BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034J05

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239250.1|  PREDICTED: uncharacterized protein LOC101257075    115   2e-25   Solanum lycopersicum
ref|XP_006354416.1|  PREDICTED: uncharacterized protein LOC102594...    110   1e-23   Solanum tuberosum [potatoes]
ref|XP_006351984.1|  PREDICTED: protein PAT1 homolog 1-like             105   4e-22   Solanum tuberosum [potatoes]
ref|XP_004251557.1|  PREDICTED: uncharacterized protein LOC101260...    105   4e-22   Solanum lycopersicum
ref|XP_009594235.1|  PREDICTED: protein PAT1 homolog 1-like             104   7e-22   Nicotiana tomentosiformis
ref|XP_009781689.1|  PREDICTED: uncharacterized protein LOC104230555    103   2e-21   Nicotiana sylvestris
ref|XP_009797313.1|  PREDICTED: protein PAT1 homolog 1-like             103   2e-21   Nicotiana sylvestris
ref|XP_009595696.1|  PREDICTED: protein PAT1 homolog 1-like             102   4e-21   Nicotiana tomentosiformis
ref|XP_010313689.1|  PREDICTED: uncharacterized protein LOC101260...    101   1e-20   Solanum lycopersicum
ref|XP_008229675.1|  PREDICTED: protein PAT1 homolog 1-like             100   3e-20   Prunus mume [ume]
ref|XP_011085449.1|  PREDICTED: protein PAT1 homolog 1-like           99.8    4e-20   Sesamum indicum [beniseed]
ref|XP_011100381.1|  PREDICTED: uncharacterized protein LOC105178578  96.7    3e-19   Sesamum indicum [beniseed]
ref|XP_009757677.1|  PREDICTED: uncharacterized protein LOC104210470  96.7    4e-19   Nicotiana sylvestris
ref|XP_002264820.1|  PREDICTED: protein PAT1 homolog 1-like           96.3    5e-19   Vitis vinifera
emb|CBI34052.3|  unnamed protein product                              95.1    5e-19   Vitis vinifera
ref|XP_009602223.1|  PREDICTED: uncharacterized protein LOC104097371  95.5    8e-19   Nicotiana tomentosiformis
ref|XP_009377953.1|  PREDICTED: protein PAT1 homolog 1-like           93.2    6e-18   Pyrus x bretschneideri [bai li]
ref|XP_008342293.1|  PREDICTED: protein PAT1 homolog 1-like           92.8    8e-18   
gb|EYU42843.1|  hypothetical protein MIMGU_mgv1a001457mg              92.8    8e-18   Erythranthe guttata [common monkey flower]
ref|XP_008378353.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  92.4    1e-17   
ref|XP_009375341.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  91.7    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_010112872.1|  hypothetical protein L484_017708                 91.3    3e-17   
ref|XP_009375342.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  89.7    8e-17   
ref|XP_004303935.1|  PREDICTED: protein PAT1 homolog 1                85.1    3e-15   Fragaria vesca subsp. vesca
ref|XP_007217055.1|  hypothetical protein PRUPE_ppa001180mg           84.3    4e-15   
ref|XP_010435003.1|  PREDICTED: protein PAT1 homolog 1-like           82.8    1e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006373646.1|  hypothetical protein POPTR_0016s02130g           82.8    2e-14   
ref|XP_011008549.1|  PREDICTED: uncharacterized protein LOC105113895  82.4    2e-14   Populus euphratica
ref|XP_010440363.1|  PREDICTED: protein PAT1 homolog 1-like           81.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010496132.1|  PREDICTED: protein PAT1 homolog 1-like           81.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010532520.1|  PREDICTED: uncharacterized protein LOC104808528  81.6    4e-14   Tarenaya hassleriana [spider flower]
ref|XP_010525174.1|  PREDICTED: uncharacterized protein LOC104803017  81.3    4e-14   Tarenaya hassleriana [spider flower]
emb|CDP16041.1|  unnamed protein product                              81.6    5e-14   Coffea canephora [robusta coffee]
ref|XP_006481340.1|  PREDICTED: uncharacterized protein LOC102618...  81.3    5e-14   Citrus sinensis [apfelsine]
ref|XP_006481341.1|  PREDICTED: uncharacterized protein LOC102618...  80.9    6e-14   Citrus sinensis [apfelsine]
emb|CDY39512.1|  BnaA01g24760D                                        80.5    8e-14   Brassica napus [oilseed rape]
ref|XP_009108983.1|  PREDICTED: uncharacterized protein LOC103834...  80.5    9e-14   Brassica rapa
ref|NP_188866.1|  Topoisomerase II-associated protein PAT1            80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF00849.1|  hypothetical protein                                 80.1    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883351.1|  hypothetical protein ARALYDRAFT_479740           79.7    2e-13   
emb|CDY46332.1|  BnaC01g31660D                                        79.3    2e-13   Brassica napus [oilseed rape]
ref|XP_002308825.2|  hypothetical protein POPTR_0006s02270g           79.0    3e-13   
ref|XP_011004464.1|  PREDICTED: uncharacterized protein LOC105110947  78.6    4e-13   Populus euphratica
ref|XP_011036076.1|  PREDICTED: protein PAT1 homolog 1-like           78.6    4e-13   Populus euphratica
ref|NP_567452.2|  Topoisomerase II-associated protein PAT1            78.2    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036063.1|  PREDICTED: protein PAT1 homolog 1-like           77.8    6e-13   Eucalyptus grandis [rose gum]
ref|XP_004147742.1|  PREDICTED: uncharacterized protein LOC101213130  77.0    1e-12   Cucumis sativus [cucumbers]
ref|XP_008451848.1|  PREDICTED: uncharacterized protein LOC103493011  77.0    1e-12   Cucumis melo [Oriental melon]
ref|XP_009108988.1|  PREDICTED: uncharacterized protein LOC103834...  75.9    2e-12   Brassica rapa
ref|XP_006297023.1|  hypothetical protein CARUB_v10013016mg           75.5    4e-12   Capsella rubella
ref|XP_010488248.1|  PREDICTED: uncharacterized protein LOC104766124  75.1    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010466506.1|  PREDICTED: uncharacterized protein LOC104746679  75.1    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007049005.1|  Topoisomerase II-associated protein PAT1, pu...  74.7    6e-12   
ref|XP_002868239.1|  hypothetical protein ARALYDRAFT_915331           74.7    6e-12   Arabidopsis lyrata subsp. lyrata
gb|KJB42926.1|  hypothetical protein B456_007G174200                  74.7    7e-12   Gossypium raimondii
ref|XP_006283147.1|  hypothetical protein CARUB_v10004170mg           74.3    8e-12   Capsella rubella
gb|KJB42927.1|  hypothetical protein B456_007G174200                  74.3    9e-12   Gossypium raimondii
gb|KJB08598.1|  hypothetical protein B456_001G092700                  73.6    1e-11   Gossypium raimondii
gb|KJB08599.1|  hypothetical protein B456_001G092700                  73.6    2e-11   Gossypium raimondii
ref|XP_010511200.1|  PREDICTED: uncharacterized protein LOC104787331  73.6    2e-11   
gb|EPS66560.1|  hypothetical protein M569_08215                       73.2    2e-11   Genlisea aurea
ref|XP_006414611.1|  hypothetical protein EUTSA_v10024461mg           72.8    2e-11   Eutrema salsugineum [saltwater cress]
gb|KFK39518.1|  hypothetical protein AALP_AA3G254500                  72.8    3e-11   Arabis alpina [alpine rockcress]
ref|XP_008353622.1|  PREDICTED: uncharacterized protein LOC103417209  67.8    4e-11   
gb|KHG26425.1|  Protein PAT1                                          72.0    5e-11   Gossypium arboreum [tree cotton]
ref|XP_006406189.1|  hypothetical protein EUTSA_v10020108mg           72.0    5e-11   Eutrema salsugineum [saltwater cress]
gb|EYU43157.1|  hypothetical protein MIMGU_mgv1a016393mg              66.6    1e-10   Erythranthe guttata [common monkey flower]
gb|KJB10632.1|  hypothetical protein B456_001G212600                  70.9    1e-10   Gossypium raimondii
emb|CDY54867.1|  BnaC01g22630D                                        70.5    1e-10   Brassica napus [oilseed rape]
emb|CDY37402.1|  BnaC05g30280D                                        68.9    4e-10   Brassica napus [oilseed rape]
emb|CDY50269.1|  BnaAnng10330D                                        68.6    7e-10   Brassica napus [oilseed rape]
ref|XP_004165263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  68.2    8e-10   
ref|XP_009147964.1|  PREDICTED: protein PAT1 homolog 1                67.8    1e-09   Brassica rapa
gb|KDO64332.1|  hypothetical protein CISIN_1g0038251mg                62.8    2e-09   Citrus sinensis [apfelsine]
gb|KFK23118.1|  hypothetical protein AALP_AAs49591U000400             66.6    2e-09   Arabis alpina [alpine rockcress]
ref|XP_006283146.1|  hypothetical protein CARUB_v10004170mg           66.6    3e-09   
ref|XP_002520595.1|  hypothetical protein RCOM_0673440                66.2    4e-09   Ricinus communis
emb|CAN68728.1|  hypothetical protein VITISV_033604                   63.9    2e-08   Vitis vinifera
ref|XP_006597998.1|  PREDICTED: uncharacterized protein LOC100779...  63.2    3e-08   Glycine max [soybeans]
ref|XP_007133386.1|  hypothetical protein PHAVU_011G174900g           62.4    6e-08   Phaseolus vulgaris [French bean]
emb|CDY10630.1|  BnaA05g17320D                                        61.2    1e-07   Brassica napus [oilseed rape]
ref|XP_009145394.1|  PREDICTED: uncharacterized protein LOC103869095  61.2    1e-07   Brassica rapa
dbj|BAB01945.1|  unnamed protein product                              61.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684289.1|  PREDICTED: uncharacterized protein LOC104898860  60.1    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006597997.1|  PREDICTED: uncharacterized protein LOC100779...  60.1    4e-07   Glycine max [soybeans]
gb|KDP44628.1|  hypothetical protein JCGZ_22047                       58.9    8e-07   Jatropha curcas
ref|XP_004514400.1|  PREDICTED: uncharacterized protein LOC101512706  58.5    1e-06   
gb|KDP25122.1|  hypothetical protein JCGZ_22657                       58.5    1e-06   Jatropha curcas
ref|XP_007049006.1|  Topoisomerase II-associated protein PAT1, pu...  58.2    2e-06   
emb|CDP13609.1|  unnamed protein product                              57.4    2e-06   Coffea canephora [robusta coffee]
gb|KHN16432.1|  hypothetical protein glysoja_046875                   57.0    4e-06   Glycine soja [wild soybean]
ref|XP_006597999.1|  PREDICTED: uncharacterized protein LOC100779...  56.6    5e-06   Glycine max [soybeans]
ref|XP_009406732.1|  PREDICTED: uncharacterized protein LOC103989...  56.2    6e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406733.1|  PREDICTED: uncharacterized protein LOC103989...  56.2    7e-06   
ref|XP_010923783.1|  PREDICTED: uncharacterized protein LOC105046771  56.2    8e-06   
emb|CAB10277.1|  hypothetical protein                                 55.8    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDO64335.1|  hypothetical protein CISIN_1g0038251mg                52.4    1e-05   Citrus sinensis [apfelsine]
ref|NP_001044369.2|  Os01g0769000                                     55.5    1e-05   
ref|XP_010243929.1|  PREDICTED: protein PAT1 homolog 1-like           54.7    2e-05   Nelumbo nucifera [Indian lotus]
gb|KHG07822.1|  Protein PAT1                                          54.7    2e-05   Gossypium arboreum [tree cotton]
gb|EAZ23222.1|  hypothetical protein OsJ_06910                        54.3    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86044.1|  hypothetical protein OsI_07409                        54.3    3e-05   Oryza sativa Indica Group [Indian rice]
ref|NP_001046960.1|  Os02g0517300                                     54.3    3e-05   
gb|KHG07107.1|  Protein PAT1                                          54.3    3e-05   Gossypium arboreum [tree cotton]
ref|XP_011014091.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    4e-05   Populus euphratica
ref|XP_011014090.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    4e-05   Populus euphratica
ref|XP_011038110.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    4e-05   Populus euphratica
ref|XP_011038109.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  53.9    4e-05   Populus euphratica
emb|CBI21787.3|  unnamed protein product                              51.6    6e-05   Vitis vinifera
ref|XP_002441360.1|  hypothetical protein SORBIDRAFT_09g025190        53.1    6e-05   Sorghum bicolor [broomcorn]
ref|XP_002300546.2|  hypothetical protein POPTR_0001s46190g           52.4    1e-04   Populus trichocarpa [western balsam poplar]
gb|KJB82133.1|  hypothetical protein B456_013G178200                  52.0    2e-04   Gossypium raimondii
ref|XP_009399054.1|  PREDICTED: protein PAT1 homolog 1-like           52.0    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004961543.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  52.0    2e-04   Setaria italica
ref|XP_006646364.1|  PREDICTED: uncharacterized protein LOC102701783  51.6    2e-04   Oryza brachyantha
ref|XP_008649853.1|  PREDICTED: uncharacterized protein LOC103630586  51.6    2e-04   Zea mays [maize]
ref|XP_004961544.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.6    2e-04   Setaria italica
ref|XP_003569904.1|  PREDICTED: uncharacterized protein LOC100838182  51.6    3e-04   Brachypodium distachyon [annual false brome]
ref|XP_010243919.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010243918.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  51.2    3e-04   Nelumbo nucifera [Indian lotus]
ref|XP_006478034.1|  PREDICTED: uncharacterized protein LOC102611...  51.2    3e-04   Citrus sinensis [apfelsine]
ref|XP_010645006.1|  PREDICTED: uncharacterized protein LOC100267...  51.2    4e-04   Vitis vinifera
ref|XP_006478033.1|  PREDICTED: uncharacterized protein LOC102611...  51.2    4e-04   Citrus sinensis [apfelsine]
ref|XP_006441043.1|  hypothetical protein CICLE_v10018922mg           50.8    4e-04   Citrus clementina [clementine]
gb|KDO40140.1|  hypothetical protein CISIN_1g003844mg                 50.8    4e-04   Citrus sinensis [apfelsine]
ref|XP_009416762.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  50.8    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416760.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  50.8    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009416761.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  50.4    5e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003568135.1|  PREDICTED: protein PAT1 homolog 1-like           50.4    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_008793552.1|  PREDICTED: protein PAT1 homolog 1-like isofo...  50.4    6e-04   Phoenix dactylifera
gb|EMT17005.1|  Lipoyl synthase, mitochondrial                        50.4    7e-04   
ref|XP_003545913.2|  PREDICTED: uncharacterized protein LOC100787648  50.1    9e-04   Glycine max [soybeans]



