BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034G15

Length=673
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    372   1e-124   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   1e-122   Nicotiana tomentosiformis
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   2e-122   Nicotiana tomentosiformis
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    367   2e-122   
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    366   4e-122   Fragaria vesca subsp. vesca
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    366   4e-122   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              366   6e-122   Scoparia dulcis [escobilla]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   1e-121   Nicotiana sylvestris
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               365   1e-121   Solanum tuberosum [potatoes]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   1e-121   Sesamum indicum [beniseed]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    365   1e-121   Solanum lycopersicum
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    364   2e-121   Solanum tuberosum [potatoes]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    361   4e-120   Prunus mume [ume]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    359   2e-119   Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    359   2e-119   Pyrus x bretschneideri [bai li]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             359   3e-119   Prunus persica
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              357   1e-118   Pyrus x bretschneideri [bai li]
gb|KJB14201.1|  hypothetical protein B456_002G114000                    357   1e-118   Gossypium raimondii
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    357   3e-118   Gossypium arboreum [tree cotton]
gb|KJB57937.1|  hypothetical protein B456_009G186400                    349   6e-118   Gossypium raimondii
ref|XP_003603852.1|  Glyceraldehyde-3-phosphate dehydrogenase           348   1e-117   
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    353   1e-117   
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    355   2e-117   Nelumbo nucifera [Indian lotus]
gb|KJB57939.1|  hypothetical protein B456_009G186400                    350   2e-117   Gossypium raimondii
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    354   3e-117   Glycine soja [wild soybean]
emb|CAN69459.1|  hypothetical protein VITISV_021576                     353   6e-117   Vitis vinifera
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    353   8e-117   Pyrus x bretschneideri [bai li]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    353   9e-117   
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    352   1e-116   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    352   2e-116   Gossypium arboreum [tree cotton]
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    352   2e-116   
gb|ACU20783.1|  unknown                                                 350   5e-116   Glycine max [soybeans]
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    350   6e-116   Vitis vinifera
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    349   2e-115   Pisum sativum [garden pea]
emb|CAA33262.1|  unnamed protein product                                348   3e-115   Pisum sativum [garden pea]
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    349   3e-115   Ricinus communis
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              347   3e-115   Medicago truncatula
ref|NP_001240080.1|  uncharacterized protein LOC100806482               348   3e-115   Glycine max [soybeans]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    348   4e-115   Gossypium raimondii
emb|CDP07271.1|  unnamed protein product                                348   4e-115   Coffea canephora [robusta coffee]
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    348   7e-115   Populus euphratica
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    347   8e-115   Populus euphratica
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    347   1e-114   Glycine max [soybeans]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    347   2e-114   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ84309.1|  unknown                                                 347   2e-114   Medicago truncatula
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           347   2e-114   Medicago truncatula
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             347   2e-114   Phaseolus vulgaris [French bean]
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    349   2e-114   Cicer arietinum [garbanzo]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    346   3e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006383782.1|  hypothetical protein POPTR_0005s27550g             341   3e-114   
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    345   4e-114   Nicotiana tabacum [American tobacco]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    345   5e-114   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           347   6e-114   
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   7e-114   Populus euphratica
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    345   8e-114   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         344   1e-113   Jatropha curcas
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    343   5e-113   Cucumis sativus [cucumbers]
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             343   7e-113   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    342   9e-113   Musa acuminata subsp. malaccensis [pisang utan]
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    342   2e-112   Spinacia oleracea
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    342   2e-112   Cucumis melo [Oriental melon]
gb|KDO85183.1|  hypothetical protein CISIN_1g012940mg                   334   4e-112   Citrus sinensis [apfelsine]
gb|KDO85177.1|  hypothetical protein CISIN_1g012940mg                   335   8e-112   Citrus sinensis [apfelsine]
gb|KDO85181.1|  hypothetical protein CISIN_1g012940mg                   333   8e-112   Citrus sinensis [apfelsine]
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    340   1e-111   Elaeis guineensis
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    340   1e-111   Phoenix dactylifera
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    339   1e-111   Populus trichocarpa [western balsam poplar]
gb|KDO85179.1|  hypothetical protein CISIN_1g012940mg                   332   1e-111   Citrus sinensis [apfelsine]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    338   3e-111   
ref|XP_006435407.1|  hypothetical protein CICLE_v10001114mg             334   4e-111   
gb|KDO85176.1|  hypothetical protein CISIN_1g012940mg                   333   5e-111   Citrus sinensis [apfelsine]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    337   1e-110   Tarenaya hassleriana [spider flower]
gb|KDO85175.1|  hypothetical protein CISIN_1g012940mg                   332   1e-110   Citrus sinensis [apfelsine]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    336   2e-110   Eucalyptus grandis [rose gum]
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         355   6e-110   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   333   8e-110   Citrus sinensis [apfelsine]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             334   1e-109   Eutrema salsugineum [saltwater cress]
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                331   3e-109   Vicia sativa [spring vetch]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    333   4e-109   Citrus sinensis [apfelsine]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             333   4e-109   Citrus clementina [clementine]
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    332   7e-109   Brassica rapa
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    331   3e-108   Arabis alpina [alpine rockcress]
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            328   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             328   4e-107   Capsella rubella
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    327   6e-107   Camelina sativa [gold-of-pleasure]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    325   5e-106   
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             324   7e-106   
gb|EPS70760.1|  hypothetical protein M569_03997                         323   1e-105   Genlisea aurea
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    315   5e-102   Camelina sativa [gold-of-pleasure]
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    314   8e-102   Setaria italica
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    313   1e-101   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    313   2e-101   Triticum urartu
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    313   3e-101   
dbj|BAJ86633.1|  predicted protein                                      311   7e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87214.1|  predicted protein                                      311   8e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001048847.1|  Os03g0129300                                       309   1e-99    
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    306   8e-99    
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    305   3e-98    
emb|CDY69523.1|  BnaC08g46180D                                          301   2e-97    Brassica napus [oilseed rape]
gb|ABK24645.1|  unknown                                                 301   1e-96    Picea sitchensis
gb|ACN40006.1|  unknown                                                 301   1e-96    Picea sitchensis
gb|ACN40526.1|  unknown                                                 299   9e-96    Picea sitchensis
gb|ABR16095.1|  unknown                                                 290   4e-95    Picea sitchensis
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      294   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             294   3e-94    Selaginella moellendorffii
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    293   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             294   4e-94    
gb|EYU41183.1|  hypothetical protein MIMGU_mgv1a025772mg                280   5e-92    Erythranthe guttata [common monkey flower]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          286   3e-91    
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    283   2e-90    Marchantia polymorpha
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               285   3e-90    Marchantia polymorpha
ref|XP_001779769.1|  predicted protein                                  270   4e-85    
gb|ACJ85309.1|  unknown                                                 261   4e-84    Medicago truncatula
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               264   5e-84    Capsicum annuum
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    263   8e-83    Spinacia oleracea
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              262   1e-82    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_001771209.1|  predicted protein                                  261   1e-81    
emb|CBI21236.3|  unnamed protein product                                256   5e-81    Vitis vinifera
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               261   5e-81    Chara vulgaris
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   8e-80    
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    256   1e-79    Vitis vinifera
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      256   1e-79    Mesostigma viride
emb|CAN78872.1|  hypothetical protein VITISV_021726                     256   1e-79    Vitis vinifera
ref|XP_001753934.1|  predicted protein                                  251   9e-78    
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             250   2e-77    Selaginella moellendorffii
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             250   2e-77    Selaginella moellendorffii
ref|XP_001771246.1|  predicted protein                                  250   2e-77    
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    249   4e-77    Glycine soja [wild soybean]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    249   4e-77    
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    249   5e-77    Glycine soja [wild soybean]
gb|ACU21011.1|  unknown                                                 249   5e-77    Glycine max [soybeans]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    249   6e-77    
gb|KJB11771.1|  hypothetical protein B456_001G276400                    249   7e-77    Gossypium raimondii
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    247   2e-76    Mesostigma viride
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    246   7e-76    Eucalyptus grandis [rose gum]
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               243   8e-76    Coleochaete scutata
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          246   8e-76    Amborella trichopoda
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               246   1e-75    Marchantia polymorpha
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    245   1e-75    Sesamum indicum [beniseed]
ref|XP_001779753.1|  predicted protein                                  245   2e-75    
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             244   2e-75    Cucumis sativus [cucumbers]
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    244   3e-75    
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         244   5e-75    Morus notabilis
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   6e-75    Nicotiana tomentosiformis
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                243   9e-75    Mangifera indica
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     242   1e-74    Physcomitrella patens
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    243   1e-74    
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      244   2e-74    Chlorokybus atmophyticus
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    242   2e-74    Nicotiana tabacum [American tobacco]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    242   2e-74    Cucumis melo [Oriental melon]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    242   2e-74    Cucumis melo [Oriental melon]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        242   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    242   3e-74    Nicotiana sylvestris
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                242   3e-74    Arachis hypogaea [goober]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             242   3e-74    Nicotiana benthamiana
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    241   4e-74    Arabis alpina [alpine rockcress]
emb|CDP18560.1|  unnamed protein product                                241   5e-74    Coffea canephora [robusta coffee]
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   6e-74    Nelumbo nucifera [Indian lotus]
ref|XP_001766703.1|  predicted protein                                  240   7e-74    
gb|EPS59235.1|  hypothetical protein M569_15573                         241   7e-74    Genlisea aurea
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             241   8e-74    Citrus clementina [clementine]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    241   9e-74    Citrus sinensis [apfelsine]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           240   1e-73    Coccomyxa subellipsoidea C-169
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   1e-73    Fragaria vesca subsp. vesca
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    240   1e-73    Theobroma cacao [chocolate]
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   241   1e-73    Citrus sinensis [apfelsine]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   1e-73    Prunus mume [ume]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   1e-73    Tarenaya hassleriana [spider flower]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   240   2e-73    Citrus sinensis [apfelsine]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    240   2e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    239   4e-73    Nelumbo nucifera [Indian lotus]
ref|XP_002892719.1|  GAPA-2                                             239   5e-73    Arabidopsis lyrata subsp. lyrata
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    239   5e-73    Arabis alpina [alpine rockcress]
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   5e-73    Camelina sativa [gold-of-pleasure]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             239   5e-73    Prunus persica
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   6e-73    Solanum tuberosum [potatoes]
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                238   7e-73    Syntrichia caninervis
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             238   7e-73    Eutrema salsugineum [saltwater cress]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   8e-73    Camelina sativa [gold-of-pleasure]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   9e-73    Brassica rapa
emb|CDY16038.1|  BnaC08g40850D                                          238   9e-73    Brassica napus [oilseed rape]
emb|CDY19412.1|  BnaC05g09210D                                          238   1e-72    Brassica napus [oilseed rape]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    238   1e-72    Pyrus x bretschneideri [bai li]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   2e-72    Brassica rapa
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   2e-72    Solanum lycopersicum
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               237   2e-72    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   2e-72    Malus domestica [apple tree]
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    236   2e-72    Gossypium arboreum [tree cotton]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             237   2e-72    Eutrema salsugineum [saltwater cress]
ref|XP_002875330.1|  gapa                                               236   3e-72    Arabidopsis lyrata subsp. lyrata
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    237   3e-72    Pyrus x bretschneideri [bai li]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             236   3e-72    
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   3e-72    
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    236   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             236   3e-72    Capsella rubella
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    236   3e-72    Ricinus communis
emb|CDY26599.1|  BnaA09g46780D                                          236   4e-72    Brassica napus [oilseed rape]
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   4e-72    Setaria italica
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   4e-72    Camelina sativa [gold-of-pleasure]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              236   5e-72    Scoparia dulcis [escobilla]
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      233   8e-72    Spirogyra sp. SAG 170.80
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   8e-72    Malus domestica [apple tree]
gb|KJB70723.1|  hypothetical protein B456_011G088800                    236   8e-72    Gossypium raimondii
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   9e-72    Cicer arietinum [garbanzo]
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    235   9e-72    Camelina sativa [gold-of-pleasure]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                235   9e-72    Arabidopsis thaliana [mouse-ear cress]
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    235   9e-72    Spinacia oleracea
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  236   1e-71    Pinus sylvestris [Scotch pine]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    234   1e-71    Marchantia polymorpha
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         235   1e-71    Medicago truncatula
dbj|BAJ34149.1|  unnamed protein product                                234   2e-71    Eutrema halophilum
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    234   2e-71    Ostreococcus sp. 'lucimarinus'
gb|AGJ50596.1|  GAPDH                                                   234   2e-71    Pericallis cruenta
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   2e-71    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       233   5e-71    Medicago sativa [alfalfa]
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   8e-71    Populus euphratica
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         233   9e-71    Jatropha curcas
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    233   1e-70    Botryococcus braunii
tpg|DAA37468.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         228   1e-70    
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             233   1e-70    
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   1e-70    Solanum lycopersicum
gb|ABK96233.1|  unknown                                                 233   1e-70    Populus trichocarpa x Populus deltoides
gb|ABK94956.1|  unknown                                                 232   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             232   1e-70    Phaseolus vulgaris [French bean]
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         232   2e-70    Micromonas commoda
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    232   2e-70    Populus euphratica
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                234   2e-70    Erythranthe guttata [common monkey flower]
gb|ABK96725.1|  unknown                                                 232   3e-70    Populus trichocarpa x Populus deltoides
ref|XP_001415434.1|  predicted protein                                  232   3e-70    Ostreococcus lucimarinus CCE9901
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    233   3e-70    
gb|ACN40000.1|  unknown                                                 231   6e-70    Picea sitchensis
gb|ABK24313.1|  unknown                                                 231   6e-70    Picea sitchensis
gb|ABK25233.1|  unknown                                                 231   6e-70    Picea sitchensis
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             231   6e-70    Populus trichocarpa [western balsam poplar]
gb|ACN40537.1|  unknown                                                 231   6e-70    Picea sitchensis
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    231   6e-70    Brassica rapa
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    231   7e-70    Ostreococcus tauri
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    230   8e-70    
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    229   8e-70    Ostreococcus tauri
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    230   1e-69    Zea mays [maize]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                228   1e-69    Lilium regale
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           229   1e-69    Bathycoccus prasinos
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                230   1e-69    Bruguiera gymnorhiza [Burma mangrove]
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               227   2e-69    Spirogyra sp.
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    230   2e-69    
emb|CAA30152.1|  GADPH (383 AA)                                         229   2e-69    Zea mays [maize]
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    227   2e-69    Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    227   2e-69    Spinacia oleracea
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    227   2e-69 
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    227   2e-69    Spinacia oleracea
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              229   3e-69    Phaseolus vulgaris [French bean]
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   3e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   4e-69    Oryza brachyantha
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    227   5e-69    Triticum urartu
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   5e-69    
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             228   5e-69    Micromonas pusilla CCMP1545
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   5e-69    
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    227   6e-69    Spinacia oleracea
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      226   6e-69    Mesostigma viride
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    227   7e-69    Micromonas commoda
dbj|BAJ90885.1|  predicted protein                                      228   8e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             228   9e-69    Micromonas pusilla CCMP1545
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         227   1e-68    
dbj|BAJ90530.1|  predicted protein                                      226   3e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001052984.1|  Os04g0459500                                       226   4e-68    
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     224   4e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   5e-68    Brachypodium distachyon [annual false brome]
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                223   6e-68    Mesostigma viride
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      224   7e-68    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57068.1|  AT1G12900                                              224   8e-68    Arabidopsis thaliana [mouse-ear cress]
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               223   1e-67    Sphagnum cuspidatum
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             223   1e-67    
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    226   1e-67    Ostreococcus tauri
gb|ACN41006.1|  unknown                                                 227   1e-67    Picea sitchensis
ref|XP_010458726.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   1e-67    Camelina sativa [gold-of-pleasure]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              224   1e-67    Volvox carteri f. nagariensis
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           223   2e-67    Chlamydomonas reinhardtii
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    224   2e-67    Pisum sativum [garden pea]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   2e-67    Pyrus x bretschneideri [bai li]
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                223   3e-67    
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    222   3e-67    
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    223   3e-67    
emb|CAA33264.1|  unnamed protein product                                224   3e-67    
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    223   4e-67    
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           222   1e-66    
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      221   2e-66    
ref|XP_001420043.1|  predicted protein                                  219   3e-66    
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    218   1e-65    
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      217   1e-65    
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    219   1e-65    
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                217   2e-65    
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      216   2e-65    
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    218   2e-65    
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               216   3e-65    
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               216   4e-65    
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    216   8e-65    
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      217   1e-64    
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               214   2e-64    
gb|ABR18416.1|  unknown                                                 218   3e-64    
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      214   3e-64    
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              214   4e-64    
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    214   4e-64    
ref|XP_005843104.1|  hypothetical protein CHLNCDRAFT_49269              212   9e-64    
gb|AGV54738.1|  glyceraldehyde-3-phosphate dehydrogenase A chloro...    211   2e-63    
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      213   2e-63    
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   8e-63    
gb|AEW46689.1|  glyceraldehyde-3-phosphate dehydrogenase                211   8e-63    
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    210   5e-62    
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    207   1e-61    
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    209   2e-61    
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           208   4e-61    
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    208   5e-61    
gb|AAB82133.1|  glyceralehyde-3-phosphate dehydrogenase subunit         206   7e-61    
gb|ABC68431.1|  putative glyceraldehyde 3-phosphate dehydrogenase       197   3e-60    
gb|ABC68432.1|  putative glyceraldehyde 3-phosphate dehydrogenase       197   5e-60    
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    204   9e-60    
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      204   1e-59    
gb|ADB81494.1|  glyceraldehyde-3-phosphate dehydrogenase                201   1e-59    
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    204   1e-59    
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    204   1e-59    
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               202   1e-59    
gb|KJB57938.1|  hypothetical protein B456_009G186400                    202   6e-59    
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    200   2e-58    
gb|ABF93790.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    192   2e-57    
gb|ACN39951.1|  unknown                                                 196   4e-57    
gb|ADB81486.1|  glyceraldehyde-3-phosphate dehydrogenase                195   4e-57    
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     192   9e-56    
emb|CDX83635.1|  BnaC07g23750D                                          192   2e-55    
emb|CDY28536.1|  BnaC02g36240D                                          192   3e-55    
gb|ADB81489.1|  glyceraldehyde-3-phosphate dehydrogenase                189   7e-55    
emb|CDY13649.1|  BnaA06g32740D                                          190   1e-54    
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    189   1e-54    
gb|AAB66887.1|  glyceraldehyde-3-phosphate dehydrogenase                186   3e-54    
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           188   4e-54    
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           187   7e-54    
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           185   6e-53    
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           184   9e-53    
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           186   1e-52    
gb|KIY96104.1|  hypothetical protein MNEG_11860                         178   2e-52    
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         183   2e-52    
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    183   3e-52    
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           183   3e-52    
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    182   8e-52    
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           182   9e-52    
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    181   1e-51    
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    181   2e-51    
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    180   2e-51    
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    181   2e-51    
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    181   2e-51    
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           180   3e-51    
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    180   3e-51    
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             181   4e-51    
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             181   4e-51    
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           180   4e-51    
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             181   4e-51    
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           180   5e-51    
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           180   5e-51    
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             180   5e-51    
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           180   6e-51    
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           180   6e-51    
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           179   6e-51    
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   7e-51    
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           179   1e-50    
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           179   1e-50    
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           178   2e-50    
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    178   2e-50    
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           178   2e-50    
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    178   2e-50    
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    178   2e-50    
pdb|2D2I|A  Chain A, Crystal Structure Of Nadp-Dependent Glyceral...    179   2e-50    
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    178   2e-50    
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           178   3e-50    
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           177   7e-50    
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           177   8e-50    
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         177   8e-50    
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           176   1e-49    
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    176   1e-49    
emb|CDY48981.1|  BnaA02g28150D                                          176   3e-49    
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           175   3e-49    
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           175   3e-49    
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      174   3e-49    
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    175   3e-49    
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           175   3e-49    
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           176   4e-49    
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        175   4e-49    
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    174   6e-49    
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    174   7e-49    
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           174   8e-49    
ref|WP_011433307.1|  glyceraldehyde-3-phosphate dehydrogenase           174   1e-48    
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48    
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        173   2e-48    
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    172   3e-48    
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               172   3e-48    
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           172   3e-48    
gb|ADB81488.1|  glyceraldehyde-3-phosphate dehydrogenase                171   4e-48    
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           172   5e-48    
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           172   5e-48    
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           171   8e-48    
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           171   9e-48    
ref|WP_011429234.1|  glyceraldehyde-3-phosphate dehydrogenase           171   9e-48    
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           171   1e-47    
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    171   2e-47    
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    170   2e-47    
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    170   3e-47    
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    169   4e-47    
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           169   5e-47    
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    169   5e-47    
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    169   6e-47    
ref|WP_015224818.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    169   1e-46    
emb|CAC81003.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    168   1e-46    
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           168   1e-46    
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           168   2e-46    
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           168   2e-46    
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                168   2e-46    
emb|CAC85938.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    167   2e-46    
emb|CAB41845.1|  glyceraldehyde-3-phosphate dehydrogenase               167   2e-46    
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    167   3e-46    
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           167   3e-46    
ref|WP_039728353.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    167   3e-46    
emb|CAC81001.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    166   4e-46    
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           167   4e-46    
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           167   4e-46    
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           167   6e-46    
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   6e-46    
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    166   6e-46    
gb|ABK00066.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    164   7e-46    
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           166   9e-46    
ref|WP_017327507.1|  glyceraldehyde-3-phosphate dehydrogenase           166   2e-45    
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase           166   2e-45    
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          166   2e-45    
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    165   2e-45    
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    164   4e-45    
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    164   4e-45    
gb|ADB81484.1|  glyceraldehyde-3-phosphate dehydrogenase                162   5e-45    
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              163   8e-45    
ref|XP_006573126.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    157   1e-44    
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    163   1e-44    
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           163   1e-44    
ref|XP_006573127.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    156   1e-44    
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    163   1e-44    
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           163   2e-44    
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44    
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        163   2e-44    
ref|WP_011057306.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44    
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44    
emb|CAC80999.1|  NAD(P)-dependent glyceraldehyde-3-phosphate dehy...    162   3e-44    
ref|WP_041429017.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44    
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    162   3e-44    
ref|WP_015125741.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    162   3e-44    
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44    
pdb|3ZCX|A  Chain A, Structure Of Gapdh From Thermosynechococcus ...    162   3e-44    
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           162   4e-44    
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           162   4e-44    
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        162   4e-44    
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    162   4e-44    
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    162   4e-44    
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           161   4e-44    
gb|ADB81487.1|  glyceraldehyde-3-phosphate dehydrogenase                160   4e-44    
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    161   5e-44    
gb|ADB81485.1|  glyceraldehyde-3-phosphate dehydrogenase                160   7e-44    
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           161   7e-44    
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           160   1e-43    
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                160   1e-43    
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase      161   1e-43    
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           160   2e-43    
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           160   2e-43    
gb|AFK38236.1|  unknown                                                 153   2e-43    
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           159   4e-43    
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           159   4e-43    
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           159   4e-43    
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           159   4e-43    
gb|ABM76784.1|  Glyceraldehyde 3-phosphate dehydrogenase(NADP+)(p...    160   5e-43    
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           159   5e-43    
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    159   6e-43    
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    159   7e-43    
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    158   9e-43    
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    158   1e-42    
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
ref|WP_041374635.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                160   1e-42    
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42    
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           157   1e-42    
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42    
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42    
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    157   2e-42    
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               156   2e-42    
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    157   2e-42    
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42    
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42    
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42    
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                157   2e-42    
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           157   3e-42    
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         157   3e-42    
gb|KGG26981.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    157   3e-42    
ref|WP_012164673.1|  glyceraldehyde-3-phosphate dehydrogenase           156   4e-42    
ref|WP_010475353.1|  glyceraldehyde-3-phosphate dehydrogenase           156   4e-42    



