE+ V PP+++EVR+KIICTSLCH+DV FW
Sbjct  2    DKTSSFSIHKGKPIRCKAALCRKAREALVMEEIQVDPPQAYEVRIKIICTSLCHTDVTFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            KL   P   FPRILGHE+ G++ESVGE V+ F
Sbjct  62   KLDSGPLARFPRILGHESVGLVESVGEHVDGF  93


 Score = 50.1 bits (118),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPF-RVTPLLHRDETSRFTD  659
            FK+GD V+P+F P+C EC DCKS KSN C ++    ++        SRF D
Sbjct  93   FKQGDVVLPVFHPNCEECKDCKSSKSNWCARYANDSISNTRRYGMASRFKD  143



>ref|XP_006649532.1| PREDICTED: alcohol dehydrogenase-like 2-like [Oryza brachyantha]
Length=380

 Score =   110 bits (276),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R +G+PL +EE++V PPK +E+R++IICTSLCH+DV  W   + P  FPR
Sbjct  7    KPIRCKAAVCRASGKPLTVEEIVVDPPKDYEIRIRIICTSLCHTDVTLWHPAK-PSLFPR  65

Query  452  ILGHEAFGVIESVGEDVEDF  511
            ILGHEA+GV+ESVG  V+ F
Sbjct  66   ILGHEAYGVVESVGRYVQGF  85


 Score = 53.5 bits (127),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 31/55 (56%), Gaps = 0/55 (0%)
 Frame = +3

Query  495  KMLRIFKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            + ++ F  GD+VVP FL  C  C  C S  +N CT  P  + P + RD T+RF D
Sbjct  80   RYVQGFGAGDAVVPTFLGQCDSCSSCASDWTNQCTAVPLTMGPGMRRDGTTRFWD  134



>gb|EEC82468.1| hypothetical protein OsI_26909 [Oryza sativa Indica Group]
Length=392

 Score =   113 bits (283),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 69/89 (78%), Gaps = 3/89 (3%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            +Q     ++ KPIRCRAAV+R AG+PL +EEV VAPP++HEVR+KIICTSLCH+D+ FW+
Sbjct  2    EQTNAAASSAKPIRCRAAVSRAAGQPLEMEEVEVAPPRAHEVRIKIICTSLCHTDITFWR  61

Query  422  LQQFPGCFPRILGHEAFGVIESVGEDVED  508
            ++   G  P I GHEA GV+ESVGE V +
Sbjct  62   ME---GLHPSIFGHEAVGVVESVGEHVRE  87


 Score = 50.8 bits (120),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +3

Query  501  LRIFKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            +R    GD+VVP+F   C+EC DC S +SN+C+K P  V   + RD T+RF+
Sbjct  85   VREVAVGDTVVPVFTAQCSECPDCLSDRSNICSKLP-DVHGFMPRDGTTRFS  135



>ref|XP_004958352.1| PREDICTED: alcohol dehydrogenase-like 2-like [Setaria italica]
Length=391

 Score =   106 bits (264),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 67/81 (83%), Gaps = 3/81 (4%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG--CF  445
            +PIRC+AAV + AGEPL   EV VAPP++HEVR++++CTSLCH+D+ FW++++  G   F
Sbjct  8    RPIRCKAAVCKAAGEPLETVEVEVAPPRAHEVRIRVVCTSLCHTDITFWRMKK-DGLITF  66

Query  446  PRILGHEAFGVIESVGEDVED  508
            P ILGHEA GV+ESVGEDVE+
Sbjct  67   PCILGHEAVGVVESVGEDVEE  87


 Score = 57.8 bits (138),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            GD+VVP+FL  C EC DC S +SNLC+  P R T L+ RD T+RF+
Sbjct  91   GDTVVPVFLAQCGECADCLSARSNLCSALPHR-TGLMPRDGTTRFS  135



>ref|NP_001060310.1| Os07g0621800 [Oryza sativa Japonica Group]
 dbj|BAC10189.1| putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAF22224.1| Os07g0621800 [Oryza sativa Japonica Group]
 dbj|BAG92638.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67611.1| hypothetical protein OsJ_25166 [Oryza sativa Japonica Group]
Length=390

 Score =   108 bits (271),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 67/85 (79%), Gaps = 3/85 (4%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +   A K IRCRAAV+R AG+PL +EEV VAPP++HEVR+KI+CTS+CH+D+ FW+++  
Sbjct  4    MNTAAAKSIRCRAAVSRVAGQPLEMEEVEVAPPRAHEVRIKILCTSICHTDITFWRME--  61

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
             G  P I GHEA GV+ESVGE V++
Sbjct  62   -GNHPSIFGHEAVGVVESVGEHVQE  85


 Score = 54.7 bits (130),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            GD VVP+F   C+EC DC S +SNLC+K P  V  L+ RD T+RF+ +
Sbjct  89   GDMVVPVFAAQCSECPDCLSDRSNLCSKLP-NVAGLMPRDRTTRFSSV  135



>ref|XP_010916714.1| PREDICTED: alcohol dehydrogenase-like 7 [Elaeis guineensis]
Length=383

 Score =   114 bits (286),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             T  KPIRC+AAV+R  GEPL IEEV+VAPP+++E+R+KIICTS+CH+DV FW+++ +PG
Sbjct  5    STTPKPIRCKAAVSRAPGEPLRIEEVVVAPPRAYEIRIKIICTSVCHTDVTFWRMKGYPG  64

Query  440  CFPRILGHEAFGVIESVGE  496
              P+I GHEA G +ESVG+
Sbjct  65   VLPQIYGHEAVGEVESVGD  83


 Score = 48.9 bits (115),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +3

Query  534  PIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            P FL  C EC DC+S+ SN+C K P+R    + RD T+RFTD
Sbjct  96   PSFLAQCGECGDCESEGSNMCGKLPYRPVG-MPRDGTTRFTD  136



>ref|XP_006658830.1| PREDICTED: alcohol dehydrogenase-like 2-like [Oryza brachyantha]
Length=390

 Score =   114 bits (285),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +   A KPIRCRAAV+R AG+PLV+EEV VAPP++HEVR+KI+CTS+CH+D+ FW+++  
Sbjct  4    MNTAAAKPIRCRAAVSRVAGQPLVMEEVEVAPPRAHEVRIKILCTSICHTDITFWRME--  61

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
             G  P I GHEA GV+ESVGE V++
Sbjct  62   -GIHPSIFGHEAVGVVESVGEHVQE  85


 Score = 48.5 bits (114),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            GD VVP+F   C+EC DC S +SNLC+K P  +   + RD T+RF+
Sbjct  89   GDMVVPVFTAQCSECPDCLSDRSNLCSKLP-NLPGGMPRDGTTRFS  133