>ref|XP_004239250.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321026.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321027.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
 ref|XP_010321028.1| PREDICTED: uncharacterized protein LOC101257075 [Solanum lycopersicum]
Length=820

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 117/154 (76%), Gaps = 7/154 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+ RDFKD T SS S SD  +F+ASQYAFFGRDIAEE+ELGGLED    +D S  G 
Sbjct  1    MERSNSRDFKDLTSSSGSISDGALFDASQYAFFGRDIAEEVELGGLEDG---QDNSDLGV  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                G         EYHLFEK+EGS +GSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  58   GGGLGDDEI----QEYHLFEKDEGSVVGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS ADWAK+AD  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAADWAKEADFHDWFDQHLSDTECY  147



>ref|XP_006354416.1| PREDICTED: uncharacterized protein LOC102594467 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354417.1| PREDICTED: uncharacterized protein LOC102594467 isoform X2 [Solanum 
tuberosum]
Length=821

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 121/154 (79%), Gaps = 7/154 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+ RDFKD T SSSS SD  +F+ASQYAFFG DIAEE+ELGGLED +   D +    
Sbjct  1    MERSNSRDFKDLTSSSSSISDGALFDASQYAFFGLDIAEEVELGGLEDGQDNSDLA----  56

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                G G GDD + EYHLFEK+EGS +GSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  57   ---VGGGLGDDEIQEYHLFEKDEGSAVGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  147



>ref|XP_006351984.1| PREDICTED: protein PAT1 homolog 1-like [Solanum tuberosum]
Length=816

 Score =   105 bits (262),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 100/154 (65%), Positives = 111/154 (72%), Gaps = 8/154 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  +DF D ++SSSS SDS +F+ASQYAFFGRD  EE+EL                 
Sbjct  1    MERSDCKDFMDLSNSSSSISDSALFDASQYAFFGRDSGEEVEL--------GGLEEEGNN  52

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
             V    GG  D  HEYHLFEK+EGS LGSLSD+DDLATTF KLNR VAGPRHPG+IGDRG
Sbjct  53   CVPVVDGGFGDDTHEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVAGPRHPGIIGDRG  112

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS A+WAK+ D PD  DQH SDTECY
Sbjct  113  SGSFSRESSSAAEWAKETDFPDCFDQHLSDTECY  146



>ref|XP_004251557.1| PREDICTED: uncharacterized protein LOC101260608 isoform X2 [Solanum 
lycopersicum]
Length=817

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 113/154 (73%), Gaps = 7/154 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  +DF D ++SSSS SD+ +F+ASQYAFFGRDI EE+EL          +   +  
Sbjct  1    MERSDCKDFMDLSNSSSSISDNALFDASQYAFFGRDIGEEVEL-------GGLEEEGNNC  53

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
              A   G GD   HEYHLFEK+EGS LGSLSD+DDLATTF KLNR VAGPRHPG+IGDRG
Sbjct  54   VPAVDGGFGDVDTHEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVAGPRHPGIIGDRG  113

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESS  A+WAK+ D PD  DQH SDTECY
Sbjct  114  SGSFSRESSLAAEWAKETDFPDCFDQHLSDTECY  147



>ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
 ref|XP_009594236.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=822

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 119/155 (77%), Gaps = 8/155 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasds-GVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS+ RD K    SSSS+     +F+ASQYAFFGRDI+EE+ELGGLEDE+   D +   
Sbjct  1    MERSNSRDIKGLASSSSSSISDSALFDASQYAFFGRDISEEVELGGLEDEQENNDLA---  57

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                 G G GDD +HEYHLFEK+EGS L SLSDLDDLATTF KLNR V GPRHPGVIGDR
Sbjct  58   ----VGGGLGDDEIHEYHLFEKDEGSVLSSLSDLDDLATTFSKLNRNVIGPRHPGVIGDR  113

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            GSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  114  GSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  148



>ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
 ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris]
Length=814

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 117/155 (75%), Gaps = 8/155 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasds-GVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS+ RD K  T SSSS+     +F+ASQYAFFG DIAEE+EL GLEDE+   D     
Sbjct  1    MERSNSRDIKGLTSSSSSSISDSALFDASQYAFFGLDIAEEVELSGLEDEQENNDL----  56

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                 G G GDD +HEYHLFEK+EGS L SLSDLDDLATTF KLNR V GPRHPGVIGDR
Sbjct  57   ---VVGGGLGDDEIHEYHLFEKDEGSVLSSLSDLDDLATTFSKLNRNVTGPRHPGVIGDR  113

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            GSGSFSRESSS A+WAK+AD  DW DQH SDTECY
Sbjct  114  GSGSFSRESSSAAEWAKEADFHDWFDQHLSDTECY  148



>ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris]
Length=817

 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 104/154 (68%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+D  D + SSSS SDS  F+ASQYAFFGRDI EE+ELGGL       D   +  
Sbjct  1    MERSDGKDSMDLSHSSSSISDSAHFDASQYAFFGRDIGEEVELGGL-------DEEGNSC  53

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
              +   G GD+ V EYHLFEK+EGS LGSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  54   VPSVDGGFGDEDVQEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS A+WAK+ D  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAAEWAKETDFTDWFDQHLSDTECY  147



>ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis]
Length=817

 Score =   102 bits (255),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 102/154 (66%), Positives = 115/154 (75%), Gaps = 7/154 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DF + + SSSS SDS +F+ASQYAFFGRDI EE+ELGGL       D   +  
Sbjct  1    MERSDGKDFNNLSHSSSSISDSALFDASQYAFFGRDIGEEVELGGL-------DEEGNSC  53

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
              +   G GD+ V EYHLF K+EGS LGSLSD+DDLATTF KLNR V GPRHPGVIGDRG
Sbjct  54   VPSVDGGFGDEDVQEYHLFAKDEGSALGSLSDIDDLATTFSKLNRNVTGPRHPGVIGDRG  113

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS A+W K+ D  DW DQH SDTECY
Sbjct  114  SGSFSRESSSAAEWEKETDFTDWFDQHLSDTECY  147



>ref|XP_010313689.1| PREDICTED: uncharacterized protein LOC101260608 isoform X1 [Solanum 
lycopersicum]
Length=818

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 112/155 (72%), Gaps = 8/155 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasd-sGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS  +DF D ++SSSS S  + +F+ASQYAFFGRDI EE+EL          +   + 
Sbjct  1    MERSDCKDFMDLSNSSSSISADNALFDASQYAFFGRDIGEEVEL-------GGLEEEGNN  53

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
               A   G GD   HEYHLFEK+EGS LGSLSD+DDLATTF KLNR VAGPRHPG+IGDR
Sbjct  54   CVPAVDGGFGDVDTHEYHLFEKDEGSALGSLSDIDDLATTFSKLNRNVAGPRHPGIIGDR  113

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            GSGSFSRESS  A+WAK+ D PD  DQH SDTECY
Sbjct  114  GSGSFSRESSLAAEWAKETDFPDCFDQHLSDTECY  148



>ref|XP_008229675.1| PREDICTED: protein PAT1 homolog 1-like [Prunus mume]
Length=808

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 103/153 (67%), Gaps = 13/153 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+DF +SSS +SD+ +F+ASQY FFG+ +             V E       
Sbjct  1    MERSNGADFRDFLESSSGSSDNKLFDASQYEFFGQKL-------------VEEVELGGLE  47

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                         +EYHLFEK+EG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  48   DEEDRKPLFGPVDNEYHLFEKDEGLGLGSLSDVDDLASTFAKLNKVVTGPRHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            SGSFSRESSS ADWA+D D  +WLDQH  DTE 
Sbjct  108  SGSFSRESSSAADWAQDGDFSNWLDQHMFDTES  140



>ref|XP_011085449.1| PREDICTED: protein PAT1 homolog 1-like [Sesamum indicum]
Length=812

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 113/155 (73%), Gaps = 11/155 (7%)
 Frame = +1

Query  217  MERSSGRDFKDFT-dssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS G+DF DFT  SSSSAS S +F+ASQYAFFG+DI +E          V        
Sbjct  1    MERSDGKDFNDFTDPSSSSASGSALFDASQYAFFGKDIVDE----------VELGGLGDE  50

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                 G  GG++ ++EYHLFEK+EGSGLGSLSD+DDLATTF KLN+VV+GPRHPGVIGDR
Sbjct  51   EEGLPGGFGGEEELNEYHLFEKDEGSGLGSLSDIDDLATTFAKLNKVVSGPRHPGVIGDR  110

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            GSGSFSRESSS   W ++AD PDW DQH SD+E Y
Sbjct  111  GSGSFSRESSSATQWTREADFPDWFDQHISDSEYY  145



>ref|XP_011100381.1| PREDICTED: uncharacterized protein LOC105178578 [Sesamum indicum]
Length=815

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 123/155 (79%), Gaps = 8/155 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFTd-ssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS G+   DF   SSSS SDS +F+ASQYAFFG+ + +E+ELGGLE E+  ED     
Sbjct  1    MERSDGKGLNDFIHPSSSSVSDSALFDASQYAFFGKGVVDEVELGGLEYED--EDVP---  55

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
              V GG  GG+D ++EYHLF+K+EGSGLGSLSD+DDLATTF KLNRVV+GPRHPGVIGDR
Sbjct  56   --VIGGKFGGEDELNEYHLFDKDEGSGLGSLSDMDDLATTFAKLNRVVSGPRHPGVIGDR  113

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            GSGSFSRESSS  +WA++AD PDW D H SD+ECY
Sbjct  114  GSGSFSRESSSATEWAREADFPDWPDHHMSDSECY  148



>ref|XP_009757677.1| PREDICTED: uncharacterized protein LOC104210470 [Nicotiana sylvestris]
Length=814