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   372 bits (956),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/210 (89%), Positives = 196/210 (93%), Gaps = 4/210 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRLP+K S     QCFSK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLPAKNSHSFPTQCFSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTPK  69

Query  227  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  403
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLK
Sbjct  70   TTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLK  129

Query  404  YDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPG  583
            YDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPG
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPG  189

Query  584  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            AGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  219



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   367 bits (943),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 183/210 (87%), Positives = 195/210 (93%), Gaps = 4/210 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRLPSK S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPSKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  227  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  403
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLK
Sbjct  70   TTGLAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  129

Query  404  YDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPG  583
            YDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPG
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPG  189

Query  584  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            AGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  219



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 185/210 (88%), Positives = 194/210 (92%), Gaps = 4/210 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRLPSK S     QCFSK+ EVAEFSGLRSSG VTFSNRE+S  DVV+AQLTPK
Sbjct  10   SRIPTSTRLPSKNSQSFPTQCFSKKFEVAEFSGLRSSGYVTFSNRESSLFDVVSAQLTPK  69

Query  227  ATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  403
             TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLK
Sbjct  70   TTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLK  129

Query  404  YDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPG  583
            YDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPG
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPG  189

Query  584  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            AGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  219



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 195/211 (92%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  224  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
            K TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   KTTGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGP  189

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   366 bits (940),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/212 (87%), Positives = 195/212 (92%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIP  TRLPSKTS     QCFSKRLEVAEFSGLRSS C+T+++  REAS  D VAAQLT
Sbjct  10   TRIPANTRLPSKTSHSYPTQCFSKRLEVAEFSGLRSSSCLTYASNGREASLFDAVAAQLT  69

Query  221  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            P+ +G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PQTSGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKAD+K+VDNETISVDGKPIKVVSNRDPLKLPWA+MGIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADIKIVDNETISVDGKPIKVVSNRDPLKLPWAEMGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   366 bits (940),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 194/211 (92%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIPT TRLPS  ++     QC SK+ EVAEFSGLRSSGCVTFSNRE+SF DVV+AQLTP
Sbjct  10   SRIPTSTRLPSNKNSYSFPTQCLSKKFEVAEFSGLRSSGCVTFSNRESSFFDVVSAQLTP  69

Query  224  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
            K TG AP KG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   KTTGSAPAKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGP  189

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   366 bits (939),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 195/212 (92%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFS-NREASFSDVVAAQLT  220
            SRIPT TRLPSKTS      QCFSK+LEVAEFSGLRSSGCVTF+ N+EASF D VAAQLT
Sbjct  10   SRIPTSTRLPSKTSHSFPAAQCFSKKLEVAEFSGLRSSGCVTFAKNKEASFFDAVAAQLT  69

Query  221  PKATGAP-VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             K  G+  VKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   LKTAGSTTVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKG+DIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGSDIPTYVVGV  221



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/210 (86%), Positives = 195/210 (93%), Gaps = 4/210 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRLP+K S     QC SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK
Sbjct  10   SRIPTTTRLPTKNSHSFPTQCLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPK  69

Query  227  ATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  403
             TG+ PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLK
Sbjct  70   TTGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLK  129

Query  404  YDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPG  583
            YDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPG
Sbjct  130  YDSMLGTFKADVKIVDNETISVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPG  189

Query  584  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            AGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  219



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   365 bits (937),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 194/211 (92%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  227  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGP  189

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 186/212 (88%), Positives = 194/212 (92%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SR+PT TRLPSK S     QCFSK+LEVAEFSGLR  G VTF+   REASF DVVAAQLT
Sbjct  10   SRVPTSTRLPSKASNAFPAQCFSKKLEVAEFSGLRVGGSVTFAKNGREASFFDVVAAQLT  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PKA G+ PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKAAGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/211 (86%), Positives = 194/211 (92%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  227  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGP  189

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   364 bits (935),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPK  226
            SRIPT TRL SK S     QCFSK+ EVAEFSGLRSSGCVTF N+E+SF DVV+AQLTPK
Sbjct  10   SRIPTSTRLLSKNSYSFPTQCFSKKFEVAEFSGLRSSGCVTFCNKESSFFDVVSAQLTPK  69

Query  227  ATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
             TG+  PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   TTGSAGPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  130  KYDSMLGTFKADVKIVDNETISVDGKNIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGP  189

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  190  GAGKHIQAGAKKVIITAPAKGADIPTYVIGV  220



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   361 bits (927),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 193/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  221  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKTTGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLG FKADVK+VDNETISVDGKP++VVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGIFKADVKIVDNETISVDGKPVQVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 191/212 (90%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  221  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKP+KVVS+RDPLKLPWA+MGIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/212 (85%), Positives = 191/212 (90%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  221  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKP+KVVS+RDPLKLPWA+MGIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   359 bits (921),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 193/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIP  TRLPSK+S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   TRIPANTRLPSKSSHSFPAQCFSKRLEVGEFSGLRSSSCVTYASNGRETSFFDAVAAQLT  69

Query  221  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK TG APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKTTGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLG FKADVK+VDNETISVDGKP++VVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGIFKADVKIVDNETISVDGKPVQVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   357 bits (917),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/212 (85%), Positives = 191/212 (90%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SR+P  TRLPSK S     QCFSKRLEV EFSGLRSS CVT+++  RE SF D VAAQLT
Sbjct  10   SRVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRSSSCVTYASNGREQSFFDTVAAQLT  69

Query  221  PKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTAGPTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKP+KVVS+RDPLKLPWA+MGIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPVKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPT+VVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTHVVGV  221



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/214 (85%), Positives = 192/214 (90%), Gaps = 8/214 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ASF DV+AAQL+
Sbjct  10   SRIPANTRLPSKTTHSFPTQCPSKRLEVTEFSGLRSSSCVTFAKNVRDASFFDVLAAQLS  69

Query  221  PKATGAP---VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  391
            PK  G P   V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+
Sbjct  70   PKGVGVPSTSVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNAS  129

Query  392  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFV  571
            HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFV
Sbjct  130  HLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  189

Query  572  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  223



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/214 (84%), Positives = 192/214 (90%), Gaps = 8/214 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            S+IP  TRLPSKT+     QC SKRLEV EFSGLRSS CVTF+   R+ SF DV+AAQLT
Sbjct  10   SKIPANTRLPSKTTHSFPTQCSSKRLEVTEFSGLRSSSCVTFAKNVRDTSFFDVLAAQLT  69

Query  221  PKATGAP---VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  391
            PK+ G P   V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+
Sbjct  70   PKSEGVPSASVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNAS  129

Query  392  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFV  571
            HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFV
Sbjct  130  HLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFV  189

Query  572  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  223



>gb|KJB57937.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=278

 Score =   349 bits (896),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 190/215 (88%), Gaps = 9/215 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  214
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  215  LTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  388
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  389  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVF  568
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDP++LPWA++GIDIVIEGTGVF
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVF  189

Query  569  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  224



>ref|XP_003603852.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=283

 Score =   348 bits (894),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   353 bits (906),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 189/211 (90%), Gaps = 6/211 (3%)
 Frame = +2

Query  59   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  223
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  224  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLL
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPW +MGIDIVIEGTGVFVDGP
Sbjct  131  KYDSMLGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGP  190

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  191  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/212 (84%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  220
            SRIP  TRLPS++S     QCFSKRLEVA+FSGLRSS  VTF  + RE+SF DVVA+QL 
Sbjct  10   SRIPANTRLPSRSSHSHATQCFSKRLEVADFSGLRSSTSVTFGKNARESSFFDVVASQLA  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HL
Sbjct  70   PKVAASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWAD+GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWADLGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>gb|KJB57939.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=320

 Score =   350 bits (897),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 190/215 (88%), Gaps = 9/215 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  214
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  215  LTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  388
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  389  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVF  568
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDP++LPWA++GIDIVIEGTGVF
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVF  189

Query  569  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  224



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 193/213 (91%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  221  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  G+  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   PKTNGSSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSMLGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   353 bits (906),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 194/213 (91%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  217
            SRIPT  TRLPSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRLPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  218  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            TPKA G APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+H
Sbjct  70   TPKAGGPAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   353 bits (905),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 189/211 (90%), Gaps = 6/211 (3%)
 Frame = +2

Query  59   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  223
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  224  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLL
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPW +MGIDIVIEGTGVFVDGP
Sbjct  131  KYDSMLGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGP  190

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  191  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   353 bits (905),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 175/214 (82%), Positives = 192/214 (90%), Gaps = 8/214 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  221  PKATG---APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAA  391
            PK T     PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+
Sbjct  70   PKQTNGSSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNAS  129

Query  392  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFV  571
            HLLKYDSMLGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFV
Sbjct  130  HLLKYDSMLGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFV  189

Query  572  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  223



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   352 bits (904),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 189/211 (90%), Gaps = 6/211 (3%)
 Frame = +2

Query  59   RIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTP  223
            ++P  TRLPSK S     QCFSKRLEV EFSGLR S C+T+++  R+ SF + VAAQLTP
Sbjct  11   KVPANTRLPSKPSHSFPTQCFSKRLEVGEFSGLRLSSCMTYASNGRDQSFFEAVAAQLTP  70

Query  224  KATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
            K  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLL
Sbjct  71   KTAGPAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLL  130

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGKP+KVVSNRDPLKLPW +MGIDIVIEGTGVFVDGP
Sbjct  131  KYDSMLGTFKADVKIVDNETISVDGKPVKVVSNRDPLKLPWTEMGIDIVIEGTGVFVDGP  190

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  191  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   352 bits (903),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 190/215 (88%), Gaps = 9/215 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  214
            SRIP  TRLPSK      S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIPATTRLPSKATHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFYDVVAAQ  69

Query  215  LTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  388
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  389  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVF  568
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPL+LPWA++GIDIVIEGTGVF
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLQLPWAELGIDIVIEGTGVF  189

Query  569  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  224



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HL
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 192/213 (90%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT T+ PSK S     QC SKRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPTNTKFPSKASHSFPTQCASKRLEVTEFSGLRSTSCVTYANDARESSFFDLVASQLT  69

Query  221  PKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  G+  PV+G TVAKLKVAINGFGRIG NFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   PKTNGSSTPVRGETVAKLKVAINGFGRIGGNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK++DNETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSMLGTFKADVKILDNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/213 (85%), Positives = 193/213 (91%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPT-RTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  217
            SRIPT  TR PSK S     Q F+KRLEVAEFSGLRS GCVTF+   RE SF DVVA+QL
Sbjct  10   SRIPTTNTRHPSKASHSFPTQFFAKRLEVAEFSGLRSGGCVTFAKNAREPSFFDVVASQL  69

Query  218  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            TPKA G APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+H
Sbjct  70   TPKAGGPAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 193/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  220
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  10   TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   SKANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVIGV  221



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 193/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLT  220
            +RIPT TR PSKTS     QC SKRLEV EFSGL+S+ C+++  S R++SF DVVAAQLT
Sbjct  6    TRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSFYDVVAAQLT  65

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  VKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  66   SKANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  186  PGAGKHIQAGAKKVIITAPAKGADIPTYVIGV  217



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSK++     QC SKRLEVAEFSGLR+S C+T++    EASF D+VAAQ+ 
Sbjct  10   SRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASFFDLVAAQMA  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK AT  P +  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVATSTPTRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDN TISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   347 bits (891),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 191/212 (90%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HL
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK++DNETI+VDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 190/215 (88%), Gaps = 9/215 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKT-----STPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQ  214
            SRI   TRLPSKT     S  QC S RL+V EFSGLRS+ CVTF N  R+ASF DVVAAQ
Sbjct  10   SRIRATTRLPSKTTHSFPSQIQCSSTRLQVTEFSGLRSASCVTFVNNARDASFFDVVAAQ  69

Query  215  LTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNA  388
            LTPK  G   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA
Sbjct  70   LTPKTAGGATPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNA  129

Query  389  AHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVF  568
            +HLLKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDP++LPWA++GIDIVIEGTGVF
Sbjct  130  SHLLKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPVQLPWAELGIDIVIEGTGVF  189

Query  569  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  VDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  224



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   348 bits (894),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 189/217 (87%), Gaps = 11/217 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTS------TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAA  211
            SRIP  TRL SKTS      T   FSKRLEV E+SGLRSSGCVTF+  +RE SF D  A 
Sbjct  11   SRIPANTRLVSKTSHYNSFPTQYSFSKRLEVDEYSGLRSSGCVTFATNSRETSFFDAAAV  70

Query  212  QLTPKATGA---PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVK  382
            QLTPK   A   PVKG TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+VIVVNDSAGVK
Sbjct  71   QLTPKRQNAGSTPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSAGVK  130

Query  383  NAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTG  562
            NA+HLLKYDSMLGTFKADVKVVD ETISVDGKPI+VVS+RDPLKLPWAD+GIDIVIEGTG
Sbjct  131  NASHLLKYDSMLGTFKADVKVVDTETISVDGKPIQVVSSRDPLKLPWADLGIDIVIEGTG  190

Query  563  VFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            VFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  191  VFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  227



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   348 bits (892),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL 
Sbjct  10   SRIPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNACEGSFFDMVASQLA  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 190/213 (89%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIP+ TR PSK S     QC  KRLEV EFSGLRS+ CVT++N  RE+SF D+VA+QLT
Sbjct  10   TRIPSNTRFPSKASHSFPTQCALKRLEVTEFSGLRSTSCVTYANSARESSFFDLVASQLT  69

Query  221  PKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK T    PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   PKQTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK++DNETI+VDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSMLGTFKADVKILDNETITVDGKSIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 189/209 (90%), Gaps = 5/209 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTPK-  226
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANTS--FSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKT  67

