BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034G13

Length=621
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770880.1|  PREDICTED: endoglucanase 25-like                   250   2e-75   Nicotiana sylvestris
gb|KJB70737.1|  hypothetical protein B456_011G089500                    244   2e-74   Gossypium raimondii
ref|XP_006358489.1|  PREDICTED: endoglucanase 25-like                   246   5e-74   Solanum tuberosum [potatoes]
ref|NP_001233943.1|  endo-1,4-beta-glucanase                            246   6e-74   Solanum lycopersicum
gb|KJB70736.1|  hypothetical protein B456_011G089500                    245   2e-73   Gossypium raimondii
ref|XP_009600540.1|  PREDICTED: endoglucanase 25-like                   244   2e-73   Nicotiana tomentosiformis
gb|AIE16186.1|  endo-1,4-beta-glucanase                                 244   2e-73   Nicotiana tabacum [American tobacco]
ref|XP_010533226.1|  PREDICTED: endoglucanase 25                        244   2e-73   Tarenaya hassleriana [spider flower]
gb|AID55380.1|  glycoside hydrolase family 9 A2                         243   6e-73   Gossypium hirsutum [American cotton]
ref|XP_006431347.1|  hypothetical protein CICLE_v10000600mg             243   1e-72   Citrus clementina [clementine]
gb|KDO53875.1|  hypothetical protein CISIN_1g007014mg                   242   2e-72   Citrus sinensis [apfelsine]
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             244   3e-71   
ref|XP_009765308.1|  PREDICTED: endoglucanase 25-like                   238   4e-71   Nicotiana sylvestris
ref|XP_010088712.1|  Endoglucanase 25                                   238   5e-71   Morus notabilis
emb|CAN68337.1|  hypothetical protein VITISV_025978                     237   1e-70   Vitis vinifera
ref|NP_001284449.1|  endoglucanase 25-like                              237   2e-70   Cucumis melo [Oriental melon]
ref|XP_009595607.1|  PREDICTED: endoglucanase 25-like                   237   2e-70   Nicotiana tomentosiformis
emb|CDP17765.1|  unnamed protein product                                237   2e-70   Coffea canephora [robusta coffee]
ref|XP_004133745.1|  PREDICTED: endoglucanase 25-like                   237   2e-70   Cucumis sativus [cucumbers]
ref|XP_011092233.1|  PREDICTED: endoglucanase 25-like                   236   4e-70   Sesamum indicum [beniseed]
gb|KJB66549.1|  hypothetical protein B456_010G143300                    233   4e-70   Gossypium raimondii
ref|XP_002519394.1|  endo-1,4-beta-glucanase, putative                  235   7e-70   Ricinus communis
ref|XP_010521418.1|  PREDICTED: endoglucanase 25-like                   235   1e-69   Tarenaya hassleriana [spider flower]
gb|KDP32467.1|  hypothetical protein JCGZ_13392                         234   1e-69   Jatropha curcas
emb|CAB51903.1|  cellulase                                              234   2e-69   Brassica napus [oilseed rape]
emb|CDX83181.1|  BnaA03g23250D                                          234   2e-69   
ref|XP_009134026.1|  PREDICTED: endoglucanase 25                        234   2e-69   Brassica rapa
ref|XP_006356407.1|  PREDICTED: endoglucanase 25-like                   234   2e-69   Solanum tuberosum [potatoes]
emb|CDY21449.1|  BnaC03g27480D                                          234   2e-69   Brassica napus [oilseed rape]
ref|XP_004238641.1|  PREDICTED: endoglucanase 25-like                   234   2e-69   
gb|AAQ08018.1|  endo-1,4-beta-glucanase                                 233   3e-69   Gossypium hirsutum [American cotton]
gb|KJB66548.1|  hypothetical protein B456_010G143300                    233   3e-69   Gossypium raimondii
gb|ADY68794.1|  membrane-anchored endo-1,4-beta-glucanase               233   3e-69   Gossypium hirsutum [American cotton]
gb|AEN70810.1|  endo-1,4-beta-glucanase                                 233   4e-69   Gossypium hirsutum subsp. latifolium