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 90/154 (58%), Positives = 107/154 (69%), Gaps = 11/154 (7%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            ME+    DF +   SSSS S+  +F+ASQYAFFG ++             + ED ++   
Sbjct  1    MEKFDSNDFSNLASSSSSISEGALFDASQYAFFGEEVELRD---------LEEDENNGVP  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
             + GGFG  +    EYHLFEK+EGS LGSLSDLDDLATTF KLNR V GPRHPGVIGDRG
Sbjct  52   LLGGGFGDDELP--EYHLFEKDEGSALGSLSDLDDLATTFSKLNRNVTGPRHPGVIGDRG  109

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS A+W K+AD PDW DQ+ SD+ECY
Sbjct  110  SGSFSRESSSAAEWTKEADFPDWFDQNLSDSECY  143



>ref|XP_002264820.1| PREDICTED: protein PAT1 homolog 1-like [Vitis vinifera]
Length=812

 Score = 96.3 bits (238),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 95/153 (62%), Gaps = 16/153 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G DFKD  ++SSS     +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSQGLDFKDLPEASSSDG--ALFDASQYEFFGQHAV--------------EEVELGGL  44

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EY LFE+EE  GL SLSD+DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  45   ENEENIPVFGSVDDEYQLFEREESVGLSSLSDIDDLASTFSKLNRVVTGPRNPGVIGDRG  104

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            SGSFSRESSS ADWA+D D P+WLDQH  D EC
Sbjct  105  SGSFSRESSSAADWAQDTDFPNWLDQHMFDAEC  137



>emb|CBI34052.3| unnamed protein product [Vitis vinifera]
Length=513

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 95/153 (62%), Gaps = 16/153 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G DFKD  ++SSS     +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSQGLDFKDLPEASSSDG--ALFDASQYEFFGQHAV--------------EEVELGGL  44

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EY LFE+EE  GL SLSD+DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  45   ENEENIPVFGSVDDEYQLFEREESVGLSSLSDIDDLASTFSKLNRVVTGPRNPGVIGDRG  104

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            SGSFSRESSS ADWA+D D P+WLDQH  D EC
Sbjct  105  SGSFSRESSSAADWAQDTDFPNWLDQHMFDAEC  137



>ref|XP_009602223.1| PREDICTED: uncharacterized protein LOC104097371 [Nicotiana tomentosiformis]
Length=814

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 89/154 (58%), Positives = 107/154 (69%), Gaps = 11/154 (7%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            ME+    DF +   SSSS S+  +F+ASQYAFFG ++             + ED ++   
Sbjct  1    MEKFDSNDFSNLASSSSSVSEGALFDASQYAFFGEEVELRG---------LEEDGNNGVP  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
             + GGFG  +    EYHLFEK+EGS LGSLSDLDDLATTF KLNR V GPRHPGVIGDRG
Sbjct  52   LLGGGFGDDELP--EYHLFEKDEGSALGSLSDLDDLATTFSKLNRNVTGPRHPGVIGDRG  109

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            SGSFSRESSS A+W K++D PDW DQ+ SD+ECY
Sbjct  110  SGSFSRESSSAAEWTKESDFPDWFDQNLSDSECY  143



>ref|XP_009377953.1| PREDICTED: protein PAT1 homolog 1-like [Pyrus x bretschneideri]
Length=817

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+D  + SSS +   +F+ASQY FFG+++             V E       
Sbjct  13   MERSNGTDFRDLLERSSSENK--LFDASQYEFFGQNL-------------VDEVELGGLD  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
             V           +EYHLFEKEEG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  58   DVEDRKPLFGPVDNEYHLFEKEEGLGLGSLSDVDDLASTFAKLNKVVTGPRHPGVIGDRG  117

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  118  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  149



>ref|XP_008342293.1| PREDICTED: protein PAT1 homolog 1-like [Malus domestica]
Length=803

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 98/152 (64%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+D    SSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDLLXRSSSENK--LFDASQYEFFGQNL-------------VDEVELGGLD  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                         +EYHLFEKEEG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  46   DEEDRKPLFGPVDNEYHLFEKEEGLGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGDRG  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  106  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata]
Length=816

 Score = 92.8 bits (229),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 120/155 (77%), Gaps = 8/155 (5%)
 Frame = +1

Query  217  MERSSGRDFKDFT-dssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS G DF +F   SSSS SDS +F+ASQY FFG+ + +E+ELGGLED    ED     
Sbjct  1    MERSDGNDFNEFLDPSSSSVSDSVLFDASQYTFFGKGMVDEVELGGLED----EDEG---  53

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
             PV  G   G+D ++EYHLF+K+EGSGLGSLSD+DDLATTF KLN+VV GPRHPGVIGDR
Sbjct  54   VPVNAGRFSGEDELNEYHLFDKDEGSGLGSLSDIDDLATTFAKLNKVVTGPRHPGVIGDR  113

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTECY  678
            GSGSFSRESSS  +WA++AD PDW + H SD+ECY
Sbjct  114  GSGSFSRESSSATEWAREADCPDWHEHHMSDSECY  148



>ref|XP_008378353.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441447 
[Malus domestica]
Length=804

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+D  +SSSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDLLESSSSENK--LFDASQYEFFGQNV-------------VDEVELGGLD  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G         +EYHLFEK+E  G+GSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  46   HEEGRKPLFGPADNEYHLFEKDEALGMGSLSDIDDLASTFAKLNKVVTGPRHPGVIGDRG  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  106  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_009375341.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Pyrus x bretschneideri]
Length=804

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+D  +SSSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDVLESSSSENK--LFDASQYEFFGQNV-------------VDEVELGGLD  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G         +EYHLFEK+E  GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  46   YEEGRKPLFGPADNEYHLFEKDEALGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGDRG  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D D  +WLDQH  DTE
Sbjct  106  SGSFSRESSSATDWAQDGDFNNWLDQHMFDTE  137



>ref|XP_010112872.1| hypothetical protein L484_017708 [Morus notabilis]
 gb|EXC35007.1| hypothetical protein L484_017708 [Morus notabilis]
Length=812

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 111/160 (69%), Gaps = 21/160 (13%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsG--------VFNASQYAFFGRdiaeeielggledeeVR  372
            MERS G+DF+DF ++SSS    G        +F+AS+Y FFG++  +E+ELGGLE+EE  
Sbjct  1    MERSDGKDFRDFVENSSSKPHLGDLSRSHNALFDASRYEFFGQNAGDEVELGGLEEEEDD  60

Query  373  EDTSSSgapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRH  552
            +    S                EYHLFE+EE +G GSLSD+DDLA+TF KLN+VV GPRH
Sbjct  61   KTLFGSVDT-------------EYHLFEREESAGFGSLSDIDDLASTFAKLNKVVTGPRH  107

Query  553  PGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            PGVIGDRGSGSFSRESSS ADW +DAD  +WLDQH  DT+
Sbjct  108  PGVIGDRGSGSFSRESSSAADWVQDADFSNWLDQHMFDTD  147



>ref|XP_009375342.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Pyrus x bretschneideri]
Length=801

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 90/152 (59%), Gaps = 18/152 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+D  +SSSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDVLESSSSENK--LFDASQYEFFGQNV-------------VDEVELGGLD  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G         +EYHLFEK+E  GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGD  
Sbjct  46   YEEGRKPLFGPADNEYHLFEKDEALGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGD--  103

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
                   S  T DWA+D D  +WLDQH  DTE
Sbjct  104  -RGSGSFSRETTDWAQDGDFNNWLDQHMFDTE  134



>ref|XP_004303935.1| PREDICTED: protein PAT1 homolog 1 [Fragaria vesca subsp. vesca]
Length=806

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 108/155 (70%), Gaps = 18/155 (12%)
 Frame = +1

Query  217  MERSS---GRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSS  387
            MERS    G DF+D   SSS  +   +F+ASQY FFG+++AEE+ELGGL+DE  R+    
Sbjct  1    MERSGSGGGADFRDLLRSSSENN--ALFDASQYEFFGQNVAEEVELGGLDDENDRKSLFG  58

Query  388  SgapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIG  567
            S               +EYHLFEK+EG GLGSLSD+DDLATTF KLN+VV GPRHPGVIG
Sbjct  59   SVD-------------NEYHLFEKDEGLGLGSLSDVDDLATTFAKLNKVVTGPRHPGVIG  105

Query  568  DrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            DRGSGSFSRESSS  DWA+D D   WLDQ   DT+
Sbjct  106  DRGSGSFSRESSSATDWAQDGDFGSWLDQQMFDTD  140



>ref|XP_007217055.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
 gb|EMJ18254.1| hypothetical protein PRUPE_ppa001180mg [Prunus persica]
Length=886

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 83/129 (64%), Gaps = 13/129 (10%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            +F+ASQY FFG+               V E                    +EYHLFEK+E
Sbjct  102  LFDASQYEFFGQKS-------------VEEVELGGLEDEEDRKPLFGPVDNEYHLFEKDE  148

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS ADWA+D D  +W
Sbjct  149  GLGLGSLSDVDDLASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSAADWAQDGDFSNW  208

Query  646  LDQHFSDTE  672
            LDQH  DTE
Sbjct  209  LDQHMFDTE  217



>ref|XP_010435003.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 76/147 (52%), Positives = 96/147 (65%), Gaps = 16/147 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+ +DF +F  ++SS +++ +F+ASQY FFG+ + E    G  ED  VR        
Sbjct  1    MERSNSKDFYNFARTTSSDNNNALFDASQYEFFGQSLEEVELGGLDEDASVRGHVDD---  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLS++DDLATTF KLNR V GP+H GVIGDRG
Sbjct  58   -------------EEYHLFDKREGAGLGSLSEMDDLATTFAKLNRNVTGPKHLGVIGDRG  104

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  105  SGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_006373646.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
 gb|ERP51443.1| hypothetical protein POPTR_0016s02130g [Populus trichocarpa]
Length=788

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 94/152 (62%), Gaps = 18/152 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DFK+FT+SSS      +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTESSSG----ALFDASQYEFFGQHAV--------------EEVELGGL  42

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGENLLLGPTNDEYRLFDRDEGVCLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D +   WLDQ   + E
Sbjct  103  SGSFSRESSSATDWAQDGEFTSWLDQQMFNAE  134



>ref|XP_011008549.1| PREDICTED: uncharacterized protein LOC105113895 [Populus euphratica]
Length=788

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 77/152 (51%), Positives = 94/152 (62%), Gaps = 18/152 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DFK+FT+SSS      +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTESSSG----ALFDASQYEFFGQHAV--------------EEVELGGL  42

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGENLLLGPTNDEYRLFDRDEGVCLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D +   WLDQ   + E
Sbjct  103  SGSFSRESSSATDWAQDGEFTSWLDQQMLNAE  134



>ref|XP_010440363.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=795

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 93/147 (63%), Gaps = 16/147 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  +DF +F  ++SS + S +F+ASQY FFG+ + E    G  ED  VR        
Sbjct  1    MERSDSKDFYNFARTTSSDNKSALFDASQYEFFGQSLEEVELGGLDEDASVRGHV-----  55

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGS S++DDLATTF KLNR V GP+H GVIGDRG
Sbjct  56   -----------DDEEYHLFDKREGTGLGSFSEMDDLATTFAKLNRNVTGPKHLGVIGDRG  104

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  105  SGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_010496132.1| PREDICTED: protein PAT1 homolog 1-like [Camelina sativa]
Length=796

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 93/147 (63%), Gaps = 16/147 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  +DF +F   +SS + S +F+ASQY FFG+ + E    G  ED  VR        
Sbjct  1    MERSDSKDFYNFARKTSSDNKSALFDASQYEFFGQSLEEVELGGLDEDASVRGHVDD---  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  58   -------------EEYHLFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  104

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  105  SGSFSRESSTATDWTQDNEFTSWLDQH  131



>ref|XP_010532520.1| PREDICTED: uncharacterized protein LOC104808528 [Tarenaya hassleriana]
Length=785

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 95/155 (61%), Gaps = 19/155 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  R   DF+ +SS A    +F+ASQY FFG++              V E+    G 
Sbjct  1    MERSDSRGSYDFSRASSDA---ALFDASQYEFFGQN--------------VVEEVELGGL  43

Query  397  pvaggfgggddgvHE--YHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
                          E  YHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGD
Sbjct  44   EDEEAKAAVLGYADEDAYHLFDKGEGTGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGD  103

Query  571  rgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            RGSGSFSRESSS  DW +DA+L  WLDQH  D + 
Sbjct  104  RGSGSFSRESSSATDWTQDAELSSWLDQHMLDVQA  138