>gb|EMS67661.1| Alcohol dehydrogenase-like 2 [Triticum urartu]
Length=446

 Score =   104 bits (259),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 63/77 (82%), Gaps = 3/77 (4%)
 Frame = +2

Query  290  AAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQ---FPGCFPRILG  460
            AAV+R  G PLVIE+++V PPK++E+R+K++CTSLCH+D+ FW+ ++    P  FPRILG
Sbjct  60   AAVSRAKGAPLVIEDIVVDPPKAYEIRMKVLCTSLCHTDITFWRGKEDFPLPPVFPRILG  119

Query  461  HEAFGVIESVGEDVEDF  511
            HEA+GV+ESVGE VE F
Sbjct  120  HEAYGVVESVGERVEGF  136


 Score = 58.5 bits (140),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C  C  C S  SN+C+  PF V P + RD T+RF D
Sbjct  136  FAAGDTVVPTFLGQCDSCGGCASAGSNMCSALPFVVGPGMRRDGTTRFRD  185



>emb|CDY41481.1| BnaA08g20830D [Brassica napus]
Length=390

 Score =   114 bits (286),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPIRC+AA+ +KAGE LVIEE+ V PP+++EVR+KI+CTSLCH+DV FWKL   P   F
Sbjct  12   GKPIRCKAALCKKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDVTFWKLDWGPLARF  71

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+G+ V  F
Sbjct  72   PRILGHEAVGVVESIGDHVNGF  93


 Score = 48.1 bits (113),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+F P C EC DCKS KSN C+++
Sbjct  93   FKQGDVVLPVFHPHCEECRDCKSPKSNWCSRY  124



>ref|NP_567645.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 ref|NP_974589.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 sp|Q0V7W6.1|ADHL5_ARATH RecName: Full=Alcohol dehydrogenase-like 5 [Arabidopsis thaliana]
 gb|ABH04561.1| At4g22110 [Arabidopsis thaliana]
 gb|AEE84551.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 gb|AEE84552.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
Length=389

 Score =   113 bits (282),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            EK +      GKPIRC+AAV+RK GE LVIEE+ V PP+++EVR+KIICTSLCH+DV F 
Sbjct  2    EKTSMFSIHEGKPIRCKAAVSRKPGEALVIEEIHVDPPQAYEVRIKIICTSLCHTDVSFS  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRILGHEA GVIES+GE V  F
Sbjct  62   KIDSGPLARFPRILGHEAVGVIESIGEHVNGF  93


 Score = 49.3 bits (116),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            F++GD V+P+F P C EC DCKS KSN C +F         R   TSRF D
Sbjct  93   FQQGDVVLPVFHPHCEECRDCKSSKSNWCARFADDFLSNTRRYGMTSRFKD  143



>ref|XP_002867792.1| hypothetical protein ARALYDRAFT_492663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44051.1| hypothetical protein ARALYDRAFT_492663 [Arabidopsis lyrata subsp. 
lyrata]
Length=389

 Score =   113 bits (283),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K +      GKPIRC+AA++RK GE LVIEE+ V PP+++EVR+KIICTSLCH+DV FW
Sbjct  2    DKASSFSIHEGKPIRCKAAISRKPGEALVIEEIHVDPPQAYEVRIKIICTSLCHTDVSFW  61

Query  419  KLQQFPGC-FPRILGHEAFGVIESVGEDVEDF  511
            K++  P   FP ILGHEA GVIES+GE V  F
Sbjct  62   KVESGPLVRFPMILGHEAVGVIESIGEPVNGF  93


 Score = 48.5 bits (114),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            F++GD V+P+F P C EC DCKS KSN C +F 
Sbjct  93   FQQGDVVLPVFHPHCEECRDCKSSKSNWCARFA  125



>ref|XP_007146073.1| hypothetical protein PHAVU_006G0103000g, partial [Phaseolus vulgaris]
 gb|ESW18067.1| hypothetical protein PHAVU_006G0103000g, partial [Phaseolus vulgaris]
Length=84

 Score =   120 bits (301),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +2

Query  224  MDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHS  403
            M+   +  +P   T GKPIRCRAA+ARKAGEPLVIEE+ VAPP   EVR+++IC+SLCHS
Sbjct  1    MEDNNQASSPASPTEGKPIRCRAAIARKAGEPLVIEEITVAPPMPREVRIRVICSSLCHS  60

Query  404  DVFFWKLQQFPGCFPRILGHEAFG  475
            D+ F  LQ FP  FPRILGHEA G
Sbjct  61   DITFRNLQDFPAIFPRILGHEATG  84



>ref|XP_006305040.1| hypothetical protein CARUB_v10009406mg [Capsella rubella]
 gb|EOA37938.1| hypothetical protein CARUB_v10009406mg [Capsella rubella]
Length=388

 Score =   115 bits (287),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +2

Query  242  KQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK  421
            ++     T GKPIRC+AA+ RKA EPLVIEE+ V PP+++E+R+KI+CTSLCH+D+ F K
Sbjct  2    EKTSFSSTQGKPIRCKAAILRKAREPLVIEEIQVDPPRAYEIRIKILCTSLCHTDLTFSK  61

Query  422  LQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            L   P   FPRILGHEA GV+ES GE+V+ F
Sbjct  62   LDSGPLARFPRILGHEAVGVVESTGENVDGF  92


 Score = 47.0 bits (110),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            F++GD V+P+F P C EC DCKS K N CT++
Sbjct  92   FEQGDVVLPVFHPQCEECKDCKSPKGNWCTRY  123



>ref|XP_008804783.1| PREDICTED: LOW QUALITY PROTEIN: alcohol dehydrogenase-like 7 
[Phoenix dactylifera]
Length=382

 Score =   104 bits (259),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T  KPIRC+AAV+R  GEPL IEEV+VAPP+++E+R+KI+CTS+CH+DV FW+++ FP  
Sbjct  5    TTPKPIRCKAAVSRAPGEPLRIEEVVVAPPQAYEIRMKILCTSVCHTDVTFWRMKGFPAV  64

Query  443  FPRILGHEAFG  475
             P+I GHEA G
Sbjct  65   LPQIYGHEAVG  75


 Score = 57.0 bits (136),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            GD VVP FL  C EC +C+S++SN+C K P+R    + RD T+RFTD
Sbjct  90   GDLVVPTFLAQCGECGECESERSNMCAKLPYRAVG-MPRDGTTRFTD  135