gb|AEN70797.1|  endo-1,4-beta-glucanase                                 233   4e-69   Gossypium schwendimanii
gb|AAP83128.1|  endo-1,4-beta-glucanase                                 233   4e-69   Gossypium hirsutum [American cotton]
gb|AEN70798.1|  endo-1,4-beta-glucanase                                 233   4e-69   Gossypium turneri
gb|ADY68792.1|  membrane-anchored endo-1,4-beta-glucanase               233   4e-69   Gossypium herbaceum subsp. africanum
gb|AEN70809.1|  endo-1,4-beta-glucanase                                 233   4e-69   Gossypium hirsutum subsp. latifolium
gb|AAS87601.1|  membrane-anchored endo-1,4-beta-glucanase               233   4e-69   Gossypium hirsutum [American cotton]
gb|ADY68791.1|  membrane-anchored endo-1,4-beta-glucanase               233   4e-69   Gossypium barbadense [Egyptian cotton]
gb|AEN70816.1|  endo-1,4-beta-glucanase                                 233   4e-69   Gossypium gossypioides
ref|XP_004171003.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    233   5e-69   
gb|AGV22123.1|  endo-1,4-beta-glucanase 1                               233   5e-69   Betula luminifera [liang ye hua]
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        238   6e-69   
ref|XP_006402246.1|  hypothetical protein EUTSA_v10012932mg             233   7e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006402245.1|  hypothetical protein EUTSA_v10012932mg             233   9e-69   
ref|XP_011022354.1|  PREDICTED: endoglucanase 25-like                   231   4e-68   Populus euphratica
gb|KFK26611.1|  hypothetical protein AALP_AA8G271400                    231   4e-68   Arabis alpina [alpine rockcress]
gb|AEO97184.1|  endo-1,4-beta-glucanase                                 230   5e-68   Populus trichocarpa [western balsam poplar]
dbj|BAH57006.1|  AT5G49720                                              229   5e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006385837.1|  endo-1 family protein                              230   6e-68   Populus trichocarpa [western balsam poplar]
gb|AHA41508.1|  endo-1,4 -beta-glucanase                                230   9e-68   Populus deltoides
ref|NP_199783.1|  endo-1,4-beta-D-glucanase                             230   9e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAN72232.1|  At5g49720/K2I5_8                                        229   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147545.1|  hypothetical protein PHAVU_006G133700g             229   1e-67   Phaseolus vulgaris [French bean]
ref|XP_002865753.1|  hypothetical protein ARALYDRAFT_495032             229   1e-67   Arabidopsis lyrata subsp. lyrata
gb|AAT75041.1|  Cel9A                                                   229   1e-67   Populus tremula x Populus tremuloides
gb|AEO97239.1|  endo-1,4-beta-glucanase                                 229   1e-67   Populus tomentosa [Chinese white poplar]
gb|AEO97182.1|  endo-1,4-beta-glucanase                                 229   1e-67   Populus tomentosa [Chinese white poplar]
gb|AEO97238.1|  endo-1,4-beta-glucanase                                 229   1e-67   Populus tomentosa [Chinese white poplar]
gb|AEO97265.1|  endo-1,4-beta-glucanase                                 229   1e-67   Populus tomentosa [Chinese white poplar]
ref|XP_010441020.1|  PREDICTED: endoglucanase 25                        229   1e-67   Camelina sativa [gold-of-pleasure]
gb|AEO97252.1|  endo-1,4-beta-glucanase                                 229   2e-67   Populus tomentosa [Chinese white poplar]
ref|XP_010442441.1|  PREDICTED: endoglucanase 25                        229   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_003594425.1|  Endoglucanase                                      229   2e-67   Medicago truncatula
ref|XP_009123553.1|  PREDICTED: endoglucanase 25                        229   2e-67   Brassica rapa
emb|CDY37768.1|  BnaA10g05530D                                          229   2e-67   Brassica napus [oilseed rape]