>ref|XP_010525174.1| PREDICTED: uncharacterized protein LOC104803017 [Tarenaya hassleriana]
Length=784

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 102/153 (67%), Gaps = 15/153 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS   DF +F  +SS      +F+ASQY FFG+++ EE+ELGGL      ED   +  
Sbjct  1    MERSDSWDFNNFARASSDT---ALFDASQYEFFGQNVLEEVELGGL------EDEVETTP  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   VPGYADDD------EYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            SGSFSRESSS  DW +DA+L  WLDQH  D + 
Sbjct  106  SGSFSRESSSATDWTQDAELSSWLDQHMLDEQA  138



>emb|CDP16041.1| unnamed protein product [Coffea canephora]
Length=958

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             +F+ASQYAFFG+DI EE++LGGLE     E   S+  PV GGFG  DD + EYHLF+K+
Sbjct  32   ALFDASQYAFFGKDIVEEVDLGGLE----EEYDDSASIPVLGGFGARDDDLQEYHLFDKD  87

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EGSGLGSLSD+DDLATTF KLNRVV GPRHPGVIGDRGSGSFSRESSS A+W +++D P+
Sbjct  88   EGSGLGSLSDMDDLATTFSKLNRVVTGPRHPGVIGDRGSGSFSRESSSAAEWVQESDFPE  147

Query  643  WLDQHFSDTECY  678
            W D H SD+E Y
Sbjct  148  WRD-HMSDSEFY  158



>ref|XP_006481340.1| PREDICTED: uncharacterized protein LOC102618153 isoform X1 [Citrus 
sinensis]
Length=793

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DF +FT +SS +    +F+ASQY FFG+++ EE+ELGGL      ED   + A
Sbjct  1    MERSRGKDFLNFTRTSSGS---AMFDASQYEFFGQNVGEEVELGGL------EDEGDNNA  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
            PV G          EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGDR 
Sbjct  52   PVFGSVTDD-----EYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGDRS  106

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
                   S++T DWA+D +  +WLDQ   D E
Sbjct  107  GSFSRESSTAT-DWAQDGEFGNWLDQQMLDLE  137



>ref|XP_006481341.1| PREDICTED: uncharacterized protein LOC102618153 isoform X2 [Citrus 
sinensis]
Length=768

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 100/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DF +FT +SS +    +F+ASQY FFG+++ EE+ELGGL      ED   + A
Sbjct  1    MERSRGKDFLNFTRTSSGS---AMFDASQYEFFGQNVGEEVELGGL------EDEGDNNA  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
            PV G          EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGDR 
Sbjct  52   PVFGSVTDD-----EYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGDRS  106

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
                   S++T DWA+D +  +WLDQ   D E
Sbjct  107  GSFSRESSTAT-DWAQDGEFGNWLDQQMLDLE  137



>emb|CDY39512.1| BnaA01g24760D [Brassica napus]
Length=774

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 95/146 (65%), Gaps = 10/146 (7%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS+  +S VF+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFARASSADQNSSVFDASQYDFFGKNLDEMSLGGLDDDEAI---------  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                    G D   EYHLF+K E  G GSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   -APVLGHPGADADDEYHLFDKAEAGGFGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  110

Query  577  sgsfsresssTADWAKDADLPDWLDQ  654
            SGSFSRESSS  DW  DA+L  WLD+
Sbjct  111  SGSFSRESSSATDWTHDAELTSWLDE  136



>ref|XP_009108983.1| PREDICTED: uncharacterized protein LOC103834665 isoform X1 [Brassica 
rapa]
Length=774

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 95/146 (65%), Gaps = 10/146 (7%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS+  +S VF+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFARASSADQNSSVFDASQYDFFGKNLDEMSLGGLDDDEVI---------  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                    G D   EYHLF+K E  G GSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   -APVLGHPGADADDEYHLFDKAEAGGFGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  110

Query  577  sgsfsresssTADWAKDADLPDWLDQ  654
            SGSFSRESSS  DW  DA+L  WLD+
Sbjct  111  SGSFSRESSSATDWTHDAELTSWLDE  136



>ref|NP_188866.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AEE76616.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=782

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 77/147 (52%), Positives = 96/147 (65%), Gaps = 13/147 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ +    G  +D  +      +  
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMELGGLDDDGVIAPVLGHADD  60

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  61   D-------------EYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTQDAELTSWLDEQ  134



>dbj|BAF00849.1| hypothetical protein [Arabidopsis thaliana]
Length=782

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 77/147 (52%), Positives = 96/147 (65%), Gaps = 13/147 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ +    G  +D  +      +  
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMELGGLDDDGVIAPVLGHADD  60

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  61   D-------------EYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|XP_002883351.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59610.1| hypothetical protein ARALYDRAFT_479740 [Arabidopsis lyrata subsp. 
lyrata]
Length=782

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 77/147 (52%), Positives = 95/147 (65%), Gaps = 13/147 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ +    G  +D  +      +  
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDDMEIGGLDDDGVIAPVLGHADD  60

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  61   D-------------EYHLFDKGEGAGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW  DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTHDAELTSWLDEQ  134



>emb|CDY46332.1| BnaC01g31660D [Brassica napus]
Length=774

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 94/147 (64%), Gaps = 10/147 (7%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS+   S VF+ASQY FFG+++ E +  G  +DE +         
Sbjct  1    MERSESRDLYNFARASSADQKSSVFDASQYDFFGKNLDEMLLGGLDDDEAI---------  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                      D   EYHLF+K E  GLGSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  52   -APVLGLADADADAEYHLFDKAEAPGLGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  110

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW  D +L  WLD+ 
Sbjct  111  SGSFSRESSSATDWTYDPELTSWLDEQ  137



>ref|XP_002308825.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
 gb|EEE92348.2| hypothetical protein POPTR_0006s02270g [Populus trichocarpa]
Length=789

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 18/148 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DFK+FTDSSS      +F+AS+Y FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTDSSSG----ALFDASRYEFFGQHAV--------------EEVELGGL  42

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGDNLVLGPADDEYRLFDRDEGVSLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  577  sgsfsresssTADWAKDADLPDWLDQHF  660
            SGSFSRESSS  DWA+D +   WLDQ  
Sbjct  103  SGSFSRESSSATDWAQDGEFAGWLDQQM  130



>ref|XP_011004464.1| PREDICTED: uncharacterized protein LOC105110947 [Populus euphratica]
Length=789

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 18/148 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DFK+FTDSSS      +F+AS+Y FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTDSSSG----ALFDASRYEFFGQHDV--------------EEVELGGL  42

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGDNPVLGPADDEYRLFDRDEGVSLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  577  sgsfsresssTADWAKDADLPDWLDQHF  660
            SGSFSRESSS  DWA+D +   WLDQ  
Sbjct  103  SGSFSRESSSATDWAQDGEFAGWLDQQM  130



>ref|XP_011036076.1| PREDICTED: protein PAT1 homolog 1-like [Populus euphratica]
Length=789

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 18/148 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DFK+FTDSSS      +F+AS+Y FFG+                 E+    G 
Sbjct  1    MERSDGKDFKEFTDSSSG----ALFDASRYEFFGQHDV--------------EEVELGGL  42

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
               G          EY LF+++EG  LGSLS++DDLA+TF KLNRVV GPR+PGVIGDRG
Sbjct  43   EDEGDNPVLGPADDEYRLFDRDEGVSLGSLSEIDDLASTFAKLNRVVTGPRNPGVIGDRG  102

Query  577  sgsfsresssTADWAKDADLPDWLDQHF  660
            SGSFSRESSS  DWA+D +   WLDQ  
Sbjct  103  SGSFSRESSSATDWAQDGEFAGWLDQQM  130



>ref|NP_567452.2| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
 gb|AAK59544.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83534.1| Topoisomerase II-associated protein PAT1 [Arabidopsis thaliana]
Length=787

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 92/147 (63%), Gaps = 17/147 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RDF +F  +SS  +   +F+ASQY FFG+ + E    G  +D  VR        
Sbjct  1    MERSDSRDFYNFAKTSSDNNS-ALFDASQYEFFGQSLEEVELGGLDDDGTVRGHVDD---  56

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  57   -------------EEYHLFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  103

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  104  SGSFSRESSTATDWTQDNEFTSWLDQH  130



>ref|XP_010036063.1| PREDICTED: protein PAT1 homolog 1-like [Eucalyptus grandis]
 gb|KCW47590.1| hypothetical protein EUGRSUZ_K01336 [Eucalyptus grandis]
Length=806

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 79/152 (52%), Positives = 92/152 (61%), Gaps = 17/152 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  +D K+  D SS      +F+ASQYAFFG+++             V E       
Sbjct  1    MERSDSKDSKELPDGSSG----ALFDASQYAFFGQNL-------------VEEMELGGLE  43

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                 F        EYHLFE+EEG GLGSLS++DDLATTF KLNRVV GPR+PGVIGDRG
Sbjct  44   DGVQDFPVFGPADDEYHLFEREEGGGLGSLSEVDDLATTFAKLNRVVTGPRNPGVIGDRG  103

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS  DWA+D D   W D +  D E
Sbjct  104  SGSFSRESSSATDWAQDGDFSTWPDPYSFDAE  135



>ref|XP_004147742.1| PREDICTED: uncharacterized protein LOC101213130 [Cucumis sativus]
 gb|KGN53503.1| hypothetical protein Csa_4G062390 [Cucumis sativus]
Length=808

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 94/153 (61%), Gaps = 17/153 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            ME+S   D +D   S+ ++S + +F+AS+Y FFG++              V  +    G 
Sbjct  1    MEQSDVNDLRD---SAENSSANSLFDASRYEFFGQN--------------VVGEVELGGL  43

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EY LF +EE +GLGSLS++DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  44   EEDEDAPLFGSTDEEYRLFVREESAGLGSLSEMDDLASTFAKLNKVVTGPRHPGVIGDRG  103

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            SGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  104  SGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  136



>ref|XP_008451848.1| PREDICTED: uncharacterized protein LOC103493011 [Cucumis melo]
Length=808

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 94/153 (61%), Gaps = 17/153 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            ME+S   D +D   S+ ++S + +F+AS+Y FFG++              V  +    G 
Sbjct  1    MEQSDVNDLRD---SAENSSANSLFDASRYEFFGQN--------------VVGEVELGGL  43

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EY LF +EE +GLGSLS++DDLA+TF KLN+VV GPRHPGVIGDRG
Sbjct  44   EEDEDVPLFGSTDEEYRLFVREESAGLGSLSEMDDLASTFAKLNKVVTGPRHPGVIGDRG  103

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            SGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  104  SGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  136



>ref|XP_009108988.1| PREDICTED: uncharacterized protein LOC103834665 isoform X2 [Brassica 
rapa]
Length=773

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 93/146 (64%), Gaps = 11/146 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS  +   VF+ASQY FFG+++ E    G  +DE +         
Sbjct  1    MERSDSRDLYNFARASSDQNS-SVFDASQYDFFGKNLDEMSLGGLDDDEVI---------  50

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                    G D   EYHLF+K E  G GSLSD+DDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  51   -APVLGHPGADADDEYHLFDKAEAGGFGSLSDMDDLATTFAKLNRVVTGPKHPGVIGDRG  109

Query  577  sgsfsresssTADWAKDADLPDWLDQ  654
            SGSFSRESSS  DW  DA+L  WLD+
Sbjct  110  SGSFSRESSSATDWTHDAELTSWLDE  135



>ref|XP_006297023.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 ref|XP_006297024.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29921.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
 gb|EOA29922.1| hypothetical protein CARUB_v10013016mg [Capsella rubella]
Length=784

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 76/147 (52%), Positives = 91/147 (62%), Gaps = 12/147 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ E             E       
Sbjct  1    MERSDSRDLYNFVRASSLDKNSTLFDASQYEFFGQNLDEM------------EIGGGLDD  48

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                    G     EYHLF+K EG+GLGSLSD+DDLATTF K+NRVV GP+HPGVIGDRG
Sbjct  49   DGVIAPVLGLTDDDEYHLFDKGEGAGLGSLSDMDDLATTFAKINRVVPGPKHPGVIGDRG  108

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  +W  DA+L  WLD  
Sbjct  109  SGSFSRESSSATEWTHDAELTSWLDDQ  135



>ref|XP_010488248.1| PREDICTED: uncharacterized protein LOC104766124 [Camelina sativa]
Length=784