Query  227  ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKY  406
            A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKY
Sbjct  68   ARAVPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGGVKNASHLLKY  127

Query  407  DSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGA  586
            DSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGA
Sbjct  128  DSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGA  187

Query  587  GKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  188  GKHIQAGAKKVIITAPAKGADIPTYVVGV  216



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT T  PSK S     QC SKRLEV +FSGLRS+ CVT+++  RE+SF D VAAQLT
Sbjct  10   TRIPTNTSFPSKASHSFPTQCTSKRLEVNDFSGLRSTSCVTYASNARESSFFDTVAAQLT  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   PKTNGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGK IKVVS+RDPLKLPW ++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKLIKVVSSRDPLKLPWTELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 191/213 (90%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST---PQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC SKRLEVAEF GL+S+ C+T++N  R++SFSDVVAAQLT
Sbjct  83   TRIPTNTRFPSKASHNFPTQCASKRLEVAEFCGLKSTSCITYANNARDSSFSDVVAAQLT  142

Query  221  PKAT--GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
             KA     PV+G TVAKLKVAINGFGRIGRNFLRCWH RKDSPLEVIVVNDS GVKNA+H
Sbjct  143  SKAAVGSIPVRGETVAKLKVAINGFGRIGRNFLRCWHERKDSPLEVIVVNDSGGVKNASH  202

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK+++NETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  203  LLKYDSMLGTFKADVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  262

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  263  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  295



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 189/211 (90%), Gaps = 7/211 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLTPK-  226
            SRIP+ TR   K +T   FSKRLEVAEFSGLRSS  +TF+   REASFSDV+A+QL+ K 
Sbjct  10   SRIPSNTRFHCKANTS--FSKRLEVAEFSGLRSSTSLTFATHGREASFSDVLASQLSTKL  67

Query  227  --ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
              A   PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLL
Sbjct  68   QTARAVPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVLVVNDSGGVKNASHLL  127

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  128  KYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGP  187

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  188  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  218



>ref|XP_006383782.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61579.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=308

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 185/212 (87%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK A   PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGATKVIITAPAKGADIPTYVVGV  221



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 180/190 (95%), Gaps = 1/190 (1%)
 Frame = +2

Query  107  CFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKAT-GAPVKGVTVAKLKVAIN  283
            C SK+ EVAEF+GLRSSGCVTFSN+E+SF DVV+AQLTPK T   PVKG TVAKLKVAIN
Sbjct  1    CLSKKFEVAEFAGLRSSGCVTFSNKESSFFDVVSAQLTPKTTRSTPVKGETVAKLKVAIN  60

Query  284  GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  463
            GFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLKYDSMLGTFKADVK+VDNETI
Sbjct  61   GFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDNETI  120

Query  464  SVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  643
            SVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG
Sbjct  121  SVDGKHIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  180

Query  644  ADIPTYVVGV  673
            ADIPTYVVGV
Sbjct  181  ADIPTYVVGV  190



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 177/212 (83%), Positives = 191/212 (90%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  T LPSK++     QC +KRLEVAEFSGLRSS  VTF+    EASF DVVAAQLT
Sbjct  10   SRIPASTTLPSKSTHSFPTQCSTKRLEVAEFSGLRSSSRVTFARNVGEASFFDVVAAQLT  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGR++SPL+VIVVNDS GVKNA+HL
Sbjct  70   PKTGGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRENSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+V+NETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVNNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   347 bits (889),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC SKRLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASKRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+++NETI+VDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKILNNETITVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   345 bits (885),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 176/212 (83%), Positives = 187/212 (88%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSK +     Q  SKRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPATTRLPSKINRSFPTQSSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  221  PKAT-GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PKA    PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKAAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   345 bits (885),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 189/212 (89%), Gaps = 7/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  220
            +RIP  TRLP+K +       QC  K+L+VA+FSGLRSS CVTF+ REASF DV+AAQLT
Sbjct  10   TRIPASTRLPTKAAQQHSFPTQCSFKKLDVADFSGLRSSNCVTFT-REASFHDVIAAQLT  68

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             K TGA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVK+A HL
Sbjct  69   TKTTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHL  128

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDS+LGTFKADVK+VDNET S+DGK IKVVSNRDPLKLPWAD+GIDIVIEGTGVFVDG
Sbjct  129  LKYDSILGTFKADVKIVDNETFSIDGKSIKVVSNRDPLKLPWADLGIDIVIEGTGVFVDG  188

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  189  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 188/212 (89%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSKT+     QC SKRLEVAEFSGLR++  V+++    E SF DVVAAQ+T
Sbjct  10   SRIPASTRLPSKTTYSFPSQCSSKRLEVAEFSGLRATSHVSYAKNATEGSFFDVVAAQMT  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK A   P++  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL
Sbjct  70   PKVAASTPIRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VD+ TISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKADVKIVDDSTISVDGKHIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   343 bits (880),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 190/211 (90%), Gaps = 5/211 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN-REASFSDVVAAQLTP  223
            +RIPT TRLPSKTS     +C SKRL VAEF+GLRS+   + +N RE SF D VAAQLTP
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSSKRLNVAEFNGLRSASLSSSNNGREGSFFDAVAAQLTP  69

Query  224  KATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLL  400
            KA  + PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLL
Sbjct  70   KAVASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLL  129

Query  401  KYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGP  580
            KYDSMLGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGP
Sbjct  130  KYDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGP  189

Query  581  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 187/210 (89%), Gaps = 6/210 (3%)
 Frame = +2

Query  62   IPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK  226
            IP  TRLPSKT+     QC SKRLEVAEFSGLR+S CVT++    E SF D+VA+QL PK
Sbjct  34   IPANTRLPSKTNHSFPTQCSSKRLEVAEFSGLRASSCVTYAKNASEGSFFDMVASQLAPK  93

Query  227  -ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  403
             A   PV+  TV+KLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLK
Sbjct  94   VAVSTPVRAETVSKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLK  153

Query  404  YDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPG  583
            YDSMLGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPG
Sbjct  154  YDSMLGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPG  213

Query  584  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            AGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  214  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  243



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   342 bits (878),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 186/212 (88%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQ---CFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL-  217
            SRIP+ T   SK +      CFSKRLEVAEFSGLRSS CVTF+   R+ASFSDV+AAQL 
Sbjct  10   SRIPSNTWFHSKAAHSHPTSCFSKRLEVAEFSGLRSSACVTFATNGRDASFSDVLAAQLS  69

Query  218  TPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            T  A    VKG TVAKLKVAINGFGRIGRNFLRCWHGR DSPLEV+VVNDS GVKNA+HL
Sbjct  70   TETARAVLVKGETVAKLKVAINGFGRIGRNFLRCWHGRNDSPLEVVVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDS+LGTFKADVK+VDNETISVDGKPIKVVSNRDPL+LPWA +GIDIVIEGTGVFVDG
Sbjct  130  LKYDSILGTFKADVKIVDNETISVDGKPIKVVSNRDPLQLPWAALGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 188/212 (89%), Gaps = 7/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP-----QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLT  220
            SRIP  TRL SK S       QC  KRL+VA+FSGLRSS  VTF+ REASF DV+AAQLT
Sbjct  10   SRIPASTRLASKASQQYSFLTQCSFKRLDVADFSGLRSSNSVTFT-REASFHDVIAAQLT  68

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             K TGA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVK+A HL
Sbjct  69   TKPTGAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHL  128

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDS+LGTFKADVK++DNET S+DGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  129  LKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  188

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKG+DIPTYVVGV
Sbjct  189  PGAGKHIQAGAKKVIITAPAKGSDIPTYVVGV  220



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 192/212 (91%), Gaps = 7/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSAS-LSFPNNGREGSFFDVVAAQLT  68

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK  G+ PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HL
Sbjct  69   PKVVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHL  128

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPW ++GIDIVIEGTGVFVDG
Sbjct  129  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFVDG  188

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  189  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  220



>gb|KDO85183.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85184.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=275

 Score =   334 bits (857),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>gb|KDO85177.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85178.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=304

 Score =   335 bits (858),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>gb|KDO85181.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85182.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=269

 Score =   333 bits (855),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 189/213 (89%), Gaps = 8/213 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  217
            SRIP+ TR  SK +    TP  F+KRLEVAEFSGLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHSHPTPS-FTKRLEVAEFSGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  218  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
              K  GA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+V+VVNDS GVKNA+H
Sbjct  69   ASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNASH  128

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK+VDN TISVDGKPI VV++RDPLKLPW ++GIDIVIEGTGVFVD
Sbjct  129  LLKYDSMLGTFKADVKIVDNGTISVDGKPIMVVASRDPLKLPWTELGIDIVIEGTGVFVD  188

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  189  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 189/213 (89%), Gaps = 8/213 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTS----TPQCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  217
            SRIP+ TR  SK +    TP  F+KRLEVAEF GLRSS CVTF+   REASFSDV+AAQL
Sbjct  10   SRIPSNTRFHSKATHVPPTPS-FTKRLEVAEFLGLRSSTCVTFATQGREASFSDVLAAQL  68

Query  218  TPKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
              K  GA PV+G TVAKLKVAINGFGRIGRNFLRCWHGRK+SPL+V+VVNDS GVKNA+H
Sbjct  69   ASKTVGASPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKNSPLDVVVVNDSGGVKNASH  128

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK+VDN TISVDGKP+ VVSNRDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  129  LLKYDSMLGTFKADVKIVDNGTISVDGKPVMVVSNRDPLKLPWAELGIDIVIEGTGVFVD  188

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  189  GPGAGKHIQAGAKKVIITAPAKGADIPTYVLGV  221



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 185/212 (87%), Gaps = 6/212 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLT  220
            SRIP  TRLPSK +     Q   KRLEVAEFSGLR+S CVT++    E SF DVVA+QL 
Sbjct  10   SRIPANTRLPSKINHSFPTQSSLKRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLA  69

Query  221  PK-ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            PK A   PV+  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HL
Sbjct  70   PKVAVSTPVRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  130  LKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  189

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  190  PGAGKHIQAGATKVIITAPAKGADIPTYVVGV  221



>gb|KDO85179.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
 gb|KDO85180.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=248

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 190/213 (89%), Gaps = 8/213 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TRLPSKTS     +C +KRL+VAEF+GLRS+  ++F N  RE SF DVVAAQLT
Sbjct  10   TRIPTNTRLPSKTSYSFPTRCSAKRLDVAEFNGLRSAS-LSFPNNGREGSFFDVVAAQLT  68

Query  221  PKAT--GAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK      PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  69   PKQVVGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  128

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKA+VK+VDNETISVDGKPIKVVS+RDPLKLPW ++GIDIVIEGTGVFVD
Sbjct  129  LLKYDSMLGTFKAEVKIVDNETISVDGKPIKVVSSRDPLKLPWGELGIDIVIEGTGVFVD  188

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  189  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  221



>ref|XP_006435407.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48647.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=329

 Score =   334 bits (856),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>gb|KDO85176.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=329

 Score =   333 bits (855),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQL  217
            SRIP   R  SK++      QC SKR+E AEF+GLRSSGC+ +S    ++SF D VA+QL
Sbjct  10   SRIPVNPRFHSKSNVNSFHAQCSSKRVEFAEFAGLRSSGCMVYSKNGGDSSFFDAVASQL  69

Query  218  TPKA-TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            TPKA   APV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+H
Sbjct  70   TPKAVAAAPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK+V+NETISVDGK IKVVS+RDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSMLGTFKADVKIVNNETISVDGKLIKVVSSRDPLKLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>gb|KDO85175.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=309

 Score =   332 bits (850),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 177/193 (92%), Gaps = 3/193 (2%)
 Frame = +2

Query  104  QCFSKRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPKATG-APVKGVTVAKLKV  274
            QCFSKRLEVAEFSGLR+  CVT++    E SF D VAAQLTPK +  AP KG TVAKLKV
Sbjct  30   QCFSKRLEVAEFSGLRAGSCVTYAKNAGEGSFFDAVAAQLTPKTSAPAPAKGETVAKLKV  89

Query  275  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDN  454
            AINGFGRIGRNFLRCWHGRK+SPL+VIVVNDS GVKNA+HLLKYDSMLGTFKADVK+VDN
Sbjct  90   AINGFGRIGRNFLRCWHGRKNSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDN  149

Query  455  ETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAP  634
            ETISVDGKP+KVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAP
Sbjct  150  ETISVDGKPVKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAP  209

Query  635  AKGADIPTYVVGV  673
            AKGADIPTYV GV
Sbjct  210  AKGADIPTYVYGV  222



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   355 bits (910),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 179/213 (84%), Positives = 194/213 (91%), Gaps = 8/213 (4%)
 Frame = +2

Query  59   RIPTRTRLPSKT----STP-QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQL  217
            RIPT TRLPS +    S P QCFSK+LEVAEFSGLRSS CVT++   REASF DVVAAQL
Sbjct  12   RIPTNTRLPSNSKPSHSFPTQCFSKKLEVAEFSGLRSSSCVTYAKNAREASFFDVVAAQL  71

Query  218  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            TP+  G APVKG TVAKLKVAINGFGRIGRNFLRCWHGR++SPL+VI+VNDS GVKNA+H
Sbjct  72   TPRTAGSAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRQNSPLDVIIVNDSGGVKNASH  131

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDSMLGTFKADVK+VD+ TISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVD
Sbjct  132  LLKYDSMLGTFKADVKIVDDTTISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVD  191

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGA+IPTYVVGV
Sbjct  192  GPGAGKHIQAGAKKVIITAPAKGAEIPTYVVGV  224



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   333 bits (855),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 184/212 (87%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP   RL SK++      QC SKRLEVAEFSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVNPRLQSKSAIHSFPAQCSSKRLEVAEFSGLR----VSNNGGEASFFDAIAAQITP  65

Query  224  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVVGV  217



>gb|ADH43199.1| glyceraldehyde-3-phosphate dehydrogenase [Vicia sativa]
Length=380

 Score =   331 bits (848),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 181/193 (94%), Gaps = 3/193 (2%)
 Frame = +2

Query  104  QCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLTPKATGA-PVKGVTVAKLKV  274
            QC SKRLEV EFSGL+S+ CVT++   RE+SF DVVAAQL+ K TG+ PV+G TVAKLKV
Sbjct  7    QCGSKRLEVPEFSGLKSTSCVTYAINARESSFYDVVAAQLSTKRTGSTPVRGETVAKLKV  66

Query  275  AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDN  454
            AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HLLKYDSMLGTFKA+VK+++N
Sbjct  67   AINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKILNN  126

Query  455  ETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAP  634
            ETI+VDGKPIKVVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH+QAGAKKVIITAP
Sbjct  127  ETITVDGKPIKVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHLQAGAKKVIITAP  186

Query  635  AKGADIPTYVVGV  673
            AKGADIPTYV+GV
Sbjct  187  AKGADIPTYVIGV  199



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 187/213 (88%), Gaps = 7/213 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            SRIP  TR+PSKT+     QC +KRL+VAEF+GLR++   T++   R+ASF D V AQLT
Sbjct  10   SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLT  69

Query  221  PK--ATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
            PK  A   PVK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+H
Sbjct  70   PKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFKADVK+VDNETISVDGK IKVVSNRDPL+LPWA++GIDIVIEGTGVFVD
Sbjct  130  LLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVD  189

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  222



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   332 bits (852),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 185/212 (87%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP + RL SK++      QC SKRLEVA FSGLR    V+ +  EASF D +AAQ+TP
Sbjct  10   SRIPVKPRLQSKSAIHSFPAQCSSKRLEVAAFSGLR----VSSNGGEASFFDAIAAQITP  65

Query  224  KATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA G  +PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVGTSSPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVVGV  217



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 183/212 (86%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP   RL SK++      QC SKRL+VAEFSGLR+S     ++ +ASF D + AQ+  
Sbjct  10   SRIPANPRLQSKSAIHSFPAQCSSKRLQVAEFSGLRASN----NSGDASFFDAIVAQIAS  65

Query  224  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKADVK+VDNETISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKADVKIVDNETISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVVGV  217



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 181/212 (85%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP   RL SK++      QC SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  224  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYV+GV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVMGV  217



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   328 bits (840),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 183/212 (86%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     ++ EASF D VA+Q+T 
Sbjct  10   SRIPVAQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS----NSGEASFFDAVASQITT  65

Query  224  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA  T  P++G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTTSTPIRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKNIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYV+GV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVMGV  217



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 182/212 (86%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP   RL SK++      QC SKRLEVAEFSGLR S     +  EASF D VAAQ+T 
Sbjct  10   SRIPVAQRLQSKSAVHSFPAQCSSKRLEVAEFSGLRMSS----NGGEASFFDAVAAQITA  65

Query  224  KATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA  A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKIIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYV+GV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVMGV  217



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 180/212 (85%), Gaps = 10/212 (5%)
 Frame = +2

Query  56   SRIPTRTRLPSKTST----PQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTP  223
            SRIP   RL SK++      Q  SKRLEVAEFSGLR S        EASF D VAAQ+ P
Sbjct  10   SRIPVTQRLQSKSAIHSFPAQWSSKRLEVAEFSGLRMSSI----GGEASFFDAVAAQIIP  65

Query  224  KA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
            KA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HL
Sbjct  66   KAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHL  125

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDG  577
            LKYDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDG
Sbjct  126  LKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDG  185

Query  578  PGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  186  PGAGKHIQAGASKVIITAPAKGADIPTYVVGV  217



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   324 bits (830),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 161/189 (85%), Positives = 173/189 (92%), Gaps = 3/189 (2%)
 Frame = +2

Query  116  KRLEVAEFSGLRSSGCVTFSNR--EASFSDVVAAQLTPK-ATGAPVKGVTVAKLKVAING  286
            +RLEVAEFSGLR+S CVT++    E SF DVVA+QL PK A   PV+  TVAKLKVAING
Sbjct  2    QRLEVAEFSGLRASSCVTYAKNASEGSFFDVVASQLAPKVAVSTPVRAETVAKLKVAING  61

Query  287  FGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETIS  466
            FGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNA+HLLKYDSMLGTFKA+VK+VDNETIS
Sbjct  62   FGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETIS  121

Query  467  VDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGA  646
            VDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGA
Sbjct  122  VDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGATKVIITAPAKGA  181

Query  647  DIPTYVVGV  673
            DIPTYVVGV
Sbjct  182  DIPTYVVGV  190



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 181/201 (90%), Gaps = 1/201 (0%)
 Frame = +2

Query  74   TRLPSKTS-TPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG  250
            +R+P+  + T QCFSKR+EV +FSGL+SS  ++F+ +E SF D VA +L   ++  PVKG
Sbjct  9    SRIPATPAFTSQCFSKRVEVGDFSGLKSSRGLSFAAKEVSFFDAVAPKLAGPSSSPPVKG  68