ref|XP_010482263.1|  PREDICTED: endoglucanase 25-like                   228   4e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006281810.1|  hypothetical protein CARUB_v10027986mg             228   6e-67   Capsella rubella
ref|XP_007222007.1|  hypothetical protein PRUPE_ppa002911mg             228   7e-67   Prunus persica
emb|CDX71601.1|  BnaC09g26420D                                          227   8e-67   
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        231   1e-66   Populus euphratica
dbj|BAF42036.1|  cellulase1                                             227   1e-66   Pyrus communis
dbj|BAC22690.1|  endo-1,4-beta-D-glucanase                              226   2e-66   Pyrus communis
gb|AAS45400.1|  endo-1,4-beta-glucanase                                 226   2e-66   Populus tremuloides
gb|ADB82903.1|  membrane-bound endo-beta-1,4-glucanase                  226   3e-66   Populus alba x Populus grandidentata
gb|ABD62083.1|  endo-1,4-beta-glucancase precursor                      225   4e-66   Glycine max [soybeans]
gb|AAK59818.1|  AT5g49720/K2I5_8                                        225   5e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63370.1|  cellulase homolog OR16pep precursor                     225   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339246.1|  PREDICTED: endoglucanase 25-like                   225   6e-66   Malus domestica [apple tree]
ref|XP_003535026.1|  PREDICTED: endoglucanase 25                        225   6e-66   
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        229   6e-66   
ref|XP_004486415.1|  PREDICTED: endoglucanase 25-like                   224   7e-66   Cicer arietinum [garbanzo]
ref|XP_010266669.1|  PREDICTED: endoglucanase 9-like                    224   1e-65   Nelumbo nucifera [Indian lotus]
gb|AEO97185.1|  endo-1,4-beta-glucanase                                 223   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002299405.1|  endo-1 family protein                              223   3e-65   
gb|AEO97183.1|  endo-1,4-beta-glucanase                                 223   3e-65   Populus tomentosa [Chinese white poplar]
ref|XP_003546229.1|  PREDICTED: endoglucanase 25-like                   223   3e-65   Glycine max [soybeans]
ref|XP_006413454.1|  hypothetical protein EUTSA_v10024681mg             222   8e-65   
gb|AEO97283.1|  endo-1,4-beta-glucanase                                 221   9e-65   Populus tomentosa [Chinese white poplar]
ref|XP_006858422.1|  hypothetical protein AMTR_s00071p00064260          221   1e-64   Amborella trichopoda
gb|EYU35397.1|  hypothetical protein MIMGU_mgv1a003033mg                220   3e-64   Erythranthe guttata [common monkey flower]
gb|ABR15471.1|  endoglucanase                                           220   4e-64   Pinus taeda
ref|XP_009355455.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    224   4e-64   
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    224   6e-64   
ref|XP_010529892.1|  PREDICTED: endoglucanase 25-like                   219   1e-63   Tarenaya hassleriana [spider flower]
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        223   1e-63   Fragaria vesca subsp. vesca
gb|AEL88496.1|  membrane-bound endo-1,4-beta-glucanase                  215   3e-62   Picea glauca
ref|XP_009340771.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    214   5e-62   
gb|KCW62543.1|  hypothetical protein EUGRSUZ_G00035                     211   2e-61   Eucalyptus grandis [rose gum]
ref|XP_003529689.1|  PREDICTED: endoglucanase 25-like                   213   2e-61   Glycine max [soybeans]
ref|XP_010682188.1|  PREDICTED: endoglucanase 25                        212   3e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|AFD33696.1|  korrigan                                                212   6e-61   Eucalyptus camaldulensis