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 75/147 (51%), Positives = 94/147 (64%), Gaps = 13/147 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS   +S +F+ASQY FFG+++ E    G  +D  +      +  
Sbjct  1    MERSDSRDLFNFVRASSLDKNSTLFDASQYEFFGQNLDEMEIGGLDDDGVIAPVLGHTDD  60

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG GLGSLS++DDLATTF K+NR V GP+HPGVIGDRG
Sbjct  61   D-------------EYHLFDKGEGGGLGSLSEIDDLATTFAKINRNVTGPKHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTQDAELTSWLDEQ  134



>ref|XP_010466506.1| PREDICTED: uncharacterized protein LOC104746679 [Camelina sativa]
Length=782

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 74/147 (50%), Positives = 93/147 (63%), Gaps = 13/147 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS   ++ +F+ASQY FFG+++ E    G  +D  +      +  
Sbjct  1    MERSDSRDLYNFVRASSLDKNTTLFDASQYEFFGQNLDEMEIGGLDDDGMIAPVLGHTDD  60

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG GLGSLS++DDLATTF K+NR V GP+HPGVIGDRG
Sbjct  61   D-------------EYHLFDKGEGGGLGSLSEIDDLATTFAKINRNVTGPKHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW  DA+L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTHDAELTSWLDEQ  134



>ref|XP_007049005.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
 gb|EOX93162.1| Topoisomerase II-associated protein PAT1, putative isoform 1 
[Theobroma cacao]
Length=798

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 82/152 (54%), Positives = 102/152 (67%), Gaps = 16/152 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            M+RS G+   +F+ +SS      +F+ASQY FFG++  EE+ELGGL+D E      +S  
Sbjct  1    MDRSDGKLPNNFSQTSSGN---ALFDASQYEFFGQNAMEEVELGGLDDGEQDAPVFASAE  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF++ E  GLGSLSD+DDLA+TF KLNRVV GPR+PGVIGD  
Sbjct  58   DD------------EYHLFDRGEVVGLGSLSDMDDLASTFAKLNRVVTGPRNPGVIGD-R  104

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSSTADWA+D +  +WLDQH  D E
Sbjct  105  SGSFSRESSSTADWAQDGEYVNWLDQHMFDAE  136



>ref|XP_002868239.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44498.1| hypothetical protein ARALYDRAFT_915331 [Arabidopsis lyrata subsp. 
lyrata]
Length=788

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 91/147 (62%), Gaps = 17/147 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RDF  F  +SS  +   +F+ASQY FFG+ + E    G  +D  VR        
Sbjct  1    MERSDSRDFYTFARTSSDKNS-ALFDASQYEFFGQSLEEVELGGLDDDVTVRGHV-----  54

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLS++DDLATTF KLNR V GP+H GVIGDRG
Sbjct  55   -----------DDEEYHLFDKREGAGLGSLSEMDDLATTFAKLNRNVTGPKHLGVIGDRG  103

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESS+  DW +D +   WLDQ+
Sbjct  104  SGSFSRESSTATDWTQDNEFTSWLDQN  130



>gb|KJB42926.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=776

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            M+RS G+   +F+  SSS +   +F+ASQY FFG++  EE+ELGG     + +D   +  
Sbjct  1    MDRSDGKLHNNFSSLSSSDN--ALFDASQYEFFGQNAMEEVELGG-----LEDDEQDAPV  53

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
              +           EYHLF+K E  GLGSLSD+DDLATTF KLNRVV GPR+PGVIGD  
Sbjct  54   FASPEDD-------EYHLFDKGEVVGLGSLSDVDDLATTFAKLNRVVTGPRNPGVIGD-R  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  106  SGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  137



>ref|XP_006283147.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16045.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=792

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 91/147 (62%), Gaps = 17/147 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  +DF +F  +SS   +  +F+ASQY FFG+ + E    G  +D  VR        
Sbjct  1    MERSDSKDFYNFARTSSDNKN-ALFDASQYEFFGQSLEEVELGGLDDDASVRGHVDD---  56

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                           YHLF+K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  57   -------------EAYHLFDKREGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  103

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESS+  DW +D +   WLDQH
Sbjct  104  SGSFSRESSTATDWTQDNEFTSWLDQH  130



>gb|KJB42927.1| hypothetical protein B456_007G174200 [Gossypium raimondii]
Length=797

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 15/152 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            M+RS G+   +F+  SSS +   +F+ASQY FFG++  EE+ELGG     + +D   +  
Sbjct  1    MDRSDGKLHNNFSSLSSSDN--ALFDASQYEFFGQNAMEEVELGG-----LEDDEQDAPV  53

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
              +           EYHLF+K E  GLGSLSD+DDLATTF KLNRVV GPR+PGVIGD  
Sbjct  54   FASPEDD-------EYHLFDKGEVVGLGSLSDVDDLATTFAKLNRVVTGPRNPGVIGD-R  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  106  SGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  137



>gb|KJB08598.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=810

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+    F+ +SS      +F+ASQY FFG++   E+            D      
Sbjct  1    MERSDGKLPSSFSQASSDN---ALFDASQYEFFGQNAVAEV------------DLGGLED  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF++ E  GLGSLSD+DDLA+TF KLNRVV GPR+PGVIGD  
Sbjct  46   GEEDSPVFASTEDDEYHLFDRGELVGLGSLSDMDDLASTFAKLNRVVTGPRNPGVIGD-R  104

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS ADW++D D  +W+DQH  D E
Sbjct  105  SGSFSRESSSAADWSQDGDYLNWMDQHMFDVE  136



>gb|KJB08599.1| hypothetical protein B456_001G092700 [Gossypium raimondii]
Length=792

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 90/152 (59%), Gaps = 16/152 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+    F+ +SS      +F+ASQY FFG++   E+            D      
Sbjct  1    MERSDGKLPSSFSQASSDN---ALFDASQYEFFGQNAVAEV------------DLGGLED  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF++ E  GLGSLSD+DDLA+TF KLNRVV GPR+PGVIGD  
Sbjct  46   GEEDSPVFASTEDDEYHLFDRGELVGLGSLSDMDDLASTFAKLNRVVTGPRNPGVIGD-R  104

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            SGSFSRESSS ADW++D D  +W+DQH  D E
Sbjct  105  SGSFSRESSSAADWSQDGDYLNWMDQHMFDVE  136



>ref|XP_010511200.1| PREDICTED: uncharacterized protein LOC104787331 [Camelina sativa]
Length=782

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 74/147 (50%), Positives = 91/147 (62%), Gaps = 13/147 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS    S +F+ASQY FFG+++ E    G  +D  +      +  
Sbjct  1    MERSDSRDLYNFVRASSLDKSSTLFDASQYEFFGQNLDEMEIGGLDDDGVIAPVLGHTDD  60

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG GLGSLS++DDLATTF K+NR V GP+HPGVIGDRG
Sbjct  61   D-------------EYHLFDKGEGGGLGSLSEIDDLATTFAKINRNVTGPKHPGVIGDRG  107

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW  D +L  WLD+ 
Sbjct  108  SGSFSRESSSATDWTHDVELTSWLDEQ  134



>gb|EPS66560.1| hypothetical protein M569_08215, partial [Genlisea aurea]
Length=772

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = +1

Query  436  HEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTAD  615
            ++Y LF+++EG G+ S SD+DDLATTF K+NR V+GPRHPGVIGDR SGSFSRESSS  D
Sbjct  48   NDYRLFQRDEGLGMDSSSDIDDLATTFAKINRDVSGPRHPGVIGDRASGSFSRESSSATD  107

Query  616  WAKDADLPDWLDQHFSDTECY  678
            WA++AD PDWLD    D + Y
Sbjct  108  WAREADYPDWLDHQLPDFDIY  128



>ref|XP_006414611.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 ref|XP_006414612.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56064.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
 gb|ESQ56065.1| hypothetical protein EUTSA_v10024461mg [Eutrema salsugineum]
Length=784

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 73/153 (48%), Positives = 91/153 (59%), Gaps = 17/153 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsG-VFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            MERS  RD      +SS   ++  +F+ASQY FFG+ + E    G  +D  +        
Sbjct  1    MERSDSRDLYSLARASSDNINNSTLFDASQYEFFGQSLEEVELGGLDDDAALLGHADD--  58

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                           EYHLF+K EG+ LGSLSD+DDLATTF KLNRVV GP+HPGVIG R
Sbjct  59   --------------EEYHLFDKREGAALGSLSDMDDLATTFAKLNRVVTGPKHPGVIGVR  104

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            GSGSFSRESS+  DW +D +   WLDQH  + +
Sbjct  105  GSGSFSRESSTATDWTQDNEFTSWLDQHMLEEQ  137



>gb|KFK39518.1| hypothetical protein AALP_AA3G254500 [Arabis alpina]
Length=781

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 74/150 (49%), Positives = 94/150 (63%), Gaps = 14/150 (9%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS  +   +F+ASQY FFG+++ E    G  +DE +      +  
Sbjct  1    MERSDSRDLFNFVRASSDTTSK-LFDASQYEFFGQNLDEVSLGGFDDDEVIAPVLGHADD  59

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG GLGSL+++DDLATTF K+NRVV GP+HPGVIGDRG
Sbjct  60   D-------------EYHLFDKGEGGGLGSLAEMDDLATTFAKINRVVTGPKHPGVIGDRG  106

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSD  666
            SGSFSRESSS  DW  DA+   W+D+   D
Sbjct  107  SGSFSRESSSATDWTHDAEATSWMDEQDQD  136



>ref|XP_008353622.1| PREDICTED: uncharacterized protein LOC103417209 [Malus domestica]
Length=114

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 71/118 (60%), Gaps = 15/118 (13%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS+G DF+D    SSS +   +F+ASQY FFG+++             V E       
Sbjct  1    MERSNGTDFRDLLXRSSSENK--LFDASQYEFFGQNL-------------VDEVELGGLD  45

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
                         +EYHLFEKEEG GLGSLSD+DDLA+TF KLN+VV GPRHPGVIGD
Sbjct  46   DEEDRKPLFGPVDNEYHLFEKEEGLGLGSLSDIDDLASTFAKLNKVVTGPRHPGVIGD  103



>gb|KHG26425.1| Protein PAT1 [Gossypium arboreum]
Length=795

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 75/152 (49%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+   +F  +SS  +    F+ASQY FFG++  EE+ELGGLED EV     +S  
Sbjct  1    MERSDGKLPINFFQTSSDNAH---FDASQYEFFGQNAMEEVELGGLEDGEVEGPVFASIE  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF++ +   LGSLSD+DDLA+TF KLNRVV GPRHPGVIGDR 
Sbjct  58   DD------------EYHLFDRGDVGSLGSLSDMDDLASTFAKLNRVVTGPRHPGVIGDRS  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
                   SS+T DWA D +  +W+DQH  +TE
Sbjct  106  CSFSRESSSAT-DWAVDGEHLNWMDQHMFETE  136



>ref|XP_006406189.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
 gb|ESQ47642.1| hypothetical protein EUTSA_v10020108mg [Eutrema salsugineum]
Length=784

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 71/148 (48%), Positives = 88/148 (59%), Gaps = 15/148 (10%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  +SS  +   +F+ASQY FFG+++ E    G  +DE +      +  
Sbjct  1    MERSDSRDLYNFVRASSDQNS-SLFDASQYEFFGQNLDEMSLGGIDDDEMIAPVLGHADD  59

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF+K EG+GLGSLSDLDDLATTF KLNRVV GP+HPGVIGDRG
Sbjct  60   D-------------EYHLFDKGEGAGLGSLSDLDDLATTFAKLNRVVTGPKHPGVIGDRG  106

Query  577  sgsfsresssTA-DWAKDADLPDWLDQH  657
                    SS+A DW  D +L  WLD+ 
Sbjct  107  GSGSFSRESSSATDWTHDTELTSWLDEQ  134



>gb|EYU43157.1| hypothetical protein MIMGU_mgv1a016393mg [Erythranthe guttata]
Length=123

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 87/120 (73%), Gaps = 9/120 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFT--dssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSS  390
            ME S G+DF DFT   +S+S S SG+F+ASQYAFFG++I +E EL          +   +
Sbjct  1    MESSDGKDFNDFTDPSTSTSVSGSGMFDASQYAFFGKEITDEEEL-------GGLEDEEA  53

Query  391  gapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
            G     G  GGD+ ++EYHLF+K+EGSGLGSLSD+DDL TTF KLN++V+GPRHPGVIGD
Sbjct  54   GLSAFTGTFGGDEELNEYHLFDKDEGSGLGSLSDIDDLTTTFAKLNKIVSGPRHPGVIGD  113