Query  251  VTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFK  430
             TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFK
Sbjct  69   ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFK  128

Query  431  ADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGA  610
            ADV+VVD++TISVDGK IKVVSNRDPL+LPW+D+GIDIVIEGTGVFVDGPGAGKHIQAGA
Sbjct  129  ADVQVVDSQTISVDGKLIKVVSNRDPLQLPWSDLGIDIVIEGTGVFVDGPGAGKHIQAGA  188

Query  611  KKVIITAPAKGADIPTYVVGV  673
            KKVIITAPAKGADIPTYVVGV
Sbjct  189  KKVIITAPAKGADIPTYVVGV  209



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 180/210 (86%), Gaps = 8/210 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSK--RLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA  229
            SRIP   R+ SK++     ++  RLEVA+FSGLR S     +  EASF D VAAQ+T KA
Sbjct  10   SRIPVTQRVQSKSAIHSFPAQXPRLEVADFSGLRMSS----NGGEASFFDAVAAQITAKA  65

Query  230  TGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLK  403
              A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HLLK
Sbjct  66   VTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLK  125

Query  404  YDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPG  583
            YDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPG
Sbjct  126  YDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPG  185

Query  584  AGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            AGKHIQAGA KVIITAPAKGADIPTYV+GV
Sbjct  186  AGKHIQAGASKVIITAPAKGADIPTYVMGV  215



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   314 bits (805),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 179/208 (86%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            SRIPT  RL S+ ++ Q    R++ A+FSGLR   C V+ + REASF DV+ AQL  KAT
Sbjct  10   SRIPTSARLNSRAASRQ----RVDFADFSGLRPGSCSVSTAAREASFYDVLGAQLVAKAT  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR+DSPL+V+VVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPLDVVVVNDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VD+ TISVDGKPIKVVS+RDPLKLPWA+MGIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDDTTISVDGKPIKVVSSRDPLKLPWAEMGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  186  KHIQAGAKKVIITAPAKGADIPTYVVGV  213



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 180/208 (87%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KH+QAGAKKVIITAPAKGADIPTYVVGV
Sbjct  186  KHLQAGAKKVIITAPAKGADIPTYVVGV  213



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 180/208 (87%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            +RIPT  RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPTSARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KH+QAGAKKVIITAPAKGADIPTYVVGV
Sbjct  186  KHLQAGAKKVIITAPAKGADIPTYVVGV  213



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 179/208 (86%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            SRIP   RL S+ ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSRAASKQ----RVDFADFSGLRPGSCSVSHAAREASFSDVLGSQLVARAT  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIVVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVVNDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VD+ETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDDETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  186  KHIQAGAKKVIITAPAKGADIPTYVLGV  213



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   311 bits (798),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 179/208 (86%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KH+QAGAKKVIITAPAKGADIPTYVVGV
Sbjct  186  KHLQAGAKKVIITAPAKGADIPTYVVGV  213



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   311 bits (798),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 179/208 (86%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            +RIP   RL SK ++ Q    R++ A+FSGLR   C V+ + REASFSDV+ AQL  +A+
Sbjct  10   TRIPASARLHSKAASRQ----RVDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVARAS  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEVIV+NDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVIVINDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KH+QAGAKKVIITAPAKGADIPTYVVGV
Sbjct  186  KHLQAGAKKVIITAPAKGADIPTYVVGV  213



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 178/208 (86%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKAT  232
            SRIP   RL SK ++ Q    R++ A+FSGLR   C ++ + REASFSDV+ +QL  +AT
Sbjct  10   SRIPATARLHSKAASKQ----RVDFADFSGLRPGSCSISHAAREASFSDVLGSQLVARAT  65

Query  233  GA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYD  409
            G   V+    AKLKVAINGFGRIGRNFLRCWH R++SPLEV+VVNDS GV+NA+HLLKYD
Sbjct  66   GENAVRAPAEAKLKVAINGFGRIGRNFLRCWHERENSPLEVVVVNDSGGVRNASHLLKYD  125

Query  410  SMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAG  589
            SMLGTFKADVK+VD++TISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAG
Sbjct  126  SMLGTFKADVKIVDDQTISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAG  185

Query  590  KHIQAGAKKVIITAPAKGADIPTYVVGV  673
            KHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  186  KHIQAGAKKVIITAPAKGADIPTYVLGV  213



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   306 bits (785),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/209 (75%), Positives = 178/209 (85%), Gaps = 3/209 (1%)
 Frame = +2

Query  56   SRIPTRTRLPSKT-STPQCFSKRLEVAEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKA  229
            SRIP   RL S+  ++ +   +RL+ A+FSGLR   C V+ + REASFSDV+ AQL  KA
Sbjct  10   SRIPAGARLHSRAPASSRHGVQRLDFADFSGLRPGSCSVSAAAREASFSDVLGAQLVAKA  69

Query  230  TGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKY  406
            TG   V+    AKLKVAINGFGRIGRNFLRCWHGR+DSP++V+VVNDS GV+NA+HLLKY
Sbjct  70   TGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGREDSPIDVVVVNDSGGVRNASHLLKY  129

Query  407  DSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGA  586
            DSMLGTFKADVK+VD+ TISVDGKPI VVS+RDPLKLPW ++GIDIVIEGTGVFVDGPGA
Sbjct  130  DSMLGTFKADVKIVDDTTISVDGKPITVVSSRDPLKLPWGELGIDIVIEGTGVFVDGPGA  189

Query  587  GKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GKHIQAGAKKVIITAPAKGADIPTYVVGV
Sbjct  190  GKHIQAGAKKVIITAPAKGADIPTYVVGV  218



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 177/209 (85%), Gaps = 5/209 (2%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVT--FSNREASFSDVVAAQLTPKA  229
            SRIPT      K ++ +   +RL++A+FSGLR   C     + REASFSDV+ AQL  +A
Sbjct  10   SRIPTGRLQHGKAASSKL--QRLDLADFSGLRPGSCSVSVAATREASFSDVLGAQLVARA  67

Query  230  TGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKY  406
            +G   V+    AKLKVAINGFGRIGRNFLRCWHGR++SPLEV+V+NDS GV+NA+HLLKY
Sbjct  68   SGENAVRAPAEAKLKVAINGFGRIGRNFLRCWHGRENSPLEVVVINDSGGVRNASHLLKY  127

Query  407  DSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGA  586
            DSMLGTFKADVK+VDNETISVDGK I+VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGA
Sbjct  128  DSMLGTFKADVKIVDNETISVDGKNIQVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGA  187

Query  587  GKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GKHIQAGAKKVIITAPAKGADIPTYV+GV
Sbjct  188  GKHIQAGAKKVIITAPAKGADIPTYVLGV  216



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 157/166 (95%), Gaps = 2/166 (1%)
 Frame = +2

Query  182  EASFSDVVAAQLTPKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  355
            EASF D +AAQ+TPKA G  +PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  6    EASFFDAIAAQITPKAVGTPSPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  65

Query  356  VVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMG  535
            V+NDS GVKNA+HLLKYDSMLGTFKADVK+VDNETISVDGK IKVVSNRDPLKLPWAD+G
Sbjct  66   VLNDSGGVKNASHLLKYDSMLGTFKADVKIVDNETISVDGKLIKVVSNRDPLKLPWADLG  125

Query  536  IDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            IDIVIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYVVGV
Sbjct  126  IDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVVGV  171



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 175/199 (88%), Gaps = 7/199 (4%)
 Frame = +2

Query  95   STPQCFSKRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVT  256
            S P  F KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG T
Sbjct  32   SLPSTF-KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGET  90

Query  257  VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKAD  436
            VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+
Sbjct  91   VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKAN  150

Query  437  VKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKK  616
            VKVVDN+TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGA+K
Sbjct  151  VKVVDNKTISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGARK  210

Query  617  VIITAPAKGADIPTYVVGV  673
            VIITAPAKGADIPTYVVGV
Sbjct  211  VIITAPAKGADIPTYVVGV  229



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 175/199 (88%), Gaps = 7/199 (4%)
 Frame = +2

Query  95   STPQCFSKRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVT  256
            S P  F KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG T
Sbjct  32   SLPSTF-KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGET  90

Query  257  VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKAD  436
            VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+
Sbjct  91   VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKAN  150

Query  437  VKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKK  616
            VKVVDN+TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGA+K
Sbjct  151  VKVVDNKTISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGARK  210

Query  617  VIITAPAKGADIPTYVVGV  673
            VIITAPAKGADIPTYVVGV
Sbjct  211  VIITAPAKGADIPTYVVGV  229



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   299 bits (766),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 172/192 (90%), Gaps = 6/192 (3%)
 Frame = +2

Query  116  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  277
            KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG TVAKLKVA
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGETVAKLKVA  97

Query  278  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNE  457
            INGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+VKVVDN+
Sbjct  98   INGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKANVKVVDNK  157

Query  458  TISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPA  637
            TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGA+KVIITAPA
Sbjct  158  TISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGARKVIITAPA  217

Query  638  KGADIPTYVVGV  673
            KGADIPTYVVGV
Sbjct  218  KGADIPTYVVGV  229



>gb|ABR16095.1| unknown [Picea sitchensis]
Length=229

 Score =   290 bits (741),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 167/187 (89%), Gaps = 6/187 (3%)
 Frame = +2

Query  116  KRLEVAEFSGLRS-SGCVTFSN--REASFS--DVVAAQLTPKA-TGAPVKGVTVAKLKVA  277
            KR+E++EF+GL+S SGC+T+    RE + +  D +A+Q+  KA     +KG TVAKLKVA
Sbjct  38   KRVEISEFAGLKSTSGCITYGRQARENNLNLFDALASQVVAKAGNSGAIKGETVAKLKVA  97

Query  278  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNE  457
            INGFGRIGRNFLRCWHGRKDSPLEV+VVNDS GVKNA+HLLKYDSMLGTFKA+VKVVDN+
Sbjct  98   INGFGRIGRNFLRCWHGRKDSPLEVVVVNDSGGVKNASHLLKYDSMLGTFKANVKVVDNK  157

Query  458  TISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPA  637
            TISVDGKPI VVS+RDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGA+KVIITAPA
Sbjct  158  TISVDGKPILVVSSRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGARKVIITAPA  217

Query  638  KGADIPT  658
            KGADIPT
Sbjct  218  KGADIPT  224



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  182  EASFSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  355
            EASF D VAAQ+ PKA  T  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  7    EASFFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  66

Query  356  VVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMG  535
            V+NDS GVKNA+HLLKYDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++G
Sbjct  67   VLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELG  126

Query  536  IDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            IDIVIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GV
Sbjct  127  IDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGV  172



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = +2

Query  119  RLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGR  295
            ++E+AEFSGL++S  + F+ R +A+  D V  Q++   +G  +KG T AKLKVAINGFGR
Sbjct  15   KMELAEFSGLKASSSMPFAARNDATLFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGR  74

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPL+VI VNDS GVKNA+HLLKYDSMLGTFKA+VKVVD++TISVDG
Sbjct  75   IGRNFLRCWHGRKDSPLDVIAVNDSGGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDG  134

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I VVS+RDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG DIP
Sbjct  135  KNITVVSSRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGTDIP  194

Query  656  TYVVGV  673
            TYVVGV
Sbjct  195  TYVVGV  200



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/166 (87%), Positives = 155/166 (93%), Gaps = 2/166 (1%)
 Frame = +2

Query  182  EASFSDVVAAQLTPKATGA--PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVI  355
            EASF D VAAQ+T KA  A  PV+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+
Sbjct  7    EASFFDAVAAQITAKAVTASTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVV  66

Query  356  VVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMG  535
            V+NDS GVKNA+HLLKYDSMLGTFKA+VK+VDNETISVDGK IKVVSNRDPLKLPWA++G
Sbjct  67   VLNDSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELG  126

Query  536  IDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            IDIVIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GV
Sbjct  127  IDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGV  172



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   294 bits (752),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = +2

Query  119  RLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGR  295
            ++E+AEFSGL++S  + F+ R +A+  D V  Q++   +G  +KG T AKLKVAINGFGR
Sbjct  15   KMELAEFSGLKASSSMPFAARNDATLFDTVRQQVSIVKSGGAIKGETTAKLKVAINGFGR  74

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPL+VI VNDS GVKNA+HLLKYDSMLGTFKA+VKVVD++TISVDG
Sbjct  75   IGRNFLRCWHGRKDSPLDVIAVNDSGGVKNASHLLKYDSMLGTFKANVKVVDDKTISVDG  134

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I VVS+RDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG DIP
Sbjct  135  KNIAVVSSRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGTDIP  194

Query  656  TYVVGV  673
            TYVVGV
Sbjct  195  TYVVGV  200



>gb|EYU41183.1| hypothetical protein MIMGU_mgv1a025772mg, partial [Erythranthe 
guttata]
Length=182

 Score =   280 bits (716),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 156/173 (90%), Gaps = 7/173 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTS---TPQCFSKRLEVAEFSGLRSSGCVTFS--NREASFSDVVAAQLT  220
            SRIPT TRLPSKT+   + QCFSK++EVAEFSGL+S+GCV F+  +REAS  DVVAAQLT
Sbjct  10   SRIPTSTRLPSKTTHSFSAQCFSKKVEVAEFSGLKSNGCVAFTKNSREASLFDVVAAQLT  69

Query  221  PKATG--APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAH  394
             K +G  APVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+H
Sbjct  70   TKTSGESAPVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASH  129

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIE  553
            LLKYDSMLGTFKADVK+V+NETISVDGK IKVVS+RDPLKLPWA++GIDIVIE
Sbjct  130  LLKYDSMLGTFKADVKIVNNETISVDGKLIKVVSSRDPLKLPWAELGIDIVIE  182



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 160/206 (78%), Gaps = 32/206 (16%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG  235
            SR+PT T LPS+++  Q  S        S  R+ G V                       
Sbjct  10   SRVPTTTGLPSRSTQSQAHS--------SFFRTEGSV-----------------------  38

Query  236  APVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSM  415
             PVKG TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VIVVNDS GVKNAAHLLKYDSM
Sbjct  39   -PVKGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVNDSGGVKNAAHLLKYDSM  97

Query  416  LGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKH  595
            LGTFKA VK+VDNETISVDGK IKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKH
Sbjct  98   LGTFKAAVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKH  157

Query  596  IQAGAKKVIITAPAKGADIPTYVVGV  673
            IQAGAKKVIITAPAKG+DIPTYVVGV
Sbjct  158  IQAGAKKVIITAPAKGSDIPTYVVGV  183



>gb|ABK00053.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=393

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +2

Query  116  KRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKA-TGAPVKGVTVAKLKVAING  286
            KR  + EFSGL++S  VTF  S+ E  F D VA+Q+  KA     +KG T AKL+VAING
Sbjct  9    KRSSLGEFSGLKASSAVTFGKSSSENGFFDAVASQVAVKAGASGAIKGETSAKLRVAING  68

Query  287  FGRIGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  463
            FGRIGRNFLRCWHGR D SPLEV+ VNDS GVKNAAHLLKYDSMLG FKADVKV D+ T+
Sbjct  69   FGRIGRNFLRCWHGRGDESPLEVVAVNDSGGVKNAAHLLKYDSMLGIFKADVKVGDDTTL  128

Query  464  SVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  643
             VDGKPI VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG
Sbjct  129  LVDGKPITVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  188

Query  644  ADIPTYVVGV  673
            ADIPTY++GV
Sbjct  189  ADIPTYIMGV  198



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 160/190 (84%), Gaps = 4/190 (2%)
 Frame = +2

Query  116  KRLEVAEFSGLRSSGCVTF--SNREASFSDVVAAQLTPKA-TGAPVKGVTVAKLKVAING  286
            KR  + EFSGL++S  VTF  S+ E  F D VA+Q+  KA     +KG T AKL+VAING
Sbjct  38   KRSSLGEFSGLKASSAVTFGKSSSENGFFDAVASQVAVKAGASGAIKGETSAKLRVAING  97

Query  287  FGRIGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  463
            FGRIGRNFLRCWHGR D SPLEV+ VNDS GVKNAAHLLKYDSMLG FKADVKV D+ T+
Sbjct  98   FGRIGRNFLRCWHGRGDESPLEVVAVNDSGGVKNAAHLLKYDSMLGIFKADVKVGDDTTL  157

Query  464  SVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  643
             VDGKPI VVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG
Sbjct  158  LVDGKPITVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  217

Query  644  ADIPTYVVGV  673
            ADIPTYV+GV
Sbjct  218  ADIPTYVMGV  227



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +2

Query  128  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +AEFSG++S  CVTF  R    S +VAAQ    A+    + VT AK+KVAINGFGRIGRN
Sbjct  19   LAEFSGMKSVNCVTFEKRSDDLSTIVAAQTVVAASSGASRAVTEAKIKVAINGFGRIGRN  78

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            F+RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N+ ISVDGK IK
Sbjct  79   FIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNADVKVEGNDAISVDGKVIK  138

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+PL LPW +MGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KGA IPTYVV
Sbjct  139  VVSDRNPLNLPWGEMGIDLVIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGA-IPTYVV  197

Query  668  GV  673
            GV
Sbjct  198  GV  199



>gb|ACJ85309.1| unknown [Medicago truncatula]
Length=229

 Score =   261 bits (668),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 149/170 (88%), Gaps = 6/170 (4%)
 Frame = +2

Query  56   SRIPTRTRLPSKTSTP---QCFSKRLEVAEFSGLRSSGCVTFSN--REASFSDVVAAQLT  220
            +RIPT TR PSK S     QC S+RLEVAEFSGL+S+ C+T+++  RE+SFSDVVAAQL 
Sbjct  10   TRIPTSTRFPSKASHSFPTQCASRRLEVAEFSGLKSTSCITYASNARESSFSDVVAAQLA  69

Query  221  PKATGA-PVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHL  397
             KA G+  V+G TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDS GVKNA+HL
Sbjct  70   TKAIGSTAVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSGGVKNASHL  129

Query  398  LKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIV  547
            LKYDSMLGTFKADVK+++N TI+VDGKPI VVS+RDPLKLPWA++GIDIV
Sbjct  130  LKYDSMLGTFKADVKILNNGTITVDGKPILVVSSRDPLKLPWAELGIDIV  179



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   264 bits (675),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/132 (95%), Positives = 131/132 (99%), Gaps = 0/132 (0%)
 Frame = +2

Query  278  INGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNE  457
            INGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVKNA+HLLKYDSMLGTFKADVKVVDNE
Sbjct  1    INGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKVVDNE  60

Query  458  TISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPA  637
            TISVDGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPA
Sbjct  61   TISVDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPA  120