>emb|CDX82904.1| BnaC01g13540D [Brassica napus]
Length=389

 Score =   111 bits (277),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K +      GKPIRC+AA+ +KAGEPLVIEE+ V PP+++EVR+KI+CT+LCH+D+ F 
Sbjct  2    DKTSSFSSHEGKPIRCKAAICKKAGEPLVIEEIHVHPPQAYEVRIKIVCTTLCHTDLAFS  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            K    P   FPRILGHEA G++ES+GE V+ F
Sbjct  62   KYDSGPLARFPRILGHEAVGLVESIGEHVDGF  93


 Score = 50.1 bits (118),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 29/51 (57%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            FK GD V+P+F P C EC DCKS K N CT+F   +     R    SRF D
Sbjct  93   FKHGDVVLPVFHPHCEECRDCKSSKGNWCTRFAEDLVSNTRRYGMASRFKD  143



>ref|XP_006413691.1| hypothetical protein EUTSA_v10025421mg [Eutrema salsugineum]
 gb|ESQ55144.1| hypothetical protein EUTSA_v10025421mg [Eutrema salsugineum]
Length=390

 Score =   111 bits (277),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC-F  445
            GKPIRC+AA+ RKAGE LVIEE+ V PP+++EVR+KI+CTSLCH+D+ F KL   P   F
Sbjct  13   GKPIRCKAAICRKAGEALVIEEIHVDPPQAYEVRIKILCTSLCHTDLSFSKLDTGPLVRF  72

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE V+ F
Sbjct  73   PRILGHEAVGVVESIGEHVDGF  94


 Score = 49.7 bits (117),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            FK+GD V+P+F P C EC DCKS K+N CT+F 
Sbjct  94   FKQGDVVLPVFHPHCEECRDCKSSKTNWCTRFA  126



>gb|EMS47035.1| Alcohol dehydrogenase-like 7 [Triticum urartu]
Length=409

 Score =   114 bits (285),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             TA KPIRC+AAV + AG+PL +EEV VAPP++HEVRV+I+CTSLCH+DV FW+++  P 
Sbjct  10   NTATKPIRCKAAVCKVAGQPLEMEEVEVAPPRAHEVRVRILCTSLCHTDVTFWRMKGSPP  69

Query  440  CFPRILGHEAFGVIESVGEDVED  508
              P ILGHEA GV+ESVG+DV +
Sbjct  70   RHPSILGHEAAGVVESVGDDVHE  92


 Score = 46.2 bits (108),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            GD+VV +FL  C +C DC S +SN+C+  P    P + RD T+RF+
Sbjct  96   GDTVVSVFLAQCGDCPDCVSDRSNICSGLPAG-RPGMPRDGTTRFS  140



>ref|XP_010320184.1| PREDICTED: alcohol dehydrogenase-like 1 isoform X2 [Solanum lycopersicum]
Length=368

 Score =   107 bits (266),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +2

Query  296  VARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCFPRILGHEAF  472
            + RKAGEPL+IEE+ VAPP S EVR+KI+CTSLCHSDV FWKL   P   FPRILGHEA 
Sbjct  1    MQRKAGEPLIIEEIEVAPPTSWEVRIKILCTSLCHSDVTFWKLSDGPVSAFPRILGHEAT  60

Query  473  GVIESVGEDVED  508
            GV+ESVGE+VE+
Sbjct  61   GVVESVGENVEE  72


 Score = 53.5 bits (127),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            KEGD V+P+F  +C EC DCK  K N+C+KFP      + RD +SRF D
Sbjct  74   KEGDIVIPVFQRNCGECRDCKCPKGNICSKFPEDFLCGMPRDGSSRFKD  122



>ref|XP_006305514.1| hypothetical protein CARUB_v10009981mg [Capsella rubella]
 gb|EOA38412.1| hypothetical protein CARUB_v10009981mg [Capsella rubella]
Length=276

 Score =   114 bits (284),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCFP  448
            KPIRC+AA+ R AGE LVIE++ V PP+++EVR+KI+CTSLCH+D+ FWKL   P   FP
Sbjct  12   KPIRCKAAICRNAGEALVIEDIYVDPPQAYEVRIKILCTSLCHTDLSFWKLDFGPLSRFP  71

Query  449  RILGHEAFGVIESVGEDVEDF  511
            RILGHEA GV+ES+GE+V+ F
Sbjct  72   RILGHEAVGVVESIGENVDGF  92


 Score = 46.6 bits (109),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            FK+GD V+P+F P C EC DCKS K+N C ++         R   +SRF D
Sbjct  92   FKQGDVVLPVFQPYCEECKDCKSSKTNWCERYADDFVSNTRRYGMSSRFKD  142



>ref|XP_010459996.1| PREDICTED: alcohol dehydrogenase-like 1 [Camelina sativa]
Length=388

 Score =   114 bits (284),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCFP  448
            KPIRC+AA+ R AGE LVIE++ V PP+++EVR+KI+CTSLCH+D+ FWK+   P   FP
Sbjct  12   KPIRCKAAICRNAGEALVIEDIYVDPPQAYEVRIKILCTSLCHTDLSFWKMDFGPLSRFP  71

Query  449  RILGHEAFGVIESVGEDVEDF  511
            RILGHEA GV+ES+GE+V+ F
Sbjct  72   RILGHEAVGVVESIGENVDGF  92


 Score = 47.0 bits (110),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            FK+GD ++P+FLP C +C DCKS K+N C ++         R   +SRF D
Sbjct  92   FKQGDVILPVFLPFCGDCRDCKSSKTNWCERYADDFVSNTRRYGMSSRFKD  142



>ref|NP_173659.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 ref|NP_001031079.1| GroES-like zinc-binding dehydrogenase family protein [Arabidopsis 
thaliana]
 sp|Q9SK86.1|ADHL1_ARATH RecName: Full=Alcohol dehydrogenase-like 1 [Arabidopsis thaliana]
 gb|AAF18534.1|AC006551_20 Very similar to alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAM13113.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AAM91221.1| putative alcohol dehydrogenase [Arabidopsis thaliana]
 gb|AEE30240.1| alcohol dehydrogenase-like 1 [Arabidopsis thaliana]
 gb|AEE30241.1| alcohol dehydrogenase-like 1 [Arabidopsis thaliana]
Length=388

 Score =   114 bits (286),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 68/82 (83%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPI C+AA+ RKAGE LVIE++ V PP+++EVR+KI+CTSLCH+D+ FWKL   P   F
Sbjct  11   GKPITCKAAICRKAGEALVIEDIHVDPPQAYEVRIKILCTSLCHTDLTFWKLSFGPISRF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE+V+ F
Sbjct  71   PRILGHEAVGVVESIGENVDGF  92


 Score = 45.8 bits (107),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            FK+GD V+P+F P C EC DCKS K+N C ++ 
Sbjct  92   FKQGDVVLPVFHPYCEECKDCKSSKTNWCDRYA  124