>gb|KJB10632.1| hypothetical protein B456_001G212600 [Gossypium raimondii]
Length=796

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 74/152 (49%), Positives = 94/152 (62%), Gaps = 16/152 (11%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+   +F  +SS  +    F+AS+Y FFG++  EE+ELGGLED EV     +S  
Sbjct  1    MERSDGKLPINFFQTSSDNAH---FDASRYEFFGQNAMEEVELGGLEDGEVEAPVFASIE  57

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF++ +   LGSLSD+DDLA+TF KLNRVV GPRHPGVIGDR 
Sbjct  58   DD------------EYHLFDRGDVGSLGSLSDMDDLASTFAKLNRVVTGPRHPGVIGDRS  105

Query  577  sgsfsresssTADWAKDADLPDWLDQHFSDTE  672
                   SS+T DWA D +  +W+DQH  +TE
Sbjct  106  GSFSRESSSAT-DWAVDGEHLNWMDQHMFETE  136



>emb|CDY54867.1| BnaC01g22630D [Brassica napus]
Length=764

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 78/149 (52%), Positives = 97/149 (65%), Gaps = 15/149 (10%)
 Frame = +1

Query  217  MERSSGRD--FKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSS  390
            MERS  RD  +     SSSS ++  +F+ASQY FFG+ + E    G      + +D ++S
Sbjct  1    MERSDSRDLYYNLARASSSSNNNITLFDASQYEFFGQSLEEVELGG------LDDDDAAS  54

Query  391  gapvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
                A    G       YHLF+K EG+GLGSLS++DDLATTF KLNRVV+GP+HPGVIGD
Sbjct  55   VLGHADDGDG-------YHLFDKREGAGLGSLSEMDDLATTFAKLNRVVSGPKHPGVIGD  107

Query  571  rgsgsfsresssTADWAKDADLPDWLDQH  657
            RGSGSFSRESSS  DW +D +   WLDQ 
Sbjct  108  RGSGSFSRESSSATDWTQDNEFTSWLDQQ  136



>emb|CDY37402.1| BnaC05g30280D [Brassica napus]
Length=785

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 77/147 (52%), Positives = 93/147 (63%), Gaps = 12/147 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  SSS ++   +F+ASQY FFG+++ E    G  +DE V      +  
Sbjct  1    MERSDSRDLYNFVRSSSDSNSK-LFDASQYEFFGQNLDEMSLGGIDDDEVVAPVLGHTSP  59

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrg  576
                          EYHLF K EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRG
Sbjct  60   DDD-----------EYHLFNKGEGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRG  108

Query  577  sgsfsresssTADWAKDADLPDWLDQH  657
            SGSFSRESSS  DW  D +L +WLD+ 
Sbjct  109  SGSFSRESSSATDWTHDTELTNWLDEQ  135



>emb|CDY50269.1| BnaAnng10330D [Brassica napus]
Length=768

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%), Gaps = 0/72 (0%)
 Frame = +1

Query  442  YHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWA  621
            YHLF+K EG+GLGSLS++DDLATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW 
Sbjct  64   YHLFDKREGAGLGSLSEMDDLATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWT  123

Query  622  KDADLPDWLDQH  657
            +D +   WLDQ 
Sbjct  124  QDNEFTSWLDQQ  135



>ref|XP_004165263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228647, 
partial [Cucumis sativus]
Length=742

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTEC  675
            A+TF KLN+VV GPRHPGVIGDRGSGSFSRESSS  DWA+D D  +WL+QH  D EC
Sbjct  14   ASTFAKLNKVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDGDFCNWLEQHVFDPEC  70



>ref|XP_009147964.1| PREDICTED: protein PAT1 homolog 1 [Brassica rapa]
Length=768

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 66/124 (53%), Positives = 78/124 (63%), Gaps = 14/124 (11%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            +F+ASQY FFG+               + E         A    G  D    YHLF+K E
Sbjct  26   LFDASQYEFFGQS--------------LEEVELGGLYDDADSVLGHADDGDGYHLFDKRE  71

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G+GLGSLS++DDLATTF KLNRVV+GP+HPGVIGDRGSGSFSRESSS  DW +D +   W
Sbjct  72   GAGLGSLSEMDDLATTFAKLNRVVSGPKHPGVIGDRGSGSFSRESSSATDWTQDNEFTSW  131

Query  646  LDQH  657
            LDQ 
Sbjct  132  LDQQ  135



>gb|KDO64332.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
 gb|KDO64333.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
 gb|KDO64334.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
Length=112

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 83/118 (70%), Gaps = 14/118 (12%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G+DF +FT +SS ++   +F+ASQY FFG+++ EE+ELGGL      ED   + A
Sbjct  1    MERSRGKDFLNFTRTSSGSA---MFDASQYEFFGQNVGEEVELGGL------EDEGDNNA  51

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
            PV G          EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGD
Sbjct  52   PVFGSVTD-----DEYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGD  104



>gb|KFK23118.1| hypothetical protein AALP_AAs49591U000400 [Arabis alpina]
Length=788

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 75/155 (48%), Positives = 94/155 (61%), Gaps = 17/155 (11%)
 Frame = +1

Query  217  MERSSGR-DFKDFTdssssasdsG-VFNASQYAFFGRdiaeeielggledeeVREDTSSS  390
            MERS  R  + +F  +SSS ++   +F+ASQY FFG+               + E     
Sbjct  1    MERSDSRVSYNNFARTSSSENNKSTLFDASQYEFFGQS--------------LEEVELGG  46

Query  391  gapvaggfgggddgvHEYHLFE-KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIG  567
                A    GG     EYHLF+ K EG+GLGS+S++DDLATTF KLNRVV GP+H GVIG
Sbjct  47   LDDDAATVLGGHVDDEEYHLFDNKREGAGLGSVSEMDDLATTFAKLNRVVTGPKHLGVIG  106

Query  568  DrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            DRGSGSFSRESSS  DW +D +   WLDQH  + +
Sbjct  107  DRGSGSFSRESSSATDWTQDNEFTSWLDQHMIEEQ  141



>ref|XP_006283146.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
 gb|EOA16044.1| hypothetical protein CARUB_v10004170mg [Capsella rubella]
Length=781

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 78/125 (62%), Gaps = 16/125 (13%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             +F+ASQY FFG+ + E    G  +D  VR                       YHLF+K 
Sbjct  11   ALFDASQYEFFGQSLEEVELGGLDDDASVRGHVDD----------------EAYHLFDKR  54

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG+GLGSLSD+DDLATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   
Sbjct  55   EGAGLGSLSDMDDLATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTS  114

Query  643  WLDQH  657
            WLDQH
Sbjct  115  WLDQH  119



>ref|XP_002520595.1| hypothetical protein RCOM_0673440 [Ricinus communis]
 gb|EEF41828.1| hypothetical protein RCOM_0673440 [Ricinus communis]
Length=739

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 43/56 (77%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            ATTF KLNRVV GPRHPGVIGDRGSGSFSRESSS  DWA+D +L  WLDQ   D E
Sbjct  17   ATTFAKLNRVVTGPRHPGVIGDRGSGSFSRESSSATDWAQDEELASWLDQQMFDIE  72



>emb|CAN68728.1| hypothetical protein VITISV_033604 [Vitis vinifera]
Length=867

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 66/118 (56%), Gaps = 16/118 (14%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS G DFKD  ++SSS     +F+ASQY FFG+                 E+    G 
Sbjct  1    MERSQGLDFKDLPEASSSDG--ALFDASQYEFFGQHAV--------------EEVELGGL  44

Query  397  pvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
                          EY LFE+EE  GL SLSD+DDLA+TF KLNRVV GPR+PGVIGD
Sbjct  45   ENENNIPVFGSVDDEYQLFEREESVGLSSLSDIDDLASTFSKLNRVVTGPRNPGVIGD  102



>ref|XP_006597998.1| PREDICTED: uncharacterized protein LOC100779096 isoform X2 [Glycine 
max]
Length=878

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 65/130 (50%), Positives = 81/130 (62%), Gaps = 16/130 (12%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
            GVF+ASQYAFFG+D+AEE+EL GLED    ED   +                E  L  KE
Sbjct  24   GVFDASQYAFFGKDVAEEVELRGLED----EDDYKAMPAAEFK--------EEDFLLNKE  71

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            E   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      SRE+SS ++W++  D+P 
Sbjct  72   EAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE----RGSRENSSASEWSQRDDIPY  127

Query  643  WLDQHFSDTE  672
            W DQH  D E
Sbjct  128  WFDQHAYDPE  137



>ref|XP_007133386.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
 gb|ESW05380.1| hypothetical protein PHAVU_011G174900g [Phaseolus vulgaris]
Length=882

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 55/130 (42%), Positives = 71/130 (55%), Gaps = 18/130 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLF-EKE  462
            VF+ASQYAFFG+++               E                    +E  LF  KE
Sbjct  26   VFDASQYAFFGKNV-------------AEEVELGGLEDQDEYKAMLAVEFNEEDLFLNKE  72

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            E   + SLSD+DDL TTFLKLN+VV GPR PGVIG+      SRE+SS ++W++  D+P 
Sbjct  73   EAEDIRSLSDIDDLTTTFLKLNKVVTGPRSPGVIGE----RGSRENSSASEWSQRDDIPY  128

Query  643  WLDQHFSDTE  672
            W DQH  D+E
Sbjct  129  WFDQHSYDSE  138



>emb|CDY10630.1| BnaA05g17320D [Brassica napus]
Length=765

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 12/148 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  SSS ++   +F+ASQY FFG+++ E    G  +D+ V      S  
Sbjct  1    MERSDSRDLYNFVRSSSDSNSK-LFDASQYEFFGQNLDEMSLGGIDDDDVVAPVLGHSAT  59

Query  397  pvaggfgggddgvHEYHLFEKE-EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                          EYHLF K  EG+GLGSLSD+DDLATTF KLNR V GP+  GVIGDR
Sbjct  60   DDDD----------EYHLFNKGGEGAGLGSLSDMDDLATTFAKLNRNVTGPKPLGVIGDR  109

Query  574  gsgsfsresssTADWAKDADLPDWLDQH  657
            GSGSFSRESSS  DW  D +L +WLD+ 
Sbjct  110  GSGSFSRESSSATDWTHDTELTNWLDEQ  137



>ref|XP_009145394.1| PREDICTED: uncharacterized protein LOC103869095 [Brassica rapa]
Length=791

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 76/148 (51%), Positives = 92/148 (62%), Gaps = 12/148 (8%)
 Frame = +1

Query  217  MERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSga  396
            MERS  RD  +F  SSS ++   +F+ASQY FFG+++ E    G  +D+ V      S  
Sbjct  1    MERSDSRDLYNFVRSSSDSNSK-LFDASQYEFFGQNLDEMSLGGIDDDDVVAPVLGHSAT  59

Query  397  pvaggfgggddgvHEYHLFEKE-EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                          EYHLF K  EG+GLGSLSD+DDLATTF KLNR V GP+  GVIGDR
Sbjct  60   DDDD----------EYHLFNKGGEGAGLGSLSDMDDLATTFAKLNRNVTGPKPLGVIGDR  109

Query  574  gsgsfsresssTADWAKDADLPDWLDQH  657
            GSGSFSRESSS  DW  D +L +WLD+ 
Sbjct  110  GSGSFSRESSSATDWTHDTELTNWLDEQ  137



>dbj|BAB01945.1| unnamed protein product [Arabidopsis thaliana]
Length=703

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  657
            ATTF KLNRVV GP+HPGVIGDRGSGSFSRESSS  DW +DA+L  WLD+ 
Sbjct  5    ATTFAKLNRVVTGPKHPGVIGDRGSGSFSRESSSATDWTQDAELTSWLDEQ  55



>ref|XP_010684289.1| PREDICTED: uncharacterized protein LOC104898860 [Beta vulgaris 
subsp. vulgaris]
Length=844

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 81/130 (62%), Gaps = 19/130 (15%)
 Frame = +1

Query  289  FNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEEg  468
            F+ASQY FFGR++ EE+ELGGLED+  R+D S                  EYHLF K+EG
Sbjct  52   FDASQYEFFGRNVGEEVELGGLEDD--RDDIS-----------VVPLHTDEYHLFNKDEG  98