Query  638  KGADIPTYVVGV  673
            KGADIPTYVVGV
Sbjct  121  KGADIPTYVVGV  132



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/137 (91%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVNDS GVK+A HLLKYDS+LGTFKADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVK  60

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
            ++DNET S+DGKPIKVVSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVI
Sbjct  61   IIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  120

Query  623  ITAPAKGADIPTYVVGV  673
            ITAPAKG+DIPTYVVGV
Sbjct  121  ITAPAKGSDIPTYVVGV  137



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 132/137 (96%), Gaps = 0/137 (0%)
 Frame = +2

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFG IGRNFLRCWHGRKDSPLEV+V+NDS GVKNA+HLLKYDSMLGTFKADVK
Sbjct  1    KLKVAINGFGGIGRNFLRCWHGRKDSPLEVVVLNDSGGVKNASHLLKYDSMLGTFKADVK  60

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
            +VDNETISVDGK IKVVSNRDPLKLPWA +GIDIVIEGTGVFVDGPGAGKHIQAGA KVI
Sbjct  61   IVDNETISVDGKLIKVVSNRDPLKLPWAGLGIDIVIEGTGVFVDGPGAGKHIQAGASKVI  120

Query  623  ITAPAKGADIPTYVVGV  673
            ITAPAKGADIPTYVVGV
Sbjct  121  ITAPAKGADIPTYVVGV  137



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 153/198 (77%), Gaps = 3/198 (2%)
 Frame = +2

Query  86   SKTSTP--QCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTV  259
            S T+ P   C  K    +EFSG++S+  VTF  R    + +V AQ    A+    + VT 
Sbjct  2    SATAFPAASCAVKASGFSEFSGIKSTNSVTFGKRHDDLTTIVTAQSAVAASSGAKRAVTE  61

Query  260  AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADV  439
            AK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADV
Sbjct  62   AKIKVAINGFGRIGRNFVRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFDADV  121

Query  440  KVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  619
            KV  N+ ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKHIQAGAKKV
Sbjct  122  KVEGNDAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQAGAKKV  181

Query  620  IITAPAKGADIPTYVVGV  673
            +ITAP KGA IPTYVVGV
Sbjct  182  LITAPGKGA-IPTYVVGV  198



>emb|CBI21236.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   256 bits (653),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (83%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  295
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDG
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG  139

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  140  KVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIP  198

Query  656  TYVVGV  673
            TYVVGV
Sbjct  199  TYVVGV  204



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   261 bits (668),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 151/190 (79%), Gaps = 8/190 (4%)
 Frame = +2

Query  128  VAEFSGLRSSGCVTF---SNREAS-----FSDVVAAQLTPKATGAPVKGVTVAKLKVAIN  283
            + E+ GL++S    F   + R+A+     F D V   ++ K  G+  +G T AKL+VAIN
Sbjct  58   LCEYKGLKASTAHVFGGVTGRDAADASDLFVDSVTRDVSSKVIGSGHRGETEAKLRVAIN  117

Query  284  GFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETI  463
            GFGRIGRNFLRCWHGR DSPLEVI +NDS GVK A HLLKYDSMLGTF ADVK VD   I
Sbjct  118  GFGRIGRNFLRCWHGRPDSPLEVIAINDSGGVKQATHLLKYDSMLGTFNADVKTVDETHI  177

Query  464  SVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  643
            SVDGK I++VSNRDPLKLPWA++GIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG
Sbjct  178  SVDGKVIQIVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  237

Query  644  ADIPTYVVGV  673
            ++IPTY VGV
Sbjct  238  SEIPTYAVGV  247



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   256 bits (654),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 155/185 (84%), Gaps = 6/185 (3%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKA-TGAPVKGVTVAKLKVAINGFGRI  298
            AEFSGLR SS C++F NR+ S  F  VVA Q +  + +G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSVGSNSGGYRKGVTEAKLKVAINGFGRI  79

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDGK  139

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  140  VIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIPT  198

Query  659  YVVGV  673
            YVVGV
Sbjct  199  YVVGV  203



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   256 bits (654),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (83%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  295
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDG
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG  139

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  140  KVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIP  198

Query  656  TYVVGV  673
            TYVVGV
Sbjct  199  TYVVGV  204



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 153/182 (84%), Gaps = 5/182 (3%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  307
            A F+GL+++   +  + + +F    AA+L P +ATG+  K VT AKLKVAINGFGRIGRN
Sbjct  7    ANFTGLKATSLFSAKSADEAF----AARLAPVQATGSSQKQVTEAKLKVAINGFGRIGRN  62

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCW GR++SPLEV+ +NDS GVK AAHLLKYDSMLGTFKADVKV+    ++V+GK I+
Sbjct  63   FLRCWVGRENSPLEVVAINDSGGVKQAAHLLKYDSMLGTFKADVKVISETALAVNGKTIE  122

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            +VS+RDPL+LPWA MG+D+VIEGTGVF+DGPGAGKHI AGAKKV+ITAPAKGA+IPTYVV
Sbjct  123  IVSSRDPLQLPWAKMGVDLVIEGTGVFIDGPGAGKHIIAGAKKVLITAPAKGAEIPTYVV  182

Query  668  GV  673
            GV
Sbjct  183  GV  184



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 154/186 (83%), Gaps = 7/186 (4%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGR  295
            AEFSGLR SS C++F NR+ S  F  VVA Q +     +G   KGVT AKLKVAINGFGR
Sbjct  21   AEFSGLRNSSACLSF-NRKTSDDFLSVVAFQTSAVGSNSGGYRKGVTEAKLKVAINGFGR  79

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPL+VIVVND+ GVK A+HLLKYDS+LGTF+ADVK V ++ ISVDG
Sbjct  80   IGRNFLRCWHGRKDSPLDVIVVNDTGGVKQASHLLKYDSILGTFEADVKAVGDDAISVDG  139

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K IK+VS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  140  KVIKIVSSRNPLDLPWGDLDIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIP  198

Query  656  TYVVGV  673
            TYVVGV
Sbjct  199  TYVVGV  204



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   251 bits (641),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  68   TRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVK  247
            T   +PS  S     SK L  +EFSG++S+  VTF  R    + +VAAQ    A+    +
Sbjct  7    TAVSVPSNASLKVAGSKGL--SEFSGMKSTNAVTFGKRSDDLASIVAAQSAVSASSGATR  64

Query  248  GVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTF  427
             VT AK+KVAINGFGRIGRNF+RCW GRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF
Sbjct  65   AVTEAKIKVAINGFGRIGRNFIRCWQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTF  124

Query  428  KADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAG  607
             ADVKV  N  ISVDGK IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKHIQAG
Sbjct  125  NADVKVEGNNAISVDGKVIKVVSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQAG  184

Query  608  AKKVIITAPAKGADIPTYVVGV  673
            AKKV+ITAP KGA IPT+VVGV
Sbjct  185  AKKVLITAPGKGA-IPTFVVGV  205



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  307
            ++FSGL+S   VTF       +  VAAQ     ++G   + V  AK+KVAINGFGRIGRN
Sbjct  22   SDFSGLKSKNAVTFGRGAEDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRN  81

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            F+RCWHGRKDSPL+VIV+ND+ GVK A+HLLKYDSMLGTF ADVKV  +  ISVDGK IK
Sbjct  82   FIRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIK  141

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVSNRDPLKLPW ++G+D+VIEGTGVFVD  GAGKH++AGAKKV+ITAP KGA IPTYVV
Sbjct  142  VVSNRDPLKLPWGELGVDLVIEGTGVFVDQEGAGKHLKAGAKKVLITAPGKGA-IPTYVV  200

Query  668  GV  673
            GV
Sbjct  201  GV  202



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 146/182 (80%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRN  307
            ++FSGL+S   VTF       +  VAAQ     ++G   + V  AK+KVAINGFGRIGRN
Sbjct  22   SDFSGLKSKNAVTFGRGAEDLASRVAAQTCKVSSSGGAKRAVAEAKIKVAINGFGRIGRN  81

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            F+RCWHGRKDSPL+VIV+ND+ GVK A+HLLKYDSMLGTF ADVKV  +  ISVDGK IK
Sbjct  82   FIRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSMLGTFDADVKVSGDSAISVDGKVIK  141

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVSNRDPLKLPW ++G+D+VIEGTGVFVD  GAGKH++AGAKKV+ITAP KGA IPTYVV
Sbjct  142  VVSNRDPLKLPWGELGVDLVIEGTGVFVDQEGAGKHLKAGAKKVLITAPGKGA-IPTYVV  200

Query  668  GV  673
            GV
Sbjct  201  GV  202



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 1/181 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  310
            ++FSG++S+  VTF  R    + +V+AQ    A+    + VT AK+KVAINGFGRIGRNF
Sbjct  26   SDFSGIKSTSAVTFGKRSEDLASIVSAQSAVSASSGAKRAVTEAKIKVAINGFGRIGRNF  85

Query  311  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  490
            +RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N+ ISVDGK IKV
Sbjct  86   VRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFDADVKVEGNDAISVDGKVIKV  145

Query  491  VSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVG  670
            VS+R+PL LPW DM ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KGA IPTYVVG
Sbjct  146  VSDRNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGA-IPTYVVG  204

Query  671  V  673
            V
Sbjct  205  V  205



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 150/184 (82%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSDIISVDGKE  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   249 bits (636),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 150/184 (82%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSDIISVDGKE  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 149/184 (81%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSNVISVDGKE  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 149/184 (81%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSNVISVDGKE  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 149/184 (81%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREAS-FSDVVAAQ-LTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLRSS G + FS + +  F  V+A Q     ++G   KGVT AKLKVAINGFGRIG
Sbjct  21   SEFSGLRSSSGFLPFSRKSSEDFHSVIAFQTYAVGSSGGYKKGVTEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS+LGTF ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSILGTFDADVKPVGSNVISVDGKE  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   249 bits (635),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR+S  +TF+ + +  F  V+A Q +      G   KGV  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSASLTFARKTSDDFQSVIAFQTSALGINNGGYRKGVVEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNAISVDGKV  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPVNLPWKDLGIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +2

Query  209  AQLTP-KATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKN  385
            A+L P +ATG+  K VT AKLKVAINGFGRIGRNFLRCW GR++SPLEV+ +NDS GVK 
Sbjct  1    ARLAPVQATGSSQKQVTEAKLKVAINGFGRIGRNFLRCWVGRENSPLEVVAINDSGGVKQ  60

Query  386  AAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGV  565
            AAHLLKYDSMLGTFKADVKV+    ++V+GK I++VS+RDPL+LPWA MG+D+VIEGTGV
Sbjct  61   AAHLLKYDSMLGTFKADVKVISETALAVNGKTIEIVSSRDPLQLPWAKMGVDLVIEGTGV  120

Query  566  FVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            F+DGPGAGKHI AGAKKV+ITAPAKGA+IPTYVVGV
Sbjct  121  FIDGPGAGKHIIAGAKKVLITAPAKGAEIPTYVVGV  156



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   246 bits (628),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 147/183 (80%), Gaps = 3/183 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  304
            AEFSGLR+S  V+F  + +  F  V+A Q +   + G   KGV  AKLKVAINGFGRIGR
Sbjct  21   AEFSGLRNSASVSFGRKNSEDFLSVIAFQTSAVGSNGGYRKGVVEAKLKVAINGFGRIGR  80

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL++I +ND+ G+K A+HLLKYDS LG F+ADVK V  + ISVDGK I
Sbjct  81   NFLRCWHGRKDSPLDIIAINDTGGIKQASHLLKYDSTLGIFEADVKPVGTDGISVDGKVI  140

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW +MGID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV
Sbjct  141  KVVSDRNPLNLPWKEMGIDLVIEGTGVFVDRDGAGKHIEAGAKKVLITAPGKG-DIPTYV  199

Query  665  VGV  673
            VGV
Sbjct  200  VGV  202



>emb|CAC80390.1| glyceraldehyde-3-phosphate dehydrogenase [Coleochaete scutata]
Length=317

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  281  NGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNET  460
            NGFGRIGRNFLRCW+ R+DSP+EV+ +NDS GVKNAAHLLKYDSMLGTFKA+VK +D++T
Sbjct  1    NGFGRIGRNFLRCWYEREDSPIEVVAINDSGGVKNAAHLLKYDSMLGTFKAEVKAIDDKT  60

Query  461  ISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAK  640
            +SV GKPI VVSNRDPLKLPWAD+GIDIVIEGTGVF+DGPGAGKHIQAGAKKVIITAPAK
Sbjct  61   LSVGGKPITVVSNRDPLKLPWADLGIDIVIEGTGVFIDGPGAGKHIQAGAKKVIITAPAK  120

Query  641  GADIPTYVVGV  673
            GADIPTYVVGV
Sbjct  121  GADIPTYVVGV  131



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 144/182 (79%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +EFSGLRSS  + FS + +  F  VVA Q +        +GV  AK+KVAINGFGRIGRN
Sbjct  18   SEFSGLRSSASIPFSRKPSEDFLSVVAFQTSVVWGSGYKRGVVEAKIKVAINGFGRIGRN  77

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVKV   + ISVDGK I+
Sbjct  78   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKVAGVDAISVDGKVIR  137

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  138  VVSNRNPVNLPWKDLGIDLVIEGTGVFVDKEGAGKHIQAGAKKVLITAPGKG-DIPTYVV  196

Query  668  GV  673
            GV
Sbjct  197  GV  198



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFL  313
            +FSGL+S+   TF  R       VAAQ     +GA  + V  AK+KVAINGFGRIGRNF+
Sbjct  20   DFSGLKSTSVATFGKRSDDLLTRVAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFI  79

Query  314  RCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVV  493
            RCWHGRKDSPLEV+V+ND+ GVK A+HLLKYDSMLG F A VK V ++ ISVDGK IK+V
Sbjct  80   RCWHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGIFDAYVKAVGDDAISVDGKIIKIV  139

Query  494  SNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            S+R+PL LPW +MG+D+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG  IPTYV+GV
Sbjct  140  SDRNPLNLPWGEMGVDLVIEGTGVFVDKEGAGKHLQAGAKKVLITAPGKGP-IPTYVIGV  198



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  304
            +EFSGLR SS  + F+ R    F  V+A Q +    G   +GV  AKLKVAINGFGRIGR
Sbjct  18   SEFSGLRGSSSALPFAKRANDDFVSVIAFQTSVVGGGKNKRGVVEAKLKVAINGFGRIGR  77

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V N+ ISVDGK I
Sbjct  78   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGNDGISVDGKVI  137

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+P  LPW DMGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  138  KVVSDRNPSNLPWKDMGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYV  196

Query  665  VGV  673
            VGV
Sbjct  197  VGV  199



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 154/198 (78%), Gaps = 3/198 (2%)
 Frame = +2

Query  80   LPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTV  259
            +PS  S     SK    +EFSG++S+   TF  +    + +VAAQ    A+    + VT 
Sbjct  11   VPSTASLKGAGSKGF--SEFSGMKSTSIATFGKQIDDLASIVAAQSAVSASSGASRAVTE  68

Query  260  AKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADV  439
            AK+KVAINGFGRIGRNF+RCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADV
Sbjct  69   AKIKVAINGFGRIGRNFIRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNADV  128

Query  440  KVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKV  619
            KV  N+ ISVDGK IKVVS+R+PL LPW +MGID+VIEGTGVFVD  GAGKHIQAGAKKV
Sbjct  129  KVEGNDAISVDGKVIKVVSDRNPLNLPWGEMGIDLVIEGTGVFVDEAGAGKHIQAGAKKV  188

Query  620  IITAPAKGADIPTYVVGV  673
            +ITAP KGA IPTYVVGV
Sbjct  189  LITAPGKGA-IPTYVVGV  205



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKI  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKI  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 146/185 (79%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS---FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  298
            +EFSGLRSS       R+AS   F  V+A Q +   ++G   KGV  AKLKVAINGFGRI
Sbjct  21   SEFSGLRSSTASLPFARKASSDDFLSVIAFQTSAVGSSGGYKKGVVEAKLKVAINGFGRI  80

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ G+K A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGGIKQASHLLKYDSTLGIFNADVKPVGTDGISVDGK  140

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  141  VIKVVSNRNPVNLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPT  199

Query  659  YVVGV  673
            YVVGV
Sbjct  200  YVVGV  204



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   243 bits (621),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNNKRGVVEAKLKVAINGFGRIGRN  80

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  140

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  141  VVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  199

Query  668  GV  673
            GV
Sbjct  200  GV  201



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   243 bits (620),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 142/181 (78%), Gaps = 2/181 (1%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  310
            +FSGLR+S  + FS + +  F  V+A Q +        KG   AKLKVAINGFGRIGRNF
Sbjct  22   DFSGLRNSASLPFSRKTSEDFLSVIAFQTSAVGNSGYRKGAAEAKLKVAINGFGRIGRNF  81

Query  311  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  490
            LRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F A+VK V +  ISVDGK IKV
Sbjct  82   LRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDANVKPVGDNAISVDGKVIKV  141

Query  491  VSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVG  670
            V+NR+PL LPW D+G+D+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVVG
Sbjct  142  VTNRNPLDLPWGDLGVDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIPTYVVG  200

Query  671  V  673
            V
Sbjct  201  V  201



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 143/178 (80%), Gaps = 1/178 (1%)
 Frame = +2

Query  140  SGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRC  319
            SG++S+  VTF  R    + +VAAQ    A+    + VT AK+KVAINGFGRIGRNF+RC
Sbjct  1    SGMKSTNAVTFGKRSDDLASIVAAQSAVSASSGATRAVTEAKIKVAINGFGRIGRNFIRC  60

Query  320  WHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSN  499
            W GRKDSPL+V+V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N  ISVDGK IKVVS+
Sbjct  61   WQGRKDSPLDVVVINDTGGVKQASHLLKYDSMLGTFNADVKVEGNNAISVDGKVIKVVSD  120

Query  500  RDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            R+PL LPW DM ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KGA IPT+VVGV
Sbjct  121  RNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGA-IPTFVVGV  177



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 147/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  304
            EFSGLR SS  ++F+ R +  F  V+A Q +   ++G   KG+  AKLKVAINGFGRIGR
Sbjct  22   EFSGLRNSSTSLSFARRTSDDFLSVIAFQTSAVGSSGGYKKGIVEAKLKVAINGFGRIGR  81

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK I
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKII  141

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW DM ID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV
Sbjct  142  KVVSSRNPLNLPWKDMEIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYV  200

Query  665  VGV  673
            VGV
Sbjct  201  VGV  203



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 129/144 (90%), Gaps = 1/144 (1%)
 Frame = +2

Query  245  KGVTVAKLKVAINGFGRIGRNFLRCWHGR-KDSPLEVIVVNDSAGVKNAAHLLKYDSMLG  421
            K  T  KL+VAINGFGRIGRNFLRCWHGR  DSPLEVI +NDS GVK A HLLKYDSMLG
Sbjct  81   KQETTMKLRVAINGFGRIGRNFLRCWHGRGDDSPLEVIAINDSGGVKQATHLLKYDSMLG  140