>gb|AAM67260.1| alcohol dehydrogenase-like protein [Arabidopsis thaliana]
Length=384

 Score =   111 bits (278),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPIRC+AAV+RK GE LVIEE+ V PP+++EVR+KIICTSLCH+DV F K+   P   F
Sbjct  7    GKPIRCKAAVSRKPGEALVIEEIHVDPPQAYEVRIKIICTSLCHTDVSFSKIDSGPLARF  66

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GVIES+GE V  F
Sbjct  67   PRILGHEAVGVIESIGEHVNGF  88


 Score = 48.9 bits (115),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            F++GD V+P+F P C EC DCKS KSN C +F         R   TSRF D
Sbjct  88   FQQGDIVLPVFHPHCEECRDCKSSKSNWCARFADDFLSNTRRYGMTSRFKD  138



>ref|XP_002890513.1| hypothetical protein ARALYDRAFT_472482 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66772.1| hypothetical protein ARALYDRAFT_472482 [Arabidopsis lyrata subsp. 
lyrata]
Length=388

 Score =   114 bits (285),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = +2

Query  245  QAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKL  424
                    GKPIRC+AA+ RKAGE LVIE++ V PP+ +EVR+KI+CTSLCH+D+ FWKL
Sbjct  3    NTSFSSNEGKPIRCKAAICRKAGEALVIEDIHVDPPQPYEVRIKILCTSLCHTDLTFWKL  62

Query  425  QQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
               P   FPRILGHEA GV+ES+GE+V  F
Sbjct  63   DFGPISRFPRILGHEAVGVVESIGENVVGF  92


 Score = 46.2 bits (108),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFP  608
            FK+GD V+P+F P C EC DCKS K+N C ++ 
Sbjct  92   FKQGDVVLPVFHPYCEECKDCKSSKTNWCERYA  124



>ref|XP_010477502.1| PREDICTED: alcohol dehydrogenase-like 1 [Camelina sativa]
Length=388

 Score =   113 bits (283),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCFP  448
            KPI+C+AA+ R AGE LVIE++ V PP+++EVR+KI+CTSLCH+D+ FWKL   P   FP
Sbjct  12   KPIKCKAAICRNAGEALVIEDIYVDPPQAYEVRIKILCTSLCHTDLTFWKLDFGPLSRFP  71

Query  449  RILGHEAFGVIESVGEDVEDF  511
            RILGHEA GV+ES+GE+V+ F
Sbjct  72   RILGHEAVGVVESIGENVDGF  92


 Score = 46.6 bits (109),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKF  605
            FK+GD V+P+FLP C +C DCKS K+N C ++
Sbjct  92   FKQGDVVLPVFLPFCEDCRDCKSSKTNWCERY  123



>ref|XP_010445220.1| PREDICTED: alcohol dehydrogenase-like 5 [Camelina sativa]
Length=314

 Score =   112 bits (280),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K +      GKPIRC+ A++RK GE LVIEE+ V PP+ +EVR+KI+CTSLCH+D+ FW
Sbjct  2    DKTSSFSIHEGKPIRCKVAISRKPGEALVIEEIYVDPPQPYEVRIKILCTSLCHTDLTFW  61

Query  419  KLQQFP-GCFPRILGHEAFGVIESVGEDVEDF  511
            KL   P   FPRILGHEA GV+E++GE V+ F
Sbjct  62   KLDCGPLARFPRILGHEAVGVVENIGEHVDGF  93


 Score = 47.8 bits (112),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            F+ GD V+P+F P C +C DCKS KSN C +F     P   R   TSRF D
Sbjct  93   FQLGDVVLPVFQPHCEDCKDCKSSKSNWCARFADDPLPNTRRYGMTSRFKD  143



>ref|XP_003562679.1| PREDICTED: alcohol dehydrogenase-like 2 [Brachypodium distachyon]
Length=408

 Score =   104 bits (259),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             TA KPIRC+AAV++ AG+PL + EV VAPP++HEVR++I+CTSLCH+DV FW+++ FP 
Sbjct  4    STAKKPIRCKAAVSKVAGQPLEMVEVDVAPPRAHEVRIRILCTSLCHTDVTFWRMKDFPA  63

Query  440  CFPRILGHEA  469
             +P ILGHEA
Sbjct  64   MYPSILGHEA  73


 Score = 55.5 bits (132),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            GD+VVP+F   C +C DC S +SN+C+  PFR  P + RD T+RF 
Sbjct  90   GDTVVPVFSGQCGDCPDCLSDRSNICSGLPFRFLPGMPRDGTTRFA  135



>ref|XP_008464877.1| PREDICTED: alcohol dehydrogenase-like 7 [Cucumis melo]
Length=387

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            T  +PIRCRAAV RK GEPLVIEE+IVAPP   EVR++IICTSLCHSD+ FWKL+  PG 
Sbjct  9    TGLQPIRCRAAVCRKPGEPLVIEEIIVAPPMPREVRIRIICTSLCHSDLTFWKLKDPPGI  68

Query  443  FPRILGHEAFGVIESVGEDVED  508
            FPRI GHEA GV+ESVG+DV +
Sbjct  69   FPRIFGHEAIGVVESVGKDVHE  90


 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  441  VFQESWATKLLGL*RV*EKMLRIFKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVT  620
            +F   +  + +G+     K +   KEGD+V+P F+ DC EC DC S KSNLCT FPF V+
Sbjct  68   IFPRIFGHEAIGVVESVGKDVHEVKEGDTVIPTFMADCGECKDCLSNKSNLCTNFPFSVS  127

Query  621  PLLHRDETSRFTDL  662
            P   R  TSRFTDL
Sbjct  128  PGTPRYGTSRFTDL  141



>ref|XP_006472563.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472564.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472565.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472566.1| PREDICTED: alcohol dehydrogenase-like 2-like isoform X4 [Citrus 
sinensis]
Length=390

 Score =   102 bits (254),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ EVR+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEVRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.6 bits (135),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFQRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>gb|KFK44338.1| hypothetical protein AALP_AA1G245100 [Arabis alpina]
Length=392

 Score =   117 bits (292),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = +2

Query  239  EKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFW  418
            +K        GKPIRC+AA+ +KAGE LVIEE+ V PP+++EVRVKI+CTSLCH+DV +W
Sbjct  3    KKITSFSSNEGKPIRCKAAICKKAGEALVIEEIQVDPPQAYEVRVKILCTSLCHTDVTYW  62

Query  419  KLQQFPGC-FPRILGHEAFGVIESVGEDVEDF  511
            K+   P   FPRILGHEA G++ES+GE+V+ F
Sbjct  63   KMDSGPRARFPRILGHEAVGMVESMGENVDGF  94