Query  469  sglgslsdldd--lATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
              +   S  +   L TT+LKLNR V GPR+PGVIGDRGSGS SRESSS ADW++D     
Sbjct  99   QDVSLASLSEADDLETTYLKLNRAVTGPRNPGVIGDRGSGSLSRESSSAADWSRDG----  154

Query  643  WLDQHFSDTE  672
            WLD    D +
Sbjct  155  WLDHGVGDVD  164



>ref|XP_006597997.1| PREDICTED: uncharacterized protein LOC100779096 isoform X1 [Glycine 
max]
Length=881

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 76/130 (58%), Gaps = 13/130 (10%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
            GVF+ASQYAFFG+D+AEE+EL GL      ED                +   E  L  KE
Sbjct  24   GVFDASQYAFFGKDVAEEVELRGL------EDEDD------YKAMPAAEFKEEDFLLNKE  71

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            E   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      +   SS ++W++  D+P 
Sbjct  72   EAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE-RGSRENFTDSSASEWSQRDDIPY  130

Query  643  WLDQHFSDTE  672
            W DQH  D E
Sbjct  131  WFDQHAYDPE  140



>gb|KDP44628.1| hypothetical protein JCGZ_22047 [Jatropha curcas]
Length=737

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 40/56 (71%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNRVV GPR+ GVIGDRGSGSFSRESSS  DWA+D D   WLDQ   D E
Sbjct  24   ASTFAKLNRVVTGPRNVGVIGDRGSGSFSRESSSATDWAQDEDFSSWLDQQMFDIE  79



>ref|XP_004514400.1| PREDICTED: uncharacterized protein LOC101512706 [Cicer arietinum]
Length=880

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 18/129 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D              V E+    G      +        E      EE
Sbjct  31   VFDASQYAFFGKD--------------VAEEVELGGLDDENDYIPSVAFNEEEFFLNGEE  76

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
               + SLSD+DDL TTFLKLN+VV+GPR  GVIGD      SRE+SS ++W++  ++P W
Sbjct  77   ADDVRSLSDIDDLTTTFLKLNKVVSGPRSAGVIGD----RVSRENSSASEWSQRDEIPYW  132

Query  646  LDQHFSDTE  672
            +D H  D+E
Sbjct  133  VDHHTYDSE  141



>gb|KDP25122.1| hypothetical protein JCGZ_22657 [Jatropha curcas]
Length=805

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 55/125 (44%), Positives = 70/125 (56%), Gaps = 18/125 (14%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG+D              + E+    G           +   E  LF ++
Sbjct  30   AVFDASQYAFFGKD--------------LVEEVELGGLDDEEEALPAAELDEEEFLFGRQ  75

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  + SLSD+DDLA+TF KLN+VV+GPR  GVIGD      SRESSS A+WA+  D P+
Sbjct  76   EGEIVRSLSDIDDLASTFSKLNKVVSGPRGAGVIGD----RGSRESSSAAEWAQGDDFPN  131

Query  643  WLDQH  657
            W DQ 
Sbjct  132  WFDQQ  136



>ref|XP_007049006.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
 gb|EOX93163.1| Topoisomerase II-associated protein PAT1, putative isoform 2 
[Theobroma cacao]
Length=724

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = +1

Query  520  KLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            KLNRVV GPR+PGVIGD  SGSFSRESSSTADWA+D +  +WLDQH  D E
Sbjct  13   KLNRVVTGPRNPGVIGD-RSGSFSRESSSTADWAQDGEYVNWLDQHMFDAE  62



>emb|CDP13609.1| unnamed protein product [Coffea canephora]
Length=817

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 78/153 (51%), Gaps = 21/153 (14%)
 Frame = +1

Query  214  IMERSSGRDFKDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSg  393
            I E S+ +D   F ++ +      VF+ASQYAFFG D              V E      
Sbjct  10   IKESSNSQDLGQFGENPTGD---AVFDASQYAFFGNDA-------------VEEVELGGL  53

Query  394  apvaggfgggddgvHEYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDr  573
                           EY L ++EEG  LGS +++DDLA TF KLN+VV+GPR  G IGD 
Sbjct  54   EDDEDEIPQVGLADEEYQL-DREEGEVLGSFTEIDDLARTFSKLNKVVSGPRDAGAIGD-  111

Query  574  gsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
                 SRESSS A+W ++ D P W DQ+  DTE
Sbjct  112  ---MGSRESSSAAEWVREEDFPSWADQNAFDTE  141



>gb|KHN16432.1| hypothetical protein glysoja_046875 [Glycine soja]
Length=823

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +1

Query  439  EYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADW  618
            E  L  KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      SRE+SS ++W
Sbjct  9    EDFLLNKEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE----RGSRENSSASEW  64

Query  619  AKDADLPDWLDQHFSDTE  672
            ++  D+P W DQH  D E
Sbjct  65   SQRDDIPYWFDQHAYDPE  82



>ref|XP_006597999.1| PREDICTED: uncharacterized protein LOC100779096 isoform X3 [Glycine 
max]
Length=826

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  439  EYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADW  618
            E  L  KEE   + SLSD+DDL TTFLKLN+ V+GPR PGVIG+      +   SS ++W
Sbjct  9    EDFLLNKEEAVDVRSLSDIDDLTTTFLKLNKAVSGPRSPGVIGE-RGSRENFTDSSASEW  67

Query  619  AKDADLPDWLDQHFSDTE  672
            ++  D+P W DQH  D E
Sbjct  68   SQRDDIPYWFDQHAYDPE  85



>ref|XP_009406732.1| PREDICTED: uncharacterized protein LOC103989576 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=811

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLNRVV+ PR  GVIGDRGS S    S  TADWA++AD P W+DQ   D E
Sbjct  93   STFRKLNRVVSEPRSVGVIGDRGSFSRESSS--TADWAQEADFPSWIDQEILDAE  145



>ref|XP_009406733.1| PREDICTED: uncharacterized protein LOC103989576 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=793

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLNRVV+ PR  GVIGDRGS S    S  TADWA++AD P W+DQ   D E
Sbjct  93   STFRKLNRVVSEPRSVGVIGDRGSFSRESSS--TADWAQEADFPSWIDQEILDAE  145



>ref|XP_010923783.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923784.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
 ref|XP_010923785.1| PREDICTED: uncharacterized protein LOC105046771 [Elaeis guineensis]
Length=814

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 57/133 (43%), Positives = 75/133 (56%), Gaps = 18/133 (14%)
 Frame = +1

Query  289  FNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYH---LFEK  459
            F+ASQYAFFG+++             + E          G  G       EYH   + ++
Sbjct  30   FDASQYAFFGKEV-------------MEEVELGGLEDDDGDAGFIGRDDEEYHFRSIGDR  76

Query  460  EEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLP  639
            EE  GLGSLSD+DDL +TF KLNR ++ PR+ GVIGDRGS S    S  TADW ++AD  
Sbjct  77   EEVEGLGSLSDIDDLTSTFEKLNRTISDPRNAGVIGDRGSFSRESSS--TADWTQEADSS  134

Query  640  DWLDQHFSDTECY  678
            +W+DQ+  D E Y
Sbjct  135  NWIDQNILDAENY  147



>emb|CAB10277.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78541.1| hypothetical protein [Arabidopsis thaliana]
Length=679

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQH  657
            ATTF KLNR V GP+H GVIGDRGSGSFSRESS+  DW +D +   WLDQH
Sbjct  5    ATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSTATDWTQDNEFTSWLDQH  55



>gb|KDO64335.1| hypothetical protein CISIN_1g0038251mg, partial [Citrus sinensis]
Length=100

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  439  EYHLFEKEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGD  570
            EYHLF+K EG GLGSLSD+DDL TTF KLNRVV GPR+PGVIGD
Sbjct  49   EYHLFDKGEGLGLGSLSDVDDLTTTFAKLNRVVTGPRNPGVIGD  92



>ref|NP_001044369.2| Os01g0769000 [Oryza sativa Japonica Group]
 dbj|BAD52714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD53338.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG94608.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06283.2| Os01g0769000 [Oryza sativa Japonica Group]
Length=809

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/56 (55%), Positives = 40/56 (71%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+DA+ P+W+DQ   + E
Sbjct  87   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWAEDAEFPNWVDQDILEGE  140



>ref|XP_010243929.1| PREDICTED: protein PAT1 homolog 1-like [Nelumbo nucifera]
Length=826

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 72/145 (50%), Gaps = 17/145 (12%)
 Frame = +1

Query  244  KDFTdssssasdsGVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfggg  423
            KDF   + S+S+   F+ASQYAFFG+D+             + E           G    
Sbjct  17   KDFKGLAESSSEDARFDASQYAFFGKDV-------------MEEVELGGLEDEDDGVPLI  63

Query  424  ddgvHEYHLFEKEEgsglgslsdldd--lATTFLKLNRVVAGPRHPGVIGDrgsgsfsre  597
                 EY L ++EE  G G  S  D   LA+TF KLN  V+ PR  GVIG+ GS S    
Sbjct  64   GFDGDEYALSDREELQGEGVGSLSDIDDLASTFSKLNSAVSKPRTAGVIGEMGSFSRESS  123

Query  598  sssTADWAKDADLPDWLDQHFSDTE  672
            S    DWA+D+D P+WLD H  +TE
Sbjct  124  S--ATDWAQDSDFPNWLDTHIFETE  146



>gb|KHG07822.1| Protein PAT1 [Gossypium arboreum]
Length=785

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 69/130 (53%), Gaps = 18/130 (14%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG D              V E+    G               E  LF++E
Sbjct  18   AVFDASQYAFFGND--------------VLEEVELGGLDGDDEDLPAAGLDEEEFLFDQE  63

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L +LSD+DDL +TF KLN  V+ PR  G+IGD      SRESSS A+WA+  + P 
Sbjct  64   EGGVLRALSDIDDLESTFSKLNTAVSRPRGSGIIGD----RGSRESSSVAEWAQGEEFPY  119

Query  643  WLDQHFSDTE  672
            WLDQH  +TE
Sbjct  120  WLDQHALETE  129



>gb|EAZ23222.1| hypothetical protein OsJ_06910 [Oryza sativa Japonica Group]
Length=825

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  103  ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  156



>gb|EAY86044.1| hypothetical protein OsI_07409 [Oryza sativa Indica Group]
Length=825

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  103  ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  156



>ref|NP_001046960.1| Os02g0517300 [Oryza sativa Japonica Group]
 dbj|BAD46717.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD46150.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08874.1| Os02g0517300 [Oryza sativa Japonica Group]
Length=815

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR ++G R+PGVIGD    S SR SS T DWA+D + P+W+DQ   + E
Sbjct  93   ASTFAKLNRTISGTRNPGVIGD--RRSISRGSSLTVDWAEDVEFPNWVDQDILEDE  146



>gb|KHG07107.1| Protein PAT1 [Gossypium arboreum]
Length=716

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = +1

Query  520  KLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            KLNRVV GPR+PGVIGD  SGSFSRESSS ADWA+D +  +W+DQH  D +
Sbjct  7    KLNRVVTGPRNPGVIGD-RSGSFSRESSSAADWAQDGEYVNWMDQHLFDAD  56



>ref|XP_011014091.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=796

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 70/130 (54%), Gaps = 19/130 (15%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG+D                E+    G          D    E+ LF+++
Sbjct  21   AVFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQ  65

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+
Sbjct  66   EGEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPN  121

Query  643  WLDQHFSDTE  672
            W DQ   D +
Sbjct  122  WSDQQLLDQD  131



>ref|XP_011014090.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=797

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 70/130 (54%), Gaps = 19/130 (15%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG+D                E+    G          D    E+ LF+++
Sbjct  22   AVFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQ  66

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+
Sbjct  67   EGEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPN  122

Query  643  WLDQHFSDTE  672
            W DQ   D +
Sbjct  123  WSDQQLLDQD  132



>ref|XP_011038110.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Populus euphratica]
Length=797

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 70/130 (54%), Gaps = 19/130 (15%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG+D                E+    G          D    E+ LF+++
Sbjct  21   AVFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQ  65

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+
Sbjct  66   EGEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPN  121

Query  643  WLDQHFSDTE  672
            W DQ   D +
Sbjct  122  WSDQQLLDQD  131



>ref|XP_011038109.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Populus euphratica]
Length=798