Query  422  TFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQ  601
            TF A+V ++D +TISVDGKPI +VSNRDP +LPWA++GID+VIEGTGVFVDGPGAGKH+Q
Sbjct  141  TFNANVGIIDEKTISVDGKPITIVSNRDPAQLPWAELGIDLVIEGTGVFVDGPGAGKHLQ  200

Query  602  AGAKKVIITAPAKGADIPTYVVGV  673
            AGAKKV+ITAPAKGA+IPTYVVGV
Sbjct  201  AGAKKVLITAPAKGAEIPTYVVGV  224



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  12   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRN  71

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  72   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  131

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  132  VVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  190

Query  668  GV  673
            GV
Sbjct  191  GV  192



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 146/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  304
            EFSGLR SS C+ F+ R +  F  ++A Q +   + G   KG+  AKLKVAINGFGRIGR
Sbjct  23   EFSGLRNSSTCLPFARRTSDDFLSIIAFQTSAVGSNGGYKKGIVEAKLKVAINGFGRIGR  82

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK I
Sbjct  83   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKII  142

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV
Sbjct  143  KVVSSRNPLNLPWKDLEIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYV  201

Query  665  VGV  673
            VGV
Sbjct  202  VGV  204



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 146/183 (80%), Gaps = 4/183 (2%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  304
            EFSGLR SS C+ F+ R +  F  ++A Q +   + G   KG+  AKLKVAINGFGRIGR
Sbjct  22   EFSGLRNSSTCLPFARRTSDDFLSIIAFQTSAVGSNGGYKKGIVEAKLKVAINGFGRIGR  81

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +E ISVDGK I
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDEAISVDGKII  141

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYV
Sbjct  142  KVVSSRNPLNLPWKDLEIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIPTYV  200

Query  665  VGV  673
            VGV
Sbjct  201  VGV  203



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F+ R +S  F   V+ Q +  ++ G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMRSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNSKRGVVEAKLKVAINGFGRIGRN  80

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  140

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  141  VVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  199

Query  668  GV  673
            GV
Sbjct  200  GV  201



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 147/185 (79%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLR--SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  298
            +EFSGLR  SS  + FS + +  F  +++ Q +   ++G   KGVT AKLKVAINGFGRI
Sbjct  22   SEFSGLRNSSSSYLPFSRKTSDDFHSIISFQTSAVGSSGGYRKGVTEAKLKVAINGFGRI  81

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  82   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGEDAISVDGK  141

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVSNR+P  LPW ++G+D+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  142  VIKVVSNRNPANLPWKELGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPT  200

Query  659  YVVGV  673
            YVVGV
Sbjct  201  YVVGV  205



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 142/182 (78%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +EFSGLR+S  + F  +       VVA Q +    G   +GV  AKLKVAINGFGRIGRN
Sbjct  21   SEFSGLRTSSAIPFGRKTNDDLLSVVAFQTSVIGGGNNKRGVVEAKLKVAINGFGRIGRN  80

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  81   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  140

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  141  VVSDRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  199

Query  668  GV  673
            GV
Sbjct  200  GV  201



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F+ R +S  F   V+ Q +   + GA  KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKRSSSDEFVSFVSFQTSAMGSNGAYRKGVTEAKIKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>emb|CDP18560.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 141/181 (78%), Gaps = 2/181 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNF  310
            +EF+GLRSS              VVA Q +    G   +GV  AKLKVAINGFGRIGRNF
Sbjct  21   SEFAGLRSSSLPFARKASDDLLSVVAFQTSVIGGGKNKRGVVEAKLKVAINGFGRIGRNF  80

Query  311  LRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKV  490
            LRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F+ADVK  D E ISVDGK IKV
Sbjct  81   LRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFEADVKPAD-EGISVDGKVIKV  139

Query  491  VSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVG  670
            V+NR+P+ LPW +MGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV+G
Sbjct  140  VTNRNPVNLPWGEMGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVIG  198

Query  671  V  673
            V
Sbjct  199  V  199



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  304
            ++FSGLR SS  + F+ + +  F  V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  21   SDFSGLRISSASLPFARKTSDDFLSVIAFQTSAVGGSGQKRGVVEAKLKVAINGFGRIGR  80

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F+ADVK   ++ ISVDGK I
Sbjct  81   NFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFEADVKPAGDDAISVDGKII  140

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVSNR+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  141  KVVSNRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYV  199

Query  665  VGV  673
            VGV
Sbjct  200  VGV  202



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 142/176 (81%), Gaps = 1/176 (1%)
 Frame = +2

Query  146  LRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWH  325
            ++S+  VTF  R    + +V+AQ    A+    + VT AK+KVAINGFGRIGRNF+RCWH
Sbjct  1    MKSTNAVTFGKRSDDLATIVSAQSAVAASSGATRAVTEAKIKVAINGFGRIGRNFVRCWH  60

Query  326  GRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRD  505
            GRKDSPL+++V+ND+ GVK A+HLLKYDSMLGTF ADVKV  N+ ISVDGK IKVVS+R+
Sbjct  61   GRKDSPLDIVVINDTGGVKQASHLLKYDSMLGTFDADVKVEGNDAISVDGKVIKVVSDRN  120

Query  506  PLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            PL LPW DM ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG  IPTYVVGV
Sbjct  121  PLNLPWGDMDIDLVIEGTGVFVDEAGAGKHIQAGAKKVLITAPGKGP-IPTYVVGV  175



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNR-EASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  304
            +EFSGLRSS   + F  R    F  V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  14   SEFSGLRSSSAALPFPRRPNDDFFSVIAFQTSSVGGDKNSRGVVEAKLKVAINGFGRIGR  73

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V N+ ISVDGK I
Sbjct  74   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGNDAISVDGKVI  133

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVV++R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  134  KVVTDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYV  192

Query  665  VGV  673
            VGV
Sbjct  193  VGV  195



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   241 bits (614),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 145/186 (78%), Gaps = 8/186 (4%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  295
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  139  KVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIP  197

Query  656  TYVVGV  673
            TYVVGV
Sbjct  198  TYVVGV  203



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 145/186 (78%), Gaps = 8/186 (4%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  295
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  139  KVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIP  197

Query  656  TYVVGV  673
            TYVVGV
Sbjct  198  TYVVGV  203



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 149/191 (78%), Gaps = 4/191 (2%)
 Frame = +2

Query  107  CFSKRLEVAEFSGLRSSGCVTF-SNREASFSDVVAAQLTPKATGAPVKGVTVAK-LKVAI  280
            C  ++  + EF+G +++G +   +N+  S +  VAAQ T    G+  K VT AK + VAI
Sbjct  6    CACQQAALNEFTGFKAAGALRLGNNQNQSLAARVAAQATTGTVGS--KQVTQAKKINVAI  63

Query  281  NGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNET  460
            NGFGRIGRNFLRC  GR++S L + V+NDS GVK A+HLLKYDS LGTF AD+KV+D+ T
Sbjct  64   NGFGRIGRNFLRCVEGRENSNLNITVINDSGGVKQASHLLKYDSTLGTFNADIKVIDDST  123

Query  461  ISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAK  640
            +SV+GK IK+VSNRDPL+LPW +MGID+VIEGTGVFV   GAGKHI+AGAKKV+ITAPAK
Sbjct  124  VSVNGKQIKIVSNRDPLQLPWGEMGIDLVIEGTGVFVSSDGAGKHIKAGAKKVLITAPAK  183

Query  641  GADIPTYVVGV  673
            G DIPTYV+GV
Sbjct  184  GNDIPTYVIGV  194



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 152/197 (77%), Gaps = 9/197 (5%)
 Frame = +2

Query  98   TPQCFSKRLEVAEFSGLRSSGCVT--FSNREAS--FSDVVAAQLTPKAT-GAPVKGVTVA  262
            +PQ   K    AEF+GLR+S   +  F  R +   FS V+A Q +   T G   +G+T A
Sbjct  12   SPQANGKGF--AEFAGLRNSSAASLCFGRRTSDDLFS-VIAFQTSAVGTNGGYKRGITEA  68

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F A+VK
Sbjct  69   KLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDAEVK  128

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
             V ++ ISVDGK IKVVS+R+PL LPW DMGID+VIEGTGVFVD  GAGKHI+AGAKKV+
Sbjct  129  PVGDDGISVDGKVIKVVSSRNPLNLPWKDMGIDLVIEGTGVFVDREGAGKHIEAGAKKVL  188

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  189  ITAPGKG-DIPTYVVGV  204



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLR SS  + F  + +  F  VVA Q +   +  G   KGV  AKLKVAINGFGRIG
Sbjct  22   EFSGLRNSSSSLPFPRKTSDDFLSVVAFQTSALGSNNGGYRKGVVEAKLKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   ++ ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPAGDDAISVDGKI  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  142  IKVVSNRNPVNLPWKDLGIDLVIEGTGVFVDSDGAGKHIQAGAKKVLITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 145/186 (78%), Gaps = 8/186 (4%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  295
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  139  KVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIP  197

Query  656  TYVVGV  673
            TYVVGV
Sbjct  198  TYVVGV  203



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR SS C+ F  + +   FS +        ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVISFQTSAVGSSGGYKKGIAEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGISVDGKV  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKHLQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA----TGAPVKGVTVAKLKVAINGFGRI  298
            +EFSGLRSS  + F+ + +S   V       KA     G   KGVT AK+KVAINGFGRI
Sbjct  19   SEFSGLRSSSGLPFAKKPSSDEFVSFVTFQTKALGNNNGGYRKGVTEAKIKVAINGFGRI  78

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK AAHLLKYDS LG F ADVK   ++ +SVDGK
Sbjct  79   GRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDSTLGIFDADVKPSGDKALSVDGK  138

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             I+VVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  139  IIQVVSDRNPANLPWKDLGIDLVIEGTGVFVDQEGAGKHIQAGAKKVLITAPGKG-DIPT  197

Query  659  YVVGV  673
            YVVGV
Sbjct  198  YVVGV  202



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 145/186 (78%), Gaps = 8/186 (4%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKATGAPVKG----VTVAKLKVAINGFGR  295
            +EFSGLR+S  + F  + +  F  V+A Q +  A G+   G       AKLKVAINGFGR
Sbjct  21   SEFSGLRNSASLPFGRKSSDDFHSVIALQTS--ALGSSSSGYRKVAAQAKLKVAINGFGR  78

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRKDSPLEV+ +ND+ GVK A+HLLKYDS LG F+ADVK V  + ISVDG
Sbjct  79   IGRNFLRCWHGRKDSPLEVVAINDTGGVKQASHLLKYDSTLGIFEADVKPVGTDGISVDG  138

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I+VVSNR+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIP
Sbjct  139  KVIQVVSNRNPVNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIP  197

Query  656  TYVVGV  673
            TYVVGV
Sbjct  198  TYVVGV  203



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG--APVKGVTVAKLKVAINGFGRIGR  304
            +EF+GL +S  + F+ R +     + A  T    G  +   GV  AKLKVAINGFGRIGR
Sbjct  21   SEFAGLHTS-SLPFARRGSDDLVALVAFQTNALAGKRSTQNGVVEAKLKVAINGFGRIGR  79

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPLEV+V+NDS GVK A+HLLKYDS+LGTF ADVK   N+ ISVDGK I
Sbjct  80   NFLRCWHGRKDSPLEVVVINDSGGVKQASHLLKYDSILGTFDADVKPEGNDAISVDGKVI  139

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  140  KVVSDRNPLNLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYV  198

Query  665  VGV  673
            VGV
Sbjct  199  VGV  201



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   239 bits (609),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  304
            +EFSGLR+S       R+AS     V+A Q +        +GV  AKLKVAINGFGRIGR
Sbjct  21   SEFSGLRNSSASLPFARKASDDLLSVIAFQTSVVGGNGQKRGVVEAKLKVAINGFGRIGR  80

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +  ISVDGK I
Sbjct  81   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDNAISVDGKII  140

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  141  KVVSDRNPVNLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYV  199

Query  665  VGV  673
            VGV
Sbjct  200  VGV  202



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKFSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW +MGIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSNLPWKEMGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I++VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IQIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR SS C+ F  + +   FS +        ++G   KG+  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVISFQTSAVGSSGGYKKGIAEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPAGDNGISVDGKV  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKHLQAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG-VTVAKLKVAINGFGRIGRN  307
            +EFSGLR+S  V F  +       VA   T    G   K  VT AKLKVAINGFGRIGRN
Sbjct  19   SEFSGLRTSSAVPFGRKTNDDLFSVAGLQTSAIGGRKNKRIVTEAKLKVAINGFGRIGRN  78

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  79   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKIIQ  138

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVSNRDP+ LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  139  VVSNRDPVNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  197

Query  668  GV  673
            GV
Sbjct  198  GV  199



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = +2

Query  140  SGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRC  319
            SG++++  VTF  R      VVAAQ    A+    + VT AK++VAINGFGRIGRNF+RC
Sbjct  1    SGIKNTNAVTFGKRTDDLVSVVAAQSAVSASSGATRAVTEAKIRVAINGFGRIGRNFVRC  60

Query  320  WHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSN  499
            WHGRKDSPLEV+V+ND+ GVK A+HLLKYDSMLGTF ADVK VD + ISVDGK IKVVS+
Sbjct  61   WHGRKDSPLEVVVINDTGGVKQASHLLKYDSMLGTFNADVK-VDGDGISVDGKTIKVVSD  119

Query  500  RDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            R+PL LPW DM ID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KGA IPTYV+GV
Sbjct  120  RNPLNLPWGDMDIDLVIEGTGVFVDEAGAGKHLQAGAKKVLITAPGKGA-IPTYVIGV  176



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 143/183 (78%), Gaps = 4/183 (2%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIGR  304
            EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIGR
Sbjct  18   EFSGLRNSSALPFAKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIGR  77

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK I
Sbjct  78   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKII  137

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            K+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  138  KIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYV  196

Query  665  VGV  673
             GV
Sbjct  197  CGV  199



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   238 bits (607),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I++VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IQIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            V GV
Sbjct  196  VCGV  199



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   238 bits (607),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 142/184 (77%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYSKGVTEAKLKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            V GV
Sbjct  196  VCGV  199



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 143/185 (77%), Gaps = 4/185 (2%)
 Frame = +2

Query  128  VAEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  298
            +AEFSGLR SS C+ F  + +   FS +        + G   KGVT AKLKVAINGFGRI
Sbjct  20   LAEFSGLRTSSACLPFGKKTSDDLFSVITFQTSALGSNGGYKKGVTEAKLKVAINGFGRI  79

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGK  139

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             +KVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH+ AGAKKV+ITAP KG DIPT
Sbjct  140  IVKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKHLLAGAKKVLITAPGKG-DIPT  198

Query  659  YVVGV  673
            YVVGV
Sbjct  199  YVVGV  203



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSSLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKG-VTVAKLKVAINGFGRIGRN  307
            +EFSGLR+S  V F  +       VA   T    G   K  VT AKLKVAINGFGRIGRN
Sbjct  19   SEFSGLRTSSAVPFGRKTNDDLFSVAGLQTSAIGGRKNKRIVTEAKLKVAINGFGRIGRN  78

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK I+
Sbjct  79   FLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIQ  138

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVSNRDP+ LPW ++G+D+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  139  VVSNRDPVNLPWGELGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  197

Query  668  GV  673
            GV
Sbjct  198  GV  199



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYRKGVTEAKLKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR SS C+ F  + +   FS +     +  + G   KGVT AKLKVAINGFGRIG
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFSVIAFQTSSVGSNGGYKKGVTEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGKI  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P+ LPW D+ ID+VIEGTGVFVD  GAGKH+ AGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSSRNPIDLPWKDLEIDLVIEGTGVFVDREGAGKHLLAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 138/174 (79%), Gaps = 3/174 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS-FSDVVAAQLTPKA--TGAPVKGVTVAKLKVAINGFGRIG  301
            AEFSGLR+S  +TF+ + +  F  V+A Q +      G   KGV  AKLKVAINGFGRIG
Sbjct  21   AEFSGLRNSASLTFARKTSDDFQSVIAFQTSALGINNGGYQKGVVEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  ISVDGK 
Sbjct  81   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNAISVDGKV  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKG  643
            IKVVS+R+P+ LPW D+GID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG
Sbjct  141  IKVVSDRNPVNLPWKDLGIDLVIEGTGVFVDRDGAGKHVQAGAKKVLITAPGKG  194



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSNLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 149/197 (76%), Gaps = 11/197 (6%)
 Frame = +2

Query  95   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  262
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVK  120

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
                  ISVDGK I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVI
Sbjct  121  PSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVI  180

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  181  ITAPGKG-DIPTYVVGV  196



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  298
            AEFSGLR SS C+ F  + +   FS V+A Q +   + G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRTSSACLPFGRKTSDDLFS-VIAFQTSAVGSNGGYKKGVTEAKLKVAINGFGRI  79

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGK  139

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVS+R+P+ LPW D+ ID+VIEGTGVFVD  GAGKH+ AGAKKV+ITAP KG DIPT
Sbjct  140  IIKVVSSRNPIDLPWKDLEIDLVIEGTGVFVDREGAGKHLLAGAKKVLITAPGKG-DIPT  198

Query  659  YVVGV  673
            YVVGV
Sbjct  199  YVVGV  203



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            +EFSGLR+S  + F+ + +S  F   V+ Q +   + G   KGVT AK+KVAINGFGRIG
Sbjct  17   SEFSGLRNSSALPFAKKSSSDEFVSFVSFQTSSMGSNGGYRKGVTEAKIKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+ +ND+ GVK A HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVVAINDTGGVKQATHLLKYDSTLGIFDADVKPSGDAALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            VVGV
Sbjct  196  VVGV  199



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSAFLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 149/197 (76%), Gaps = 11/197 (6%)
 Frame = +2

Query  95   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  262
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVK  120

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
                  ISVDGK I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVI
Sbjct  121  PSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVI  180

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  181  ITAPGKG-DIPTYVVGV  196



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 143/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLR SS  + FS + +  F  VVA Q +    + G   K V  AKLKVAINGFGRIG
Sbjct  22   EFSGLRNSSAFLPFSKKTSDDFLSVVAFQTSAVGSSNGGYRKTVAEAKLKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKV  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  142  IQVVSDRNPANLPWKDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            ++FSGLR+S  + F  + +S  F   V+ Q +   + G   KGVT AKLKVAINGFGRIG
Sbjct  17   SDFSGLRNSSALPFGKKSSSDEFVSFVSFQTSAMGSNGGYKKGVTEAKLKVAINGFGRIG  76