gb|ABR16291.1|  unknown                                                 211   6e-61   Picea sitchensis
gb|EPS69180.1|  hypothetical protein M569_05586                         211   1e-60   Genlisea aurea
ref|XP_003550680.1|  PREDICTED: endoglucanase 25-like                   211   1e-60   Glycine max [soybeans]
ref|XP_010065200.1|  PREDICTED: endoglucanase 25-like                   210   2e-60   Eucalyptus grandis [rose gum]
ref|XP_009400506.1|  PREDICTED: endoglucanase 10-like                   210   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFY03622.1|  endo-1,4-beta-glucanase                                 210   2e-60   Eucalyptus globulus [blue gum]
ref|XP_007154086.1|  hypothetical protein PHAVU_003G089600g             210   3e-60   Phaseolus vulgaris [French bean]
ref|XP_010433798.1|  PREDICTED: endoglucanase 21-like                   208   9e-60   Camelina sativa [gold-of-pleasure]
gb|KHN14382.1|  Endoglucanase 25                                        208   1e-59   Glycine soja [wild soybean]
ref|XP_010439066.1|  PREDICTED: endoglucanase 21                        207   2e-59   Camelina sativa [gold-of-pleasure]
gb|EPS66085.1|  hypothetical protein M569_08689                         207   3e-59   Genlisea aurea
ref|XP_010448587.1|  PREDICTED: endoglucanase 21-like                   206   5e-59   Camelina sativa [gold-of-pleasure]
gb|KFK22234.1|  hypothetical protein AALP_AAs42893U000400               205   2e-58   Arabis alpina [alpine rockcress]
ref|XP_009395086.1|  PREDICTED: endoglucanase 10-like                   204   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABP96983.1|  cellulase                                               204   3e-58   Colocasia esculenta [cocoyam]
ref|XP_002465324.1|  hypothetical protein SORBIDRAFT_01g036480          204   4e-58   Sorghum bicolor [broomcorn]
ref|XP_002867672.1|  predicted protein                                  203   6e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_010909007.1|  PREDICTED: endoglucanase 10-like                   202   1e-57   Elaeis guineensis
ref|XP_004984503.1|  PREDICTED: endoglucanase 9-like                    202   1e-57   Setaria italica
ref|XP_008782747.1|  PREDICTED: endoglucanase 9-like                    201   4e-57   Phoenix dactylifera
ref|XP_010921267.1|  PREDICTED: endoglucanase 9-like                    201   5e-57   Elaeis guineensis
ref|XP_008793381.1|  PREDICTED: endoglucanase 9-like                    201   5e-57   Phoenix dactylifera
ref|NP_194157.1|  endoglucanase 21                                      201   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283336.1|  hypothetical protein CARUB_v10004382mg             201   6e-57   Capsella rubella
ref|XP_008803421.1|  PREDICTED: endoglucanase 10-like                   199   2e-56   Phoenix dactylifera
ref|XP_009417855.1|  PREDICTED: endoglucanase 9-like                    199   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001183308.1|  hypothetical protein                               199   2e-56   Zea mays [maize]
ref|NP_001050004.1|  Os03g0329500                                       198   7e-56   
ref|NP_001147537.1|  endo-1,4-beta-glucanase                            197   1e-55   Zea mays [maize]
ref|XP_006650027.1|  PREDICTED: endoglucanase 9-like                    196   3e-55   Oryza brachyantha
emb|CDX92628.1|  BnaC07g38860D                                          195   6e-55   
ref|XP_009406859.1|  PREDICTED: endoglucanase 9-like                    195   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011088109.1|  PREDICTED: endoglucanase 25-like                   194   1e-54   
ref|XP_010938102.1|  PREDICTED: endoglucanase 9-like                    194   2e-54   Elaeis guineensis
ref|XP_003557996.1|  PREDICTED: endoglucanase 9                         194   2e-54   Brachypodium distachyon [annual false brome]