 Score = 41.6 bits (96),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 2/35 (6%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSK--KSNLCTKFP  608
            FK+GD V+P+F P C EC  CKS   KSN C KF 
Sbjct  94   FKQGDIVLPVFHPHCEECEVCKSSKTKSNWCAKFA  128



>ref|XP_006433934.1| hypothetical protein CICLE_v10001399mg [Citrus clementina]
 gb|ESR47174.1| hypothetical protein CICLE_v10001399mg [Citrus clementina]
Length=396

 Score =   100 bits (249),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = +2

Query  218  LEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLC  397
            L MD+K         TAGK IRCRAA++R  G+PLV+EE+ V PPK+ EVR+KI+CTSLC
Sbjct  6    LVMDNKNASS-----TAGKIIRCRAAISRIPGKPLVMEEIEVDPPKAGEVRIKILCTSLC  60

Query  398  HSDVFFWKLQQFP-GCFPRILGHEA  469
            HSDV FW+  Q P   FPRILGHEA
Sbjct  61   HSDVTFWRSTQPPMAVFPRILGHEA  85


 Score = 58.2 bits (139),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F  DC EC DCKS KSN+C+KF  +    + RD T+RF DL
Sbjct  100  REGDLVLPVFQGDCGECRDCKSPKSNICSKFVNKDNQSMPRDGTNRFRDL  149



>ref|XP_006472567.1| PREDICTED: alcohol dehydrogenase-like 2-like [Citrus sinensis]
Length=379

 Score =   100 bits (249),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = +2

Query  218  LEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLC  397
            L MD+K         TAGK IRCRAA++R  G+PLV+EE+ V PPK+ EVR+KI+CTSLC
Sbjct  6    LVMDNKNASS-----TAGKIIRCRAAISRIPGKPLVMEEIEVDPPKAGEVRIKILCTSLC  60

Query  398  HSDVFFWKLQQFP-GCFPRILGHEA  469
            HSDV FW+  Q P   FPRILGHEA
Sbjct  61   HSDVTFWRSTQPPMAVFPRILGHEA  85


 Score = 58.2 bits (139),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F  DC EC DCKS KSN+C+KF  +    + RD T+RF DL
Sbjct  100  REGDLVLPVFQGDCGECRDCKSPKSNICSKFVNKDNQSMPRDGTNRFRDL  149



>gb|EYU36482.1| hypothetical protein MIMGU_mgv1a013093mg [Erythranthe guttata]
Length=230

 Score =   114 bits (285),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 70/82 (85%), Gaps = 1/82 (1%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCF  445
            AGKPIRC+AAVAR+AGEPL++EE+ V PP+  EVR+KI+CTSLCH+DV +WKL+  P  F
Sbjct  10   AGKPIRCKAAVAREAGEPLILEEIQVLPPEPGEVRIKILCTSLCHTDVTWWKLKAGPIDF  69

Query  446  -PRILGHEAFGVIESVGEDVED  508
             PRI GHEA G++ESVGE+VE+
Sbjct  70   LPRIFGHEAAGIVESVGENVEE  91


 Score = 44.3 bits (103),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            K GD V+P+F  +C EC DC SK+ N+C+KF       + R    +RF D
Sbjct  93   KAGDLVLPVFQRNCGECKDCNSKRGNVCSKFAVEYFGGMPRYGGATRFLD  142



>gb|KDO81033.1| hypothetical protein CISIN_1g016363mg [Citrus sinensis]
Length=373

 Score =   102 bits (253),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ E+R+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEIRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.6 bits (135),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFHRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>ref|XP_006433936.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|ESR47176.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|KDO81032.1| hypothetical protein CISIN_1g016363mg [Citrus sinensis]
Length=390

 Score =   102 bits (253),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ E+R+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEIRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.6 bits (135),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFHRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>ref|XP_006433938.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|ESR47178.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
Length=343

 Score =   102 bits (253),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ E+R+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEIRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.6 bits (135),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFHRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>ref|XP_006433939.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|ESR47179.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
Length=256

 Score =   101 bits (252),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ E+R+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEIRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.6 bits (135),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFHRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>ref|XP_006433935.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
 gb|ESR47175.1| hypothetical protein CICLE_v10001446mg [Citrus clementina]
Length=266

 Score =   101 bits (252),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ E+R+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEIRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.6 bits (135),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFHRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>gb|KDO81034.1| hypothetical protein CISIN_1g016363mg [Citrus sinensis]
 gb|KDO81035.1| hypothetical protein CISIN_1g016363mg [Citrus sinensis]
Length=267

 Score =   101 bits (252),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 6/85 (7%)
 Frame = +2

Query  266  AGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWK----LQQF  433
            AGK IRC+AA+ R  G+PLVIEE+ V PPK+ E+R+KI+CTSLCHSDV FWK    L + 
Sbjct  10   AGKVIRCKAAICRIPGKPLVIEEIEVEPPKAWEIRIKILCTSLCHSDVTFWKSSTDLPKL  69

Query  434  PGCFPRILGHEAFGVIESVGEDVED  508
            P   P I GHEA GV+ESVGE VE+
Sbjct  70   P--LPVIFGHEAVGVVESVGEYVEE  92


 Score = 56.2 bits (134),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            KE D V+PIF  DC EC DCKS KSN C+KF     P + RD TSRF +L
Sbjct  94   KERDLVLPIFHRDCGECRDCKSSKSNTCSKFGRGYRPNMPRDGTSRFREL  143



>ref|XP_010448936.1| PREDICTED: alcohol dehydrogenase-like 5 isoform X2 [Camelina 
sativa]
Length=389

 Score =   110 bits (274),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPIRC+AA++RK GE LVIEE+ V PP+ +EVR+KI+CTSLCH+D  F KL   P   F
Sbjct  11   GKPIRCKAAISRKPGEALVIEEIYVDPPQPYEVRIKILCTSLCHTDYTFCKLDSGPLARF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE V+ F
Sbjct  71   PRILGHEAVGVVESIGEHVDGF  92


 Score = 47.8 bits (112),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            F+  D V+P+F P C EC DCKS KSN C +F   + P   R   TSRF D
Sbjct  92   FQLNDVVLPVFHPHCEECRDCKSSKSNWCARFADDLLPNTRRYGMTSRFKD  142



>ref|XP_010448937.1| PREDICTED: alcohol dehydrogenase-like 5 isoform X3 [Camelina 
sativa]
Length=388

 Score =   110 bits (274),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPIRC+AA++RK GE LVIEE+ V PP+ +EVR+KI+CTSLCH+D  F KL   P   F
Sbjct  11   GKPIRCKAAISRKPGEALVIEEIYVDPPQPYEVRIKILCTSLCHTDYTFCKLDSGPLARF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE V+ F
Sbjct  71   PRILGHEAVGVVESIGEHVDGF  92