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  77   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDSALSVDGKI  136

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IK+VS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  137  IKIVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  195

Query  662  VVGV  673
            V GV
Sbjct  196  VCGV  199



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 138/185 (75%), Gaps = 4/185 (2%)
 Frame = +2

Query  128  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKA---TGAPVKGVTVAKLKVAINGFGRI  298
            ++EFSGLRSS  +       S   V A      A   +G P +  T AKLKVAINGFGRI
Sbjct  18   LSEFSGLRSSASLPLRRNATSDDFVNAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRI  77

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGR DSPLEVI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK
Sbjct  78   GRNFLRCWHGRDDSPLEVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGK  137

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVS+R+P  LPW +MG+D+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  138  VIKVVSDRNPSNLPWGEMGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPT  196

Query  659  YVVGV  673
            YV GV
Sbjct  197  YVCGV  201



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 143/183 (78%), Gaps = 4/183 (2%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNRE-ASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGR  304
            +EF+GLRSS   + F+ ++   F  V+A Q T        +GV  AKLKVAINGFGRIGR
Sbjct  18   SEFAGLRSSSAALPFARKQNEDFLSVIAFQ-TSAIDSKNKRGVVEAKLKVAINGFGRIGR  76

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK I
Sbjct  77   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVI  136

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            +VVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYV
Sbjct  137  QVVSDRNPSNLPWGDLGIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIPTYV  195

Query  665  VGV  673
            VGV
Sbjct  196  VGV  198



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score =   233 bits (594),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  269  KVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVV  448
            K+ INGFGRIGRNFLRCW+ R+DSP+EVI VNDS GVKNAAHLLKYDSMLGTFKADVK+V
Sbjct  1    KIGINGFGRIGRNFLRCWYEREDSPIEVIAVNDSGGVKNAAHLLKYDSMLGTFKADVKIV  60

Query  449  DNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIIT  628
            D++TISV GK I VVS+RDPL+LPWA++GIDIVIEGTGVF+D PGAGKH+ AGAKKVIIT
Sbjct  61   DDKTISVGGKNILVVSSRDPLQLPWAELGIDIVIEGTGVFIDTPGAGKHLTAGAKKVIIT  120

Query  629  APAKGADIPTYVVGV  673
            APAKG +IPTYV GV
Sbjct  121  APAKGNEIPTYVCGV  135



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRI  298
            AEFSGLR+S  C+ F  + +   FS V+A Q +   + G   KGVT AKLKVAINGFGRI
Sbjct  21   AEFSGLRTSLACLPFGRKTSDDLFS-VIAFQTSALGSNGVYKKGVTEAKLKVAINGFGRI  79

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  +SVDGK
Sbjct  80   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNGLSVDGK  139

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             +KVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKH+ AGAKKV+ITAP KG DIPT
Sbjct  140  IVKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDRDGAGKHLLAGAKKVLITAPGKG-DIPT  198

Query  659  YVVGV  673
            YVVGV
Sbjct  199  YVVGV  203



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 127/194 (65%), Positives = 147/194 (76%), Gaps = 5/194 (3%)
 Frame = +2

Query  104  QCFSKRLEVAEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLK  271
            Q   K +  A+FSGL  SS  + F+ + +  F  +VA Q +   +  G   KG+  AKLK
Sbjct  16   QAKGKGVGFADFSGLHNSSTSLPFARKTSDDFHSLVAFQTSALGSNNGGYRKGMAEAKLK  75

Query  272  VAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVD  451
            VAINGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V 
Sbjct  76   VAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFAADVKPVG  135

Query  452  NETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITA  631
             + ISVDGK IKVVS+R+P  LPW D+GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITA
Sbjct  136  TDGISVDGKVIKVVSDRNPSNLPWGDLGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITA  195

Query  632  PAKGADIPTYVVGV  673
            P KG DIPTYVVGV
Sbjct  196  PGKG-DIPTYVVGV  208



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 146/186 (78%), Gaps = 6/186 (3%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKATGAPVK--GVTV-AKLKVAINGFGR  295
            +EFSGLR S+G + FS + +  F  VV+ Q     +    K  GV V AKLKVAINGFGR
Sbjct  21   SEFSGLRNSTGYLPFSRKTSDDFHSVVSFQTNAVGSNGGYKRGGVVVEAKLKVAINGFGR  80

Query  296  IGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDG  475
            IGRNFLRCWHGRK+SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V N+ ISVDG
Sbjct  81   IGRNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGNDAISVDG  140

Query  476  KPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIP  655
            K I+VVSNR+P  LPW ++GID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIP
Sbjct  141  KVIQVVSNRNPSNLPWKELGIDLVIEGTGVFVDREGAGKHIEAGAKKVLITAPGKG-DIP  199

Query  656  TYVVGV  673
            TYVVGV
Sbjct  200  TYVVGV  205



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 143/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F   V+ Q +   ++G   KGVT AKLKVAINGFGRIG
Sbjct  18   EFSGLRSSSAFLPFGKKLSSDEFVSFVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK      ISVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 149/197 (76%), Gaps = 11/197 (6%)
 Frame = +2

Query  95   STPQCFSKRLEVAEFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVA  262
            S P+ F+      EFSGLRSS   + F  + +S  F  +V+ Q +   ++G   KGVT A
Sbjct  7    SVPKGFT------EFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEA  60

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL++I +ND+ GVK A+HLLKYDS LG F ADVK
Sbjct  61   KLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVK  120

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
                  ISVDGK I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKH++AGAKKVI
Sbjct  121  PSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHMEAGAKKVI  180

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  181  ITAPGKG-DIPTYVVGV  196



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 142/184 (77%), Gaps = 6/184 (3%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATG---APVKGVTVAKLKVAINGFGRIG  301
            +EFSGL +S  + F  R+ S   +        A G   +   GV  AKLKVAINGFGRIG
Sbjct  21   SEFSGLHTSS-LPFG-RKGSDDLMAFVSFQTNAVGGKRSSQNGVVEAKLKVAINGFGRIG  78

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF ADVK   +  ISVDGK 
Sbjct  79   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKV  138

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  139  IKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTY  197

Query  662  VVGV  673
            VVGV
Sbjct  198  VVGV  201



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 5/184 (3%)
 Frame = +2

Query  131  AEFSGLRSSG---CVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +E+SGL+SS    C+   N E  F  +VA Q     +    +GV  AK+KVAINGFGRIG
Sbjct  29   SEYSGLKSSSGFPCLRKYNEELRFQ-LVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIG  87

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  DV+V  N+ ISVDGK 
Sbjct  88   RNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDPDVQVAGNDGISVDGKV  147

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P+ LPW D  ID+VIEG GVFVD  GAGKH+QAGAKKV+ITAP KG DIPTY
Sbjct  148  IKVVSDRNPVNLPWKDYEIDLVIEGPGVFVDREGAGKHLQAGAKKVLITAPGKG-DIPTY  206

Query  662  VVGV  673
            V GV
Sbjct  207  VCGV  210



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = +2

Query  203  VAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVK  382
            VAAQ     +GA  + V  AK+KVAINGFGRIGRNF+RCWHGRKDSPLEV+V+ND+ GVK
Sbjct  2    VAAQSAVAVSGAQKRAVVEAKVKVAINGFGRIGRNFIRCWHGRKDSPLEVVVINDTGGVK  61

Query  383  NAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTG  562
             A+HLLKYDSMLG F ADVK V ++ ISVDGK IK+VS+R+PL LPW +MG+D+VIEGTG
Sbjct  62   QASHLLKYDSMLGIFDADVKAVGDDAISVDGKIIKIVSDRNPLNLPWGEMGVDLVIEGTG  121

Query  563  VFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            VFVD  GAGKH+QAGAKKV+ITAP KG  IPTYV+GV
Sbjct  122  VFVDKEGAGKHLQAGAKKVLITAPGKGP-IPTYVIGV  157



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 146/185 (79%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTV-AKLKVAINGFGRI  298
            +EFSGLR SSG + FS + +  F  V++ Q     ++G   KGV V AK+KVAINGFGRI
Sbjct  21   SEFSGLRNSSGYLPFSRKTSDDFHSVISFQTNAVGSSGRSKKGVVVEAKIKVAINGFGRI  80

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGK  140

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPT
Sbjct  141  VIKVVSDRNPANLPWGELGIDLVIEGTGVFVDREGAGKHITAGAKKVLITAPGKG-DIPT  199

Query  659  YVVGV  673
            YVVGV
Sbjct  200  YVVGV  204



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 144/184 (78%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREAS--FSDVVAAQLTPK-ATGAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLRSS   + F  + +S  F  VV  Q +   ++G   KGVT AKLKVAI+GFGRIG
Sbjct  18   EFSGLRSSSASLPFGKKLSSDEFVSVVTFQTSAMGSSGGYRKGVTEAKLKVAISGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            I+VVSNR+P  LPW ++GIDIVIEGTGVFVD  GAGKHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IQVVSNRNPSNLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 3/180 (2%)
 Frame = +2

Query  137  FSGLRSSGCVTFSNREASFSDVVAAQLTPKATGA-PVKGVTVAKLKVAINGFGRIGRNFL  313
            F+GL S+   T    E +F+  VA Q   KATGA  V  +   + KVAINGFGRIGRNFL
Sbjct  3    FTGLTSTALPT--KAEQTFTGRVARQTATKATGAKTVAAMKGKQCKVAINGFGRIGRNFL  60

Query  314  RCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIKVV  493
            RCWHGR ++ L+++ +NDS GVK A+HL+KYDS+LGTF+ADVK++D+  IS+DGK I++V
Sbjct  61   RCWHGRANTMLDIVAINDSGGVKQASHLVKYDSVLGTFEADVKIIDDTHISIDGKSIEIV  120

Query  494  SNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            S+RDPL+LPW  +G+DIVIEGTGVF+D PGA KH+ AGAKKV+ITAPAKG DIPTYV+GV
Sbjct  121  SSRDPLQLPWKALGVDIVIEGTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYVLGV  180



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVA-AQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +EF+GLRSS     + +  S  D V+   L     G   KG   AKLKVAINGFGRIGRN
Sbjct  18   SEFAGLRSSSASLPAFQMKSCDDFVSMVALQTSFVGKNSKGPVEAKLKVAINGFGRIGRN  77

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+VIV+ND+ GVK A+HLLKYDS LG F ADVK   ++ ISVDGK IK
Sbjct  78   FLRCWHGRKDSPLDVIVINDTGGVKQASHLLKYDSTLGIFDADVKPSGDQAISVDGKIIK  137

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P  LPW +MGID+VIEGTGVFVD  GAGKHI+AGAKKV+ITAP KG DIPTYVV
Sbjct  138  VVSDRNPSNLPWGEMGIDLVIEGTGVFVDRDGAGKHIEAGAKKVLITAPGKG-DIPTYVV  196

Query  668  GV  673
            GV
Sbjct  197  GV  198



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 139/185 (75%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLRSSGCVT----FSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  298
            ++FSGLRS+ C        + +   S V        ++G   KG   AK+KVAINGFGRI
Sbjct  21   SDFSGLRSASCSIPLRKIHSSDDFLSTVAFRTAAESSSGGYRKGAAEAKIKVAINGFGRI  80

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+V+ +ND+ G+K A+HLLKYDS LG F+ADVK      ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVVAINDTGGIKQASHLLKYDSTLGIFEADVKPEGQSAISVDGK  140

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVSNR+PL LPW ++G+D+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  141  VIKVVSNRNPLDLPWGELGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPT  199

Query  659  YVVGV  673
            YVVGV
Sbjct  200  YVVGV  204



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLR-SSGCVTFSNREAS-FSDVVAAQLTP-KATGAPVKGVTV-AKLKVAINGFGRI  298
            +EFSGLR SSG + FS + +  F  V++ Q     ++G   KGV V AK+KVAINGFGR 
Sbjct  21   SEFSGLRNSSGYLPFSRKTSDDFHSVISVQTNAVGSSGRSRKGVVVEAKIKVAINGFGRT  80

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V  + ISVDGK
Sbjct  81   GRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGK  140

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPT
Sbjct  141  VIKVVSDRNPANLPWGELGIDLVIEGTGVFVDREGAGKHITAGAKKVLITAPGKG-DIPT  199

Query  659  YVVGV  673
            YVVGV
Sbjct  200  YVVGV  204



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   233 bits (594),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPV----KGVTVAKLKVAINGFGRIG  301
            +FSGLRSS       ++ S   V A  L   A G+      KG   AKLKVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSAVSLQTSALGSSSGGYRKGAAEAKLKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNGISVDGKV  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW D+ +D+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPTY
Sbjct  142  IKVVSSRNPLDLPWKDLEVDLVIEGTGVFVDREGAGKHITAGAKKVLITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 144/191 (75%), Gaps = 12/191 (6%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPK---------ATGAPVKGVTVAKLKVAI  280
            EFSGLR SS  + F+ + +  F  VVA Q + K           G   K    AKLKVAI
Sbjct  22   EFSGLRNSSAFLPFAKKTSDDFLSVVAFQTSAKRILTVKVGSNNGGYRKTAAEAKLKVAI  81

Query  281  NGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNET  460
            NGFGRIGRNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK V +  
Sbjct  82   NGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPVGDNG  141

Query  461  ISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAK  640
            ISVDGK IKVVS+R+P+ LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP K
Sbjct  142  ISVDGKVIKVVSDRNPVNLPWGELGIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGK  201

Query  641  GADIPTYVVGV  673
            G DIPTYVVGV
Sbjct  202  G-DIPTYVVGV  211



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 150/204 (74%), Gaps = 10/204 (5%)
 Frame = +2

Query  68   TRTRLPSKTSTPQCFSKRLEVAEFSGLRSSGCVTFSNR-EASFSDVVAAQLTPKATGAPV  244
            TR + P + + PQ       +A+++G +S+  +   ++ E S +  VAAQ     TGA  
Sbjct  16   TRVQAPRRAA-PQA-----SLADYTGFKSASSLRLGHKQEHSLNSRVAAQTYTGTTGA--  67

Query  245  KGVT-VAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLG  421
            K VT   K+ VAINGFGRIGRNFLRC  GR DS L V V+NDS GVK A+HLLKYDS LG
Sbjct  68   KLVTECKKINVAINGFGRIGRNFLRCVEGRTDSNLNVTVINDSGGVKQASHLLKYDSTLG  127

Query  422  TFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQ  601
            TF ADVKVVD+ TI+V+GKPIK+VS+RDPL LPW D  ID+VIEGTGVFV   GAGKHI 
Sbjct  128  TFNADVKVVDDTTIAVNGKPIKIVSSRDPLALPWKDNNIDLVIEGTGVFVSSEGAGKHIA  187

Query  602  AGAKKVIITAPAKGADIPTYVVGV  673
            AGAKKV+ITAPAKG+D+PTYVVGV
Sbjct  188  AGAKKVLITAPAKGSDVPTYVVGV  211



>tpg|DAA37468.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=252

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 141/187 (75%), Gaps = 7/187 (4%)
 Frame = +2

Query  128  VAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGR  295
            ++EFSGLRSS  +    R A+  D ++A          +G   +  T AKLKVAINGFGR
Sbjct  19   LSEFSGLRSSASLPM-RRNATSDDFMSAVSFRTHAVGTSGGSRRAPTEAKLKVAINGFGR  77

Query  296  IGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVD  472
            IGRNFLRCWHGR D SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVD
Sbjct  78   IGRNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVD  137

Query  473  GKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADI  652
            GK IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DI
Sbjct  138  GKVIKVVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DI  196

Query  653  PTYVVGV  673
            PTYVVGV
Sbjct  197  PTYVVGV  203



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  304
            +FSGLRSS       ++ S  F  VVA Q +   ++G   K    AK+KVAINGFGRIGR
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSMGNSSGGYRKSAAEAKIKVAINGFGRIGR  81

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK I
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVI  141

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW DM +D+VIEGTGVFVD  GAGKHI AGAKKVIITAP KG DIPTYV
Sbjct  142  KVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKHITAGAKKVIITAPGKG-DIPTYV  200

Query  665  VGV  673
            VGV
Sbjct  201  VGV  203



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 143/188 (76%), Gaps = 8/188 (4%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREASFSDVVA--AQLTPKATGAPVKG-----VTVAKLKVAINGF  289
            +EF+GLR+S  V F     +  D+++  A  T   +GA         V  AKLKVAINGF
Sbjct  23   SEFTGLRTSSAVPFGVGWKTNVDLLSLVAYQTSVISGAGKNNNNNSRVVEAKLKVAINGF  82

Query  290  GRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISV  469
            GRIGRNFLRCWHGRKDSPL+VI +NDS GVK A+HLLKYDS LG F ADVK V  + ISV
Sbjct  83   GRIGRNFLRCWHGRKDSPLDVIAINDSGGVKQASHLLKYDSTLGIFDADVKPVGTDGISV  142

Query  470  DGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGAD  649
            DGK IKVVS+R+P+ LPW D+G+D+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG D
Sbjct  143  DGKIIKVVSDRNPINLPWKDLGVDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-D  201

Query  650  IPTYVVGV  673
            IPTYVVGV
Sbjct  202  IPTYVVGV  209



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  301
            +FSGLRSS       ++ S  F  VVA Q +    ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSAMGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW DM +D+VIEGTGVFVD  GAGKHI AGAKKVIITAP KG DIPTY
Sbjct  142  IKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKHITAGAKKVIITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTP-KATGAPVKGVTVAKLKVAINGFGRIGR  304
            +FSGLRSS       ++ S  F  VVA Q +   ++G   K    AK+KVAINGFGRIGR
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSMGNSSGGYRKSAAEAKIKVAINGFGRIGR  81

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK I
Sbjct  82   NFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKVI  141

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            KVVS+R+PL LPW DM +D+VIEGTGVFVD  GAGKHI AGAKKVIITAP KG DIPTYV
Sbjct  142  KVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKHITAGAKKVIITAPGKG-DIPTYV  200

Query  665  VGV  673
            VGV
Sbjct  201  VGV  203



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = +2

Query  131  AEFSGLRSSGCVTFSNREAS--FSDVVAAQLTPKATGAPVKGVTV-AKLKVAINGFGRIG  301
            ++FSGLRSS      +R+ S  F+ V+A Q +        K V V AKLKVAINGFGRIG
Sbjct  21   SDFSGLRSSSSYLPFSRKTSEDFNSVIAFQTSAVGNSGGYKKVVVEAKLKVAINGFGRIG  80

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRK+SPL+VI +ND+ GVK A+HLLKYDS+LGTF A VK V ++ ISVDGK 
Sbjct  81   RNFLRCWHGRKESPLDVIAINDTGGVKQASHLLKYDSILGTFDAVVKPVGSDIISVDGKE  140

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPTY
Sbjct  141  IKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGAGKHIVAGAKKVLITAPGKG-DIPTY  199