gb|EEE58992.1|  hypothetical protein OsJ_10702                          193   3e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137436.1|  PREDICTED: endoglucanase 21-like                   189   8e-53   Brassica rapa
ref|XP_009399913.1|  PREDICTED: endoglucanase 9-like                    190   9e-53   
dbj|BAK04500.1|  predicted protein                                      188   3e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGK26802.1|  endo-beta-1,4-glucanase                                 187   9e-52   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26803.1|  endo-beta-1,4-glucanase                                 186   2e-51   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26798.1|  endo-beta-1,4-glucanase                                 186   2e-51   Triticum aestivum [Canadian hard winter wheat]
gb|AGK26801.1|  endo-beta-1,4-glucanase                                 186   2e-51   Triticum aestivum [Canadian hard winter wheat]
emb|CDY03467.1|  BnaC01g16150D                                          185   2e-51   
emb|CDY34271.1|  BnaA01g13740D                                          182   2e-50   Brassica napus [oilseed rape]
ref|XP_009137865.1|  PREDICTED: endoglucanase 21                        182   4e-50   Brassica rapa
tpg|DAA51201.1|  TPA: endo-1,4-beta-glucanase Cel1                      170   1e-45   
ref|XP_002463915.1|  hypothetical protein SORBIDRAFT_01g008860          169   1e-45   Sorghum bicolor [broomcorn]
ref|NP_001151770.1|  endo-1,4-beta-glucanase Cel1                       169   1e-45   
emb|CDI66528.1|  Endoglucanase 10                                       169   2e-45   Saccharum hybrid cultivar R570
emb|CDI66566.1|  Endoglucanase 10                                       169   2e-45   Saccharum hybrid cultivar R570
gb|ACN28577.1|  unknown                                                 169   2e-45   Zea mays [maize]
ref|NP_001051192.1|  Os03g0736300                                       166   3e-44   
ref|XP_004981854.1|  PREDICTED: endoglucanase 10-like                   164   9e-44   Setaria italica
emb|CBB36505.1|  Hordeum vulgare protein similar to endo-1,4-b-gl...    164   2e-43   Saccharum hybrid cultivar R570
ref|XP_006650552.1|  PREDICTED: endoglucanase 10-like                   161   1e-42   Oryza brachyantha
ref|XP_010277803.1|  PREDICTED: endoglucanase 12-like                   160   3e-42   Nelumbo nucifera [Indian lotus]
ref|XP_006858738.1|  hypothetical protein AMTR_s00066p00128970          159   7e-42   Amborella trichopoda
emb|CDI66602.1|  Endoglucanase 10                                       159   7e-42   Saccharum hybrid cultivar R570
ref|XP_009385674.1|  PREDICTED: endoglucanase 12-like                   159   9e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACZ82300.1|  beta-1,4 glycosidase                                    158   2e-41   Phyllostachys edulis [kikko-chiku]
dbj|BAJ94336.1|  predicted protein                                      157   3e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP21162.1|  unnamed protein product                                156   9e-41   Coffea canephora [robusta coffee]
dbj|BAA94257.1|  endo-1,4-beta-glucanase Cel1                           155   1e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU39502.1|  hypothetical protein MIMGU_mgv1a002977mg                155   3e-40   Erythranthe guttata [common monkey flower]
gb|ACT54547.1|  endo-1,4-beta-glucanase                                 153   7e-40   Dimocarpus longan [longan]
ref|XP_003560035.1|  PREDICTED: endoglucanase 10                        152   2e-39   Brachypodium distachyon [annual false brome]
gb|EMT18790.1|  Endoglucanase 9                                         151   5e-39   
ref|XP_010930303.1|  PREDICTED: endoglucanase 12-like                   151   6e-39   Elaeis guineensis
gb|AAM13693.1|  endo-1,4-beta-glucanase                                