 Score = 47.8 bits (112),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            F+  D V+P+F P C EC DCKS KSN C +F   + P   R   TSRF D
Sbjct  92   FQLNDVVLPVFHPHCEECRDCKSSKSNWCARFADDLLPNTRRYGMTSRFKD  142



>ref|XP_010448935.1| PREDICTED: alcohol dehydrogenase-like 5 isoform X1 [Camelina 
sativa]
Length=390

 Score =   110 bits (274),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
            GKPIRC+AA++RK GE LVIEE+ V PP+ +EVR+KI+CTSLCH+D  F KL   P   F
Sbjct  11   GKPIRCKAAISRKPGEALVIEEIYVDPPQPYEVRIKILCTSLCHTDYTFCKLDSGPLARF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE V+ F
Sbjct  71   PRILGHEAVGVVESIGEHVDGF  92


 Score = 47.8 bits (112),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            F+  D V+P+F P C EC DCKS KSN C +F   + P   R   TSRF D
Sbjct  92   FQLNDVVLPVFHPHCEECRDCKSSKSNWCARFADDLLPNTRRYGMTSRFKD  142



>gb|KDO81038.1| hypothetical protein CISIN_1g025173mg [Citrus sinensis]
Length=208

 Score =   100 bits (249),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = +2

Query  218  LEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLC  397
            L MD+K         TAGK IRCRAA++R  G+PLV+EE+ V PPK+ EVR+KI+CTSLC
Sbjct  6    LVMDNKNASS-----TAGKIIRCRAAISRIPGKPLVMEEIEVDPPKAGEVRIKILCTSLC  60

Query  398  HSDVFFWKLQQFP-GCFPRILGHEA  469
            HSDV FW+  Q P   FPRILGHEA
Sbjct  61   HSDVTFWRSTQPPMAVFPRILGHEA  85


 Score = 57.4 bits (137),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F  DC EC DCKS KSN+C+KF  +    + RD T+RF DL
Sbjct  100  REGDLVLPVFQGDCGECRDCKSPKSNICSKFVNKDNQSMPRDGTNRFRDL  149



>ref|XP_010498711.1| PREDICTED: alcohol dehydrogenase-like 1 [Camelina sativa]
Length=148

 Score =   111 bits (278),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = +2

Query  269  GKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFP-GCF  445
             KPIRC+A + R AGE LVIE++ V PP+++EVR+KI+CTSLCH+D+ FWKL   P   F
Sbjct  11   AKPIRCKAEICRNAGEALVIEDIYVDPPQAYEVRIKILCTSLCHTDLSFWKLDFGPLSRF  70

Query  446  PRILGHEAFGVIESVGEDVEDF  511
            PRILGHEA GV+ES+GE+V+ F
Sbjct  71   PRILGHEAVGVVESIGENVDGF  92


 Score = 46.6 bits (109),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 1/51 (2%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHR-DETSRFTD  659
            FK+GD V+P+FLP C +C DCKS K+N C ++         R   +SRF D
Sbjct  92   FKQGDVVLPVFLPFCEDCRDCKSSKTNWCERYADDFVSNTRRYGMSSRFKD  142



>gb|KDO81037.1| hypothetical protein CISIN_1g025173mg [Citrus sinensis]
Length=256

 Score =   100 bits (248),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 62/85 (73%), Gaps = 6/85 (7%)
 Frame = +2

Query  218  LEMDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLC  397
            L MD+K         TAGK IRCRAA++R  G+PLV+EE+ V PPK+ EVR+KI+CTSLC
Sbjct  6    LVMDNKNASS-----TAGKIIRCRAAISRIPGKPLVMEEIEVDPPKAGEVRIKILCTSLC  60

Query  398  HSDVFFWKLQQFP-GCFPRILGHEA  469
            HSDV FW+  Q P   FPRILGHEA
Sbjct  61   HSDVTFWRSTQPPMAVFPRILGHEA  85


 Score = 57.4 bits (137),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTDL  662
            +EGD V+P+F  DC EC DCKS KSN+C+KF  +    + RD T+RF DL
Sbjct  100  REGDLVLPVFQGDCGECRDCKSPKSNICSKFVNKDNQSMPRDGTNRFRDL  149



>ref|XP_006849437.1| hypothetical protein AMTR_s00024p00046470 [Amborella trichopoda]
 gb|ERN11018.1| hypothetical protein AMTR_s00024p00046470 [Amborella trichopoda]
Length=381

 Score =   102 bits (254),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            +T GK IRC+AAV     E  VIEE+ VAPPK  EVR+KI+CTS CH+D+ FWKL++ P 
Sbjct  3    ETRGKAIRCKAAVCWSLEEDPVIEEIEVAPPKPWEVRIKILCTSPCHTDLTFWKLKEPPL  62

Query  440  CFPRILGHEAFGVIESVGEDVED  508
             FPRILGHEA G++ESVGE+V++
Sbjct  63   PFPRILGHEASGIVESVGEEVKE  85


 Score = 54.7 bits (130),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  513  KEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFT  656
            +EGD VVP+ +P C EC DC+S +SN+C+   F+    + RD TSRFT
Sbjct  87   QEGDLVVPVCVPQCDECPDCRSDRSNICSNIQFQFAGDMVRDGTSRFT  134



>ref|XP_006405266.1| hypothetical protein EUTSA_v10028003mg [Eutrema salsugineum]
 gb|ESQ46719.1| hypothetical protein EUTSA_v10028003mg [Eutrema salsugineum]
Length=97

 Score =   117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
            K++ KPIRC+AAV+RKAGEPL++EE++VAPP+ +EVR++IICT+LC+SD+ FWKLQ  P 
Sbjct  10   KSSVKPIRCKAAVSRKAGEPLIMEEIVVAPPQPYEVRIRIICTALCYSDITFWKLQVPPA  69

Query  440  CFPRILGHEAFGVI  481
            CFPRILGHEA G++
Sbjct  70   CFPRILGHEAIGLV  83



>ref|XP_004985403.1| PREDICTED: alcohol dehydrogenase-like 2-like [Setaria italica]
Length=376

 Score =   102 bits (254),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 61/80 (76%), Gaps = 5/80 (6%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            KPIRC+AAV R AGEPL +EE++V PPK++E+R+KI+CTSLCHSD+ FW+     G    
Sbjct  7    KPIRCKAAVCRAAGEPLTVEEIVVDPPKAYEIRIKIVCTSLCHSDITFWR-----GKASI  61