Query  662  VVGV  673
            VVGV
Sbjct  200  VVGV  203



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +2

Query  236  APVKGVTVAKLKVAINGFGRIGRNFLRCWHGR-KDSPLEVIVVNDSAGVKNAAHLLKYDS  412
            A +  +T AK+KVAINGFGRIGRNF+RCW  R  D+ LEV+ VN S G K AAHLLKYDS
Sbjct  31   AAINTMTEAKVKVAINGFGRIGRNFVRCWMSRGADTTLEVVCVNQSGGAKPAAHLLKYDS  90

Query  413  MLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGK  592
            +LGTF ADVKVVD+ TI+V+GKPIKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGK
Sbjct  91   ILGTFDADVKVVDDATITVNGKPIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGK  150

Query  593  HIQAGAKKVIITAPAKGADIPTYVVGV  673
            HIQAGAKKV+ITAPAKG DIPTYVVGV
Sbjct  151  HIQAGAKKVVITAPAKGNDIPTYVVGV  177



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS--FSDVVAAQL--TPKATGAPVKGVTVAKLKVAINGFGRIG  301
            +FSGLRSS       ++ S  F  VVA Q   T  ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSATGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW DM +D+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPTY
Sbjct  142  IKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKHITAGAKKVLITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 138/185 (75%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLRSSGCVT----FSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRI  298
            +EFSGLRSS         +N  A F   V+ Q +        K V  AKLKVAINGFGRI
Sbjct  83   SEFSGLRSSSSALPFGKRANSNADFVSFVSFQTSLVGGEKNQKVVVEAKLKVAINGFGRI  142

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+VI +ND+ GVK AAHLLKYDS LG F A VK V  + ISVDGK
Sbjct  143  GRNFLRCWHGRKDSPLDVIAINDTGGVKQAAHLLKYDSTLGIFDAVVKPVGTDAISVDGK  202

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             I+VVS+R+P  LPW DMGID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  203  IIQVVSDRNPSNLPWGDMGIDLVIEGTGVFVDRDGAGKHIQAGAKKVLITAPGKG-DIPT  261

Query  659  YVVGV  673
            YVVGV
Sbjct  262  YVVGV  266



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREAS--FSDVVAAQLTP--KATGAPVKGVTVAKLKVAINGFGRIG  301
            +FSGLRSS       ++ S  F  VVA Q +    ++G   K    AK+KVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSVVAFQTSAMGNSSGGYRKSAAEAKIKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW DM +D+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPTY
Sbjct  142  IKVVSSRNPLDLPWKDMEVDLVIEGTGVFVDREGAGKHITAGAKKVLITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 127/145 (88%), Gaps = 1/145 (1%)
 Frame = +2

Query  242  VKGVTVAKLKVAINGFGRIGRNFLRCWHGR-KDSPLEVIVVNDSAGVKNAAHLLKYDSML  418
            V  VT AK+KVAINGFGRIGRNF+RCW  R  D PL+V+ VN S G K AAHLLKYDS+L
Sbjct  34   VNVVTEAKVKVAINGFGRIGRNFVRCWKSRGPDCPLQVVCVNQSGGAKPAAHLLKYDSIL  93

Query  419  GTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHI  598
            GTFK+DVKVVD+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+DGPGAGKHI
Sbjct  94   GTFKSDVKVVDDATISVDGDIIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLDGPGAGKHI  153

Query  599  QAGAKKVIITAPAKGADIPTYVVGV  673
            QAGAKKV+ITAPAKG+DIPTYVVGV
Sbjct  154  QAGAKKVVITAPAKGSDIPTYVVGV  178



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = +2

Query  131  AEFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAPV---KGVTVAKLKVAINGFGRI  298
            +EFSGLRSS   +   N    F  V++ + +  A G+     KG   AK+KVAINGFGRI
Sbjct  62   SEFSGLRSSSLPLRRINTSDDFISVISFKTSAVAGGSGGGYRKGPAEAKIKVAINGFGRI  121

Query  299  GRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGK  478
            GRNFLRCWHGRKDSPL+V+ +ND+ GVK A+HLLKYDS LG F+ADVK   N  ISVDGK
Sbjct  122  GRNFLRCWHGRKDSPLDVVAINDTGGVKQASHLLKYDSTLGIFEADVKPAGNAAISVDGK  181

Query  479  PIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPT  658
             IKVV+NR+PL LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPT
Sbjct  182  VIKVVTNRNPLDLPWKELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPT  240

Query  659  YVVGV  673
            YVVGV
Sbjct  241  YVVGV  245



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P  LPW D  ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  149  VVSSRNPQNLPWKDYEIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  207

Query  668  GV  673
            GV
Sbjct  208  GV  209



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P  LPW D  ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  149  VVSSRNPQNLPWKDYEIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  207

Query  668  GV  673
            GV
Sbjct  208  GV  209



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P  LPW D  ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  149  VVSSRNPQNLPWKDYEIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  207

Query  668  GV  673
            GV
Sbjct  208  GV  209



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 137/184 (74%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPV----KGVTVAKLKVAINGFGRIG  301
            +FSGLRSS       ++ S   V A  L   A G+      K    AKLKVAINGFGRIG
Sbjct  22   DFSGLRSSSAFLPFTKKTSDDFVSAVSLQTSALGSSSGGYRKSAAEAKLKVAINGFGRIG  81

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  82   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFAADVKPVGDNGISVDGKV  141

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+PL LPW D+ ID+VIEGTGVFVD  GAGKHI AGAKKV+ITAP KG DIPTY
Sbjct  142  IKVVSSRNPLDLPWKDLEIDLVIEGTGVFVDREGAGKHITAGAKKVLITAPGKG-DIPTY  200

Query  662  VVGV  673
            VVGV
Sbjct  201  VVGV  204



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +2

Query  131  AEFSGLRSS-GCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +E+SGL+SS G  +          VVA Q     +    +GV  AK+KVAINGFGRIGRN
Sbjct  29   SEYSGLKSSIGFPSLRKYNEDLVSVVAFQTNAVGSSGQKRGVVEAKIKVAINGFGRIGRN  88

Query  308  FLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPIK  487
            FLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF  +VK+   + ISV GK IK
Sbjct  89   FLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDTEVKIAGTDGISVGGKVIK  148

Query  488  VVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVV  667
            VVS+R+P  LPW D  ID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTYVV
Sbjct  149  VVSSRNPQNLPWKDYEIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTYVV  207

Query  668  GV  673
            GV
Sbjct  208  GV  209



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGC-VTFSNREASFSDVVAAQLTPKATGAP---VKGVTVAKLKVAINGFGRIG  301
            +FSGLRSS   + F  + +S   V A      A G+     KGVT AKLKVAINGFGRIG
Sbjct  18   DFSGLRSSSASLPFGKKLSSDEFVSAVTFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIG  77

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSP +VI +ND+ GVK A+HLLKYDS LG F ADVK   +  +SVDGK 
Sbjct  78   RNFLRCWHGRKDSPFDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGDAALSVDGKI  137

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVSNR+P  LPW ++GIDIVIEGTGVFVD  GA KHI+AGAKKVIITAP KG DIPTY
Sbjct  138  IKVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAXKHIEAGAKKVIITAPGKG-DIPTY  196

Query  662  VVGV  673
            VVGV
Sbjct  197  VVGV  200



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  218  TPKATG-APVKGVTVAKLKVAINGFGRIGRNFLRCWHGR-KDSPLEVIVVNDSAGVKNAA  391
            TP+A   A V  VT AK+KVAINGFGRIGRNF+RCW  R  D PL+V+ VN S G K AA
Sbjct  25   TPRAAAKANVNVVTEAKVKVAINGFGRIGRNFVRCWKTRGPDCPLQVVCVNQSGGAKPAA  84

Query  392  HLLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFV  571
            HLLKYDS+LGTFK+DVKV+D+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+
Sbjct  85   HLLKYDSILGTFKSDVKVIDDSTISVDGDVIKVVSDRDPLNLPWKEMGIDIVIEGTGVFL  144

Query  572  DGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            DGPGAGKHI AGAKKV+ITAPAKG DIPTYVVGV
Sbjct  145  DGPGAGKHITAGAKKVVITAPAKGNDIPTYVVGV  178



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 9/183 (5%)
 Frame = +2

Query  137  FSGLRSSGCVTFSNREASFSDVVAAQLTPKATG----APVKGVTVAKLKVAINGFGRIGR  304
            F+GL S+   T    E +F+  V  Q   KATG    A +KG T+   KVAINGFGRIGR
Sbjct  1    FTGLTSTALPT--KAEQTFAGRVQRQTATKATGSKTVAAMKGKTI---KVAINGFGRIGR  55

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGR ++ L+++ +NDS GVK A+HL+KYDS+LGTF+ADVK+VD+  IS+DGK I
Sbjct  56   NFLRCWHGRANTMLDIVAINDSGGVKQASHLVKYDSVLGTFEADVKIVDDTHISIDGKKI  115

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            ++VS+RDPL+LPW  +G+D+VIEGTGVF+D PGA KHI AGA KV+ITAPAKG DIPTYV
Sbjct  116  EIVSSRDPLQLPWKALGVDLVIEGTGVFIDTPGASKHITAGASKVLITAPAKGDDIPTYV  175

Query  665  VGV  673
            +GV
Sbjct  176  LGV  178



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 143/183 (78%), Gaps = 9/183 (5%)
 Frame = +2

Query  137  FSGLRSSGCVTFSNREASFSDVVAAQLTPKATG----APVKGVTVAKLKVAINGFGRIGR  304
            F+GL S+   T    E +F+  V  Q   KATG    A +KG T+   KVAINGFGRIGR
Sbjct  3    FTGLTSTALPT--KAEQTFAGRVQRQTATKATGSKTVAAMKGKTI---KVAINGFGRIGR  57

Query  305  NFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            NFLRCWHGR ++ L+++ +NDS GVK A+HL+KYDS+LGTF+ADVK+VD+  IS+DGK I
Sbjct  58   NFLRCWHGRANTMLDIVAINDSGGVKQASHLVKYDSVLGTFEADVKIVDDTHISIDGKKI  117

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            ++VS+RDPL+LPW  +G+D+VIEGTGVF+D PGA KHI AGA KV+ITAPAKG DIPTYV
Sbjct  118  EIVSSRDPLQLPWKALGVDLVIEGTGVFIDTPGASKHITAGASKVLITAPAKGDDIPTYV  177

Query  665  VGV  673
            +GV
Sbjct  178  LGV  180



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = +2

Query  128  VAEFSGLRSSGCVTFSNREASFSDVVAA----QLTPKATGAPVKGVTVAKLKVAINGFGR  295
            ++EFSGLRSS  +    R A+  D ++A          +G P +  T AKLKVAINGFGR
Sbjct  19   LSEFSGLRSSASLPM-RRNATSDDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGR  77

Query  296  IGRNFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVD  472
            IGRNFLRCWHGR D SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVD
Sbjct  78   IGRNFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVD  137

Query  473  GKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADI  652
            GK IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DI
Sbjct  138  GKVIKVVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DI  196

Query  653  PTYVVGV  673
            PTYVVGV
Sbjct  197  PTYVVGV  203



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +2

Query  245  KGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGT  424
            KG   AK+KVAINGFGRIGRNFLRCWHGRKDSPLE+I +ND+ GVK A+HLLKYDS LG 
Sbjct  3    KGPAEAKIKVAINGFGRIGRNFLRCWHGRKDSPLEIIAINDTGGVKQASHLLKYDSTLGI  62

Query  425  FKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQA  604
            F ADVK V ++ ISVDGKPI+VVSNR+P  LPW ++GID+VIEGTGVFVD  GAGKHIQA
Sbjct  63   FGADVKAVGDDVISVDGKPIQVVSNRNPANLPWGELGIDLVIEGTGVFVDREGAGKHIQA  122

Query  605  GAKKVIITAPAKGADIPTYVVGV  673
            GAKKV+ITAP KG DIPTYVVGV
Sbjct  123  GAKKVLITAPGKG-DIPTYVVGV  144



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 141/183 (77%), Gaps = 5/183 (3%)
 Frame = +2

Query  128  VAEFSGLRSSGCVTFSNREASFSDVVAAQLTPKATGAPVKGVTVAKLKVAINGFGRIGRN  307
            +A FS  +++    FS     F +   A+ +   T    KG T    KVAINGFGRIGRN
Sbjct  1    MATFSAAKTTQLTQFSKAAGQFKNKTVAKASVSNT-IEAKGKTC---KVAINGFGRIGRN  56

Query  308  FLRCWHGR-KDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKPI  484
            FLRCWHGR KD+ LEV+ +NDS GVK A+HL+KYDS+LGTF+ADVK+VD+  +S+DGK I
Sbjct  57   FLRCWHGRGKDTLLEVVAINDSGGVKQASHLVKYDSVLGTFEADVKIVDDTHMSIDGKSI  116

Query  485  KVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV  664
            ++VS+RDPL+LPW ++GIDIVIEGTGVF+D PGA KH+ AGAKKV+ITAPAKG DIPTYV
Sbjct  117  QIVSSRDPLQLPWKELGIDIVIEGTGVFIDTPGASKHLTAGAKKVVITAPAKGDDIPTYV  176

Query  665  VGV  673
            +GV
Sbjct  177  LGV  179



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLR-SSGCVTFSNREAS-FSDVVAAQLTPKAT--GAPVKGVTVAKLKVAINGFGRIG  301
            EFSGLR SS  + F+ + +  F  VVA Q +  A+  G   +    AKLKVAINGFGRIG
Sbjct  23   EFSGLRNSSAFLPFAKKTSDDFLSVVAFQTSALASSSGGYRRAAAEAKLKVAINGFGRIG  82

Query  302  RNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            RNFLRCWHGRKDSPL+VI +ND+ GVK A+HLLKYDS LG F+ADVK   +  ISVDGK 
Sbjct  83   RNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFEADVKPAGDSAISVDGKI  142

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKV SNR+P+ LPW +M ID+VIEGTGVFVD  GAGKHI AGAK V+ITAP KG DIPTY
Sbjct  143  IKVASNRNPVNLPWKEMEIDLVIEGTGVFVDREGAGKHIHAGAKNVLITAPGKG-DIPTY  201

Query  662  VVGV  673
            VVGV
Sbjct  202  VVGV  205



>emb|CAC80392.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Spirogyra 
sp.]
Length=318

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = +2

Query  269  KVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVV  448
            KV INGFGRIGRNF+RCWHGR DSPLEVI +ND+ GVK AAHLLKYDSMLG F ADVK+ 
Sbjct  1    KVGINGFGRIGRNFIRCWHGRDDSPLEVIAINDTGGVKQAAHLLKYDSMLGIFNADVKIA  60

Query  449  DNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIIT  628
            D+ +ISVDGK IKVVS+R+PL LPW +MGID+VIEGTGVF+DGPGAGKHI+AGAKKV+IT
Sbjct  61   DDNSISVDGKIIKVVSDRNPLNLPWGEMGIDLVIEGTGVFIDGPGAGKHIEAGAKKVLIT  120

Query  629  APAKGADIPTYVVGV  673
            AP KG  IPTYVVGV
Sbjct  121  APGKGP-IPTYVVGV  134



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 128/153 (84%), Gaps = 1/153 (1%)
 Frame = +2

Query  218  TPKATGAPVKGVTVAKLKVAINGFGRIGRNFLRCWHGR-KDSPLEVIVVNDSAGVKNAAH  394
            T   T A V  VT AK+KVAINGFGRIGRNF+RCW  R  D PL+V+ VN S G K AAH
Sbjct  53   TACVTQANVNVVTEAKVKVAINGFGRIGRNFVRCWKTRGPDCPLQVVCVNQSGGAKPAAH  112

Query  395  LLKYDSMLGTFKADVKVVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVD  574
            LLKYDS+LGTFK+DVKV+D+ TISVDG  IKVVS+RDPL LPW +MGIDIVIEGTGVF+D
Sbjct  113  LLKYDSILGTFKSDVKVIDDSTISVDGDVIKVVSDRDPLNLPWKEMGIDIVIEGTGVFLD  172

Query  575  GPGAGKHIQAGAKKVIITAPAKGADIPTYVVGV  673
            GPGAGKHI AGAKKV+ITAPAKG DIPTYVVGV
Sbjct  173  GPGAGKHITAGAKKVVITAPAKGNDIPTYVVGV  205



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 137/184 (74%), Gaps = 5/184 (3%)
 Frame = +2

Query  134  EFSGLRSSGCVTFSNREASFSDVVAAQLTPKA---TGAPVKGVTVAKLKVAINGFGRIGR  304
            EFSGLRSS  +       S   + A      A   +G P +  T AKLKVAINGFGRIGR
Sbjct  1    EFSGLRSSASLPMRRNATSDDFMSAVSFRTHAVGTSGGPRRAPTEAKLKVAINGFGRIGR  60

Query  305  NFLRCWHGRKD-SPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVKVVDNETISVDGKP  481
            NFLRCWHGR D SPL+VI +ND+ GVK A+HLLKYDS LG F ADVK V +  ISVDGK 
Sbjct  61   NFLRCWHGRGDASPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGDNAISVDGKV  120

Query  482  IKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTY  661
            IKVVS+R+P  LPW ++GID+VIEGTGVFVD  GAGKHIQAGAKKV+ITAP KG DIPTY
Sbjct  121  IKVVSDRNPSNLPWGELGIDLVIEGTGVFVDREGAGKHIQAGAKKVLITAPGKG-DIPTY  179

Query  662  VVGV  673
            VVGV
Sbjct  180  VVGV  183



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +2

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF ADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
               +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH+QAGAKKV+
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  121  ITAPGKG-DIPTYVVGV  136



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +2

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF ADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
               +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH+QAGAKKV+
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  121  ITAPGKG-DIPTYVVGV  136



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +2

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF ADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVK  60

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
               +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH+QAGAKKV+
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  121  ITAPGKG-DIPTYVVGV  136



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 1/137 (1%)
 Frame = +2

Query  263  KLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVNDSAGVKNAAHLLKYDSMLGTFKADVK  442
            KLKVAINGFGRIGRNFLRCWHGRKDSPL+V+V+ND+ GVK A+HLLKYDS+LGTF ADVK
Sbjct  1    KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDAGGVKQASHLLKYDSILGTFDADVK  60

Query  443  VVDNETISVDGKPIKVVSNRDPLKLPWADMGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI  622
               +  ISVDGK IKVVS+R+P+ LPW DMGID+VIEGTGVFVD  GAGKH+QAGAKKV+
Sbjct  61   TAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVL  120

Query  623  ITAPAKGADIPTYVVGV  673
            ITAP KG DIPTYVVGV
Sbjct  121  ITAPGKG-DIPTYVVGV  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600