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 70/130 (54%), Gaps = 19/130 (15%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG+D                E+    G          D    E+ LF+++
Sbjct  22   AVFDASQYAFFGKDHV--------------EEVELGGLEDDEELPAADFEEEEF-LFDRQ  66

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L SLSD+DDLA TF KLN+ V GPR  G+IGD      SRESSS A+WA+  D P+
Sbjct  67   EGEVLRSLSDIDDLAITFSKLNKGVNGPRSTGIIGD----RGSRESSSAAEWAQGEDFPN  122

Query  643  WLDQHFSDTE  672
            W DQ   D +
Sbjct  123  WSDQQLLDQD  132



>emb|CBI21787.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 81/129 (63%), Gaps = 20/129 (16%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D+ EE+ELGGLEDE++                       E  L ++EE
Sbjct  16   VFDASQYAFFGKDVVEEVELGGLEDEDL----------------PVAGFDEEEFLLDREE  59

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G  L SLSD+DDLA+TF KL   V+GPR+ G+IGD      SRESSS A+WA++ DL  W
Sbjct  60   GEVLRSLSDIDDLASTFSKLETGVSGPRNAGIIGD----RGSRESSSAAEWAQEEDLHYW  115

Query  646  LDQHFSDTE  672
             DQH  +TE
Sbjct  116  FDQHMFETE  124



>ref|XP_002441360.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
 gb|EES19790.1| hypothetical protein SORBIDRAFT_09g025190 [Sorghum bicolor]
Length=802

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  666
            A+TF  LNR ++G R+PGVIGD    S SRESS TADWA+DAD  +W+DQ   D
Sbjct  92   ASTFAMLNRSISGTRNPGVIGD--RRSISRESSLTADWAQDADFSNWVDQDILD  143



>ref|XP_002300546.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
 gb|EEE85351.2| hypothetical protein POPTR_0001s46190g [Populus trichocarpa]
Length=801

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 54/130 (42%), Positives = 68/130 (52%), Gaps = 19/130 (15%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG+D                E+    G          D    E+ LF+++
Sbjct  22   AVFDASQYAFFGKDHV--------------EEVELGGLEDGEELPAADFEEEEF-LFDRQ  66

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L SLSD+D LA TF KLN+ V GPR  G+I D      SRESSS A+WA+  D P+
Sbjct  67   EGEVLRSLSDIDGLAITFSKLNKGVNGPRSTGIISD----RGSRESSSAAEWAQGEDFPN  122

Query  643  WLDQHFSDTE  672
            W DQ   D +
Sbjct  123  WFDQQLLDQD  132



>gb|KJB82133.1| hypothetical protein B456_013G178200 [Gossypium raimondii]
Length=785

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 55/130 (42%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFFG D              V E+    G               E  LF++E
Sbjct  18   AVFDASQYAFFGND--------------VLEEVELGGIDDEDEDLPAAGLDEEEFLFDQE  63

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            EG  L +LSD+DDL +TF KLN  V+ PR  G+IGD      SRESSS A+WA+  + P 
Sbjct  64   EGGVLRALSDIDDLESTFSKLNTAVSRPRGSGIIGD----RGSRESSSVAEWAQGEEFPY  119

Query  643  WLDQHFSDTE  672
            WLDQ   +TE
Sbjct  120  WLDQQALETE  129



>ref|XP_009399054.1| PREDICTED: protein PAT1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=822

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 71/132 (54%), Gaps = 18/132 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYH---LFE  456
            +F+ASQYAFFG+ +             + E          G   G      EYH   + +
Sbjct  34   LFDASQYAFFGKGV-------------MEEVELGCIEDNGGDNAGFIGIDDEYHFSTVGD  80

Query  457  KEEgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADL  636
            +EE   L SLSD DDLA+TF KLNRVV  PR  GVIGD   GS SRESSST DW ++ D 
Sbjct  81   REEAVVLDSLSDADDLASTFAKLNRVVNDPRTAGVIGD--RGSSSRESSSTVDWTQEGDY  138

Query  637  PDWLDQHFSDTE  672
             +W+DQ   D E
Sbjct  139  LNWIDQRILDAE  150



>ref|XP_004961543.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Setaria italica]
Length=813

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  666
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW +DAD   W+DQ   D
Sbjct  93   ASTFAKLNRSISGTRNPGVIGD--RRSISRESSLTTDWVQDADFHSWVDQGMLD  144



>ref|XP_006646364.1| PREDICTED: uncharacterized protein LOC102701783 [Oryza brachyantha]
Length=808

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 29/56 (52%), Positives = 38/56 (68%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR ++G R+PGVIGD    S SR SS T DW +D + P+W+DQ   + E
Sbjct  86   ASTFAKLNRSISGTRNPGVIGD--RRSISRGSSLTVDWPEDVEFPNWVDQDILEDE  139



>ref|XP_008649853.1| PREDICTED: uncharacterized protein LOC103630586 [Zea mays]
 gb|AFW78649.1| hypothetical protein ZEAMMB73_732523 [Zea mays]
Length=797

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  666
            A+TF  LNR ++G R+PG+IGD    S SRESS TADW +DAD  +W+DQ   D
Sbjct  86   ASTFAMLNRNISGTRNPGIIGD--RRSISRESSLTADWVQDADFSNWVDQDILD  137



>ref|XP_004961544.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Setaria italica]
Length=731

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSD  666
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW +DAD   W+DQ   D
Sbjct  11   ASTFAKLNRSISGTRNPGVIGD--RRSISRESSLTTDWVQDADFHSWVDQGMLD  62



>ref|XP_003569904.1| PREDICTED: uncharacterized protein LOC100838182 [Brachypodium 
distachyon]
Length=805

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR V+G R+PGVIGD    S SR SS T DW +D + P+W DQ   + E
Sbjct  84   ASTFAKLNRTVSGTRNPGVIGD--RRSISRGSSFTVDWDEDVEFPNWQDQDILENE  137



>ref|XP_010243919.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Nelumbo nucifera]
Length=824

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLN+ V+ PR  GVIGDRGS S    S  T +WA+++D P+WLD H  D+E
Sbjct  93   STFSKLNKAVSEPRTAGVIGDRGSFSRESSS--TTEWAQESDFPNWLDPHIFDSE  145



>ref|XP_010243918.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Nelumbo nucifera]
Length=825

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLN+ V+ PR  GVIGDRGS S    S  T +WA+++D P+WLD H  D+E
Sbjct  94   STFSKLNKAVSEPRTAGVIGDRGSFSRESSS--TTEWAQESDFPNWLDPHIFDSE  146



>ref|XP_006478034.1| PREDICTED: uncharacterized protein LOC102611484 isoform X2 [Citrus 
sinensis]
Length=791

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  24   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  69

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  70   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  125

Query  646  LDQHFSDTE  672
            L+Q   DTE
Sbjct  126  LEQQMLDTE  134



>ref|XP_010645006.1| PREDICTED: uncharacterized protein LOC100267869 isoform X1 [Vitis 
vinifera]
Length=828

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 20/130 (15%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D              V E+       +            E  L ++EE
Sbjct  31   VFDASQYAFFGKD--------------VVEEVE--LGGLEDEDLPVAGFDEEEFLLDREE  74

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G  L SLSD+DDLA+TF KL   V+GPR+ G+IGD      SRESSS A+WA++ DL  W
Sbjct  75   GEVLRSLSDIDDLASTFSKLETGVSGPRNAGIIGD----RGSRESSSAAEWAQEEDLHYW  130

Query  646  LDQHFSDTEC  675
             DQH  +TE 
Sbjct  131  FDQHMFETES  140



>ref|XP_006478033.1| PREDICTED: uncharacterized protein LOC102611484 isoform X1 [Citrus 
sinensis]
Length=792

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  25   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  70

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  71   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  126

Query  646  LDQHFSDTE  672
            L+Q   DTE
Sbjct  127  LEQQMLDTE  135



>ref|XP_006441043.1| hypothetical protein CICLE_v10018922mg [Citrus clementina]
 gb|ESR54283.1| hypothetical protein CICLE_v10018922mg [Citrus clementina]
 gb|KDO40139.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=792

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  25   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  70

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  71   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  126

Query  646  LDQHFSDTE  672
            L+Q   DTE
Sbjct  127  LEQQMLDTE  135



>gb|KDO40140.1| hypothetical protein CISIN_1g003844mg [Citrus sinensis]
Length=791

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 69/129 (53%), Gaps = 18/129 (14%)
 Frame = +1

Query  286  VFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKEE  465
            VF+ASQYAFFG+D              V E+    G               E  LF+KEE
Sbjct  24   VFDASQYAFFGKD--------------VVEEVELGGLEDEEDNLPAPAYDEEEFLFDKEE  69

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
            G  L SLSD+DDLA+TF KLN  V+GPR  G+IGD      SRESSS A+W +  D  + 
Sbjct  70   GEVLRSLSDIDDLASTFSKLNTDVSGPRGAGIIGD----WGSRESSSAAEWVQGDDYRNL  125

Query  646  LDQHFSDTE  672
            L+Q   DTE
Sbjct  126  LEQQMLDTE  134



>ref|XP_009416762.1| PREDICTED: protein PAT1 homolog 1-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=742

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  26   STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  78



>ref|XP_009416760.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=836

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  120  STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  172



>ref|XP_009416761.1| PREDICTED: protein PAT1 homolog 1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=808

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = +1

Query  508  TTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            +TF KLNRVV+ PR  G+IGD   GSFSRESSS A+W ++AD P W+DQ   D E
Sbjct  92   STFRKLNRVVSEPRSVGIIGD--RGSFSRESSSAAEWTQEADFPSWIDQEIFDAE  144



>ref|XP_003568135.1| PREDICTED: protein PAT1 homolog 1-like [Brachypodium distachyon]
Length=806

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLD  651
            A+TF KLNR ++G R+PGVIGD    S SRESS T DW  +AD P+W+D
Sbjct  90   ASTFAKLNRTISGTRNPGVIGD--RRSISRESSLTNDWVPEADFPNWVD  136



>ref|XP_008793552.1| PREDICTED: protein PAT1 homolog 1-like isoform X1 [Phoenix dactylifera]
Length=815

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 17/131 (13%)
 Frame = +1

Query  289  FNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYH-LFEKEE  465
            F+ASQYAFFG++              V E+    G     GF G  D  + +  + ++EE
Sbjct  33   FDASQYAFFGKE--------------VMEEVELGGLEDDAGFIGLHDEEYRFSSIGDREE  78

Query  466  gsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDW  645
              GLGSLSD+DDL +TF KLNR ++ PR  GVIGD    SFSRESSSTADW ++AD  +W
Sbjct  79   VEGLGSLSDIDDLTSTFAKLNRTISDPRSAGVIGD--RRSFSRESSSTADWMQEADCSNW  136

Query  646  LDQHFSDTECY  678
            +D++  D E +
Sbjct  137  IDENIIDAENF  147



>gb|EMT17005.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=1181

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 39/56 (70%), Gaps = 2/56 (4%)
 Frame = +1

Query  505  ATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPDWLDQHFSDTE  672
            A+TF KLNR + G R+PGVIGD    S SRESS T DWA++A+  +W+D    D++
Sbjct  93   ASTFAKLNRSIGGTRNPGVIGD--RRSISRESSLTTDWAQEAEFSNWVDHDILDSD  146



>ref|XP_003545913.2| PREDICTED: uncharacterized protein LOC100787648 [Glycine max]
 gb|KHN27738.1| Protein PAT1 like 1 [Glycine soja]
Length=886

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 74/130 (57%), Gaps = 21/130 (16%)
 Frame = +1

Query  283  GVFNASQYAFFGRdiaeeielggledeeVREDTSSSgapvaggfgggddgvHEYHLFEKE  462
             VF+ASQYAFF ++  +E+ELGGLED+       S                +E   F +E
Sbjct  33   AVFDASQYAFFSKEAVQEVELGGLEDDGCLPTVES----------------NEEFFFNRE  76

Query  463  EgsglgslsdlddlATTFLKLNRVVAGPRHPGVIGDrgsgsfsresssTADWAKDADLPD  642
            E   + SLSD+DDL TTF KLN+VV+GPR  GVIG+          +ST++W++  D  +
Sbjct  77   EAEDVKSLSDIDDLTTTFWKLNKVVSGPRSAGVIGE-----RGSRENSTSEWSQREDSFN  131

Query  643  WLDQHFSDTE  672
            W DQ+  D+E
Sbjct  132  WYDQNAYDSE  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240