Query  452  ILGHEAFGVIESVGEDVEDF  511
               HEA+GV+ES+GE VE F
Sbjct  62   PFSHEAYGVVESLGEHVEGF  81


 Score = 54.7 bits (130),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 0/50 (0%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRVTPLLHRDETSRFTD  659
            F  GD+VVP FL  C  C  C S+ +NLC+  PF   P + RD T+RF D
Sbjct  81   FAAGDTVVPTFLSQCDRCPGCASEHNNLCSTVPFVFGPGMRRDGTTRFHD  130



>gb|AAN64149.1| Putative alcohol dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ25880.1| hypothetical protein OsJ_09717 [Oryza sativa Japonica Group]
Length=88

 Score =   116 bits (290),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  272  KPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGCFPR  451
            +PIRC+AAV R AGEPL +EE++V PPK+HEVR+KI+CTSLCHSDV FW++Q FPG FPR
Sbjct  7    QPIRCKAAVCRAAGEPLAVEEIVVDPPKAHEVRIKIVCTSLCHSDVTFWRMQDFPGVFPR  66

Query  452  ILGHEAFG  475
            I GHEAFG
Sbjct  67   IFGHEAFG  74



>ref|XP_006434372.1| hypothetical protein CICLE_v10001500mg [Citrus clementina]
 gb|ESR47612.1| hypothetical protein CICLE_v10001500mg [Citrus clementina]
Length=380

 Score =   114 bits (284),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVRVKI+ TSLCH+DV+FW+ +  
Sbjct  1    MSSTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQTNEVRVKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.6 bits (96),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (48%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C EC  CKS++SN+C                 ++F     P+ H  
Sbjct  86   LKPGDQVLPVFTGECKECAHCKSEESNMCDLLRINTDRGVMLNDGKSRFSINGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_009414968.1| PREDICTED: alcohol dehydrogenase 1-like [Musa acuminata subsp. 
malaccensis]
Length=390

 Score =   114 bits (284),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  224  MDSKAEKQAPIGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHS  403
            M    ++ A +  TAG+ IRCRAAVA +AG+PLV+EE+ VAPPK+ EVRVKI+ TSLCH+
Sbjct  1    MGEGGKRVAEMSSTAGQVIRCRAAVAWEAGKPLVVEEIEVAPPKAMEVRVKILYTSLCHT  60

Query  404  DVFFWKLQQFPGCFPRILGHEAFGVIESVGEDV  502
            DV+FW+ +     FPRI GHEA GV+ESVGE V
Sbjct  61   DVYFWEAKGQTPVFPRIFGHEAGGVVESVGEGV  93


 Score = 41.2 bits (95),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 17/64 (27%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRDETS  647
            GD V+PIF  +C EC  CKS++SN+C                 ++F     P+ H   TS
Sbjct  99   GDHVLPIFTGECGECAHCKSQESNMCDLLRINTDRGVMIGDGQSRFSINGKPIYHFLGTS  158

Query  648  RFTD  659
             F++
Sbjct  159  TFSE  162



>ref|XP_006472918.1| PREDICTED: alcohol dehydrogenase-like [Citrus sinensis]
Length=380

 Score =   114 bits (284),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVRVKI+ TSLCH+DV+FW+ +  
Sbjct  1    MSSTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQTNEVRVKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 40.8 bits (94),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (48%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C EC  CKS++SN+C                 ++F     P+ H  
Sbjct  86   LKPGDHVLPVFTGECKECAHCKSEESNMCDLLRINTDRGVMLNDGKSRFSINGRPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_008237686.1| PREDICTED: alcohol dehydrogenase [Prunus mume]
Length=382

 Score =   113 bits (282),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  260  KTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPG  439
             TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +    
Sbjct  5    NTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQTNEVRLKILYTSLCHTDVYFWEAKGQNP  64

Query  440  CFPRILGHEAFGVIESVGEDVEDF  511
             FPRI GHEA G++ESVGE V D 
Sbjct  65   LFPRIYGHEAGGIVESVGEGVTDL  88


 Score = 41.6 bits (96),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  88   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGNPIYHFV  147

Query  639  ETSRFTD  659
             TS F++
Sbjct  148  GTSTFSE  154



>gb|AEL75214.1| alcohol dehydrogenase, partial [Malus rockii]
Length=377

 Score =   113 bits (282),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIFGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAQCKSEESNMCELLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>sp|P48977.1|ADH_MALDO RecName: Full=Alcohol dehydrogenase [Malus domestica]
 emb|CAA88271.1| alcohol dehydrogenase [Malus domestica]
Length=380

 Score =   113 bits (283),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_009360723.1| PREDICTED: alcohol dehydrogenase-like [Pyrus x bretschneideri]
Length=380

 Score =   111 bits (278),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            TAG+ IRCRAAVA +AG+PLV+EEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +     
Sbjct  4    TAGQVIRCRAAVAWEAGKPLVVEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQNPL  63

Query  443  FPRILGHEAFGVIESVGEDVEDF  511
            FPRI GHEA GV+ESVGE V D 
Sbjct  64   FPRIYGHEAGGVVESVGEGVTDL  86


 Score = 42.7 bits (99),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 34/67 (51%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F+ +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFMGECKDCAHCKSEESNMCDLLRINTDRGVMLGDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>gb|AEL75212.1| alcohol dehydrogenase, partial [Pyrus sinkiangensis]
Length=377

 Score =   113 bits (282),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_008346611.1| PREDICTED: alcohol dehydrogenase [Malus domestica]
Length=380

 Score =   113 bits (282),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLNDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_010245834.1| PREDICTED: alcohol dehydrogenase 1-like [Nelumbo nucifera]
Length=379

 Score =   113 bits (283),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  263  TAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQFPGC  442
            TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCHSDV+FW+ +     
Sbjct  3    TAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRLKILYTSLCHSDVYFWEAKGQTPL  62

Query  443  FPRILGHEAFGVIESVGEDVEDF  511
            FPRI GHEA G++ESVGE V D 
Sbjct  63   FPRIYGHEAGGIVESVGEGVTDL  85


 Score = 40.8 bits (94),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (62%), Gaps = 1/47 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRV-TPLLHRDETSRFT  656
            GD V+P+F  +C EC+ CKS++SN+C+         ++  D  SRF+
Sbjct  88   GDHVLPVFTGECKECVHCKSEESNMCSLLRINTDRGVMLNDGKSRFS  134



>ref|XP_009416943.1| PREDICTED: alcohol dehydrogenase 3-like [Musa acuminata subsp. 
malaccensis]
Length=380

 Score =   111 bits (278),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ I+CRAAVA +AG+PLV+EEV VAPPK+ EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSSTAGQVIKCRAAVAWEAGKPLVMEEVEVAPPKAMEVRLKILYTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA GV+ESVGE V D 
Sbjct  61   TPVFPRIFGHEAGGVVESVGEGVTDL  86


 Score = 42.4 bits (98),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 32/64 (50%), Gaps = 17/64 (27%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRDETS  647
            GD V+PIF+ +C EC  CKS++SN+C                 ++F     P+ H   TS
Sbjct  89   GDHVLPIFMGECKECAHCKSQESNMCDLLRINTDRGVMISDGQSRFSINGKPIYHFLGTS  148

Query  648  RFTD  659
             F++
Sbjct  149  TFSE  152



>gb|AEL75216.1| alcohol dehydrogenase, partial [Pyrus sinkiangensis]
Length=377

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>gb|AEL75215.1| alcohol dehydrogenase, partial [Pyrus communis]
Length=377

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>gb|AIU98500.1| alcohol dehydrogenase [Musa acuminata AAA Group]
Length=380

 Score =   111 bits (278),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ I+CRAAVA +AG+PLV+EEV VAPPK+ EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSSTAGQVIKCRAAVAWEAGKPLVMEEVEVAPPKAMEVRLKILYTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA GV+ESVGE V D 
Sbjct  61   TPVFPRIFGHEAGGVVESVGEGVTDL  86


 Score = 42.4 bits (98),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 32/64 (50%), Gaps = 17/64 (27%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRDETS  647
            GD V+PIF+ +C EC  CKS++SN+C                 ++F     P+ H   TS
Sbjct  89   GDHVLPIFMGECKECAHCKSQESNMCDLLRINTDRGVMISDGQSRFSINGKPIYHFLGTS  148

Query  648  RFTD  659
             F++
Sbjct  149  TFSE  152



>ref|XP_006858450.1| hypothetical protein AMTR_s00071p00086150 [Amborella trichopoda]
 gb|ERN19917.1| hypothetical protein AMTR_s00071p00086150 [Amborella trichopoda]
Length=380

 Score =   113 bits (282),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +G TAG+ IRC+AAVA +AGEPLVIEEV VAPP++ EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MGSTAGQVIRCKAAVAWEAGEPLVIEEVEVAPPQAMEVRLKILYTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA GV+ESVGE V + 
Sbjct  61   KPLFPRIFGHEAGGVVESVGEGVTEL  86


 Score = 40.8 bits (94),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (60%), Gaps = 1/47 (2%)
 Frame = +3

Query  519  GDSVVPIFLPDCTECLDCKSKKSNLCTKFPFRV-TPLLHRDETSRFT  656
            GD V+P+F  +C EC  CKS++SN+C          ++  DE SRF+
Sbjct  89   GDHVLPVFTGECKECAHCKSEESNMCDLLRINTDRGVMLSDEKSRFS  135



>gb|AEL75217.1| alcohol dehydrogenase, partial [Pyrus sinkiangensis]
Length=377

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRLKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>gb|AEL75211.1| alcohol dehydrogenase [Pyrus communis]
Length=380

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVMDL  86


 Score = 41.2 bits (95),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_009360724.1| PREDICTED: alcohol dehydrogenase [Pyrus x bretschneideri]
Length=380

 Score =   112 bits (281),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ES+GE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESIGEGVTDL  86


 Score = 41.2 bits (95),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGDHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_008364888.1| PREDICTED: alcohol dehydrogenase [Malus domestica]
Length=380

 Score =   113 bits (282),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRCRAAVA +AG+PLVIEEV VAPP+++EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIRCRAAVAWEAGKPLVIEEVEVAPPQANEVRIKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   NPLFPRIYGHEAGGIVESVGEGVTDL  86


 Score = 40.4 bits (93),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K G+ V+P+F  +C +C  CKS++SN+C                 ++F  +  P+ H  
Sbjct  86   LKAGBHVLPVFTGECKDCAHCKSEESNMCDLLRINTDRGVMLSDGKSRFSIKGKPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_006382857.1| hypothetical protein POPTR_0005s06160g [Populus trichocarpa]
 gb|ERP60654.1| hypothetical protein POPTR_0005s06160g [Populus trichocarpa]
Length=380

 Score =   110 bits (274),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRC+AAVA +AG+PLV+EEV VAPP++ EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSSTAGQVIRCKAAVAWEAGKPLVMEEVEVAPPQAMEVRLKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   TPLFPRIFGHEAGGIVESVGEGVTDL  86


 Score = 42.7 bits (99),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C EC  CKS++SN+C                 ++F  R  P+ H  
Sbjct  86   LKPGDHVLPVFTGECKECRHCKSEESNMCDLLRINTDRGVMLNDGKSRFSIRGQPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_011022979.1| PREDICTED: alcohol dehydrogenase-like isoform X2 [Populus euphratica]
Length=380

 Score =   107 bits (267),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ I C+AAVA +AG+PLVIEEV VAPP++ EVR+ I+ TSLCH+DV+FW+ +  
Sbjct  1    MSNTAGQVIYCKAAVAWEAGKPLVIEEVEVAPPQAMEVRLNILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   TPLFPRIFGHEAGGIVESVGEGVTDL  86


 Score = 45.8 bits (107),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C ECL CKS++SN+C                 ++F  R  P+ H  
Sbjct  86   LKPGDHVLPVFTGECKECLHCKSEESNMCDLLRINTDRGVMLNDGKSRFSIRGQPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



>ref|XP_002309899.2| alcohol-dehydrogenase family protein [Populus trichocarpa]
 gb|EEE90349.2| alcohol-dehydrogenase family protein [Populus trichocarpa]
Length=380

 Score =   109 bits (273),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  254  IGKTAGKPIRCRAAVARKAGEPLVIEEVIVAPPKSHEVRVKIICTSLCHSDVFFWKLQQF  433
            +  TAG+ IRC+AAVA +AG+PLV+EEV VAPP++ EVR+KI+ TSLCH+DV+FW+ +  
Sbjct  1    MSSTAGQVIRCKAAVAWEAGKPLVMEEVEVAPPQAMEVRLKILFTSLCHTDVYFWEAKGQ  60

Query  434  PGCFPRILGHEAFGVIESVGEDVEDF  511
               FPRI GHEA G++ESVGE V D 
Sbjct  61   TPLFPRIFGHEAGGIVESVGEGVTDL  86


 Score = 43.1 bits (100),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 33/67 (49%), Gaps = 17/67 (25%)
 Frame = +3

Query  510  FKEGDSVVPIFLPDCTECLDCKSKKSNLC-----------------TKFPFRVTPLLHRD  638
             K GD V+P+F  +C EC  CKS++SN+C                 ++F  R  P+ H  
Sbjct  86   LKPGDHVLPVFTGECKECRHCKSEESNMCDLLRINTDRGVMLNDGKSRFSIRGQPIYHFV  145

Query  639  ETSRFTD  659
             TS F++
Sbjct  146  GTSTFSE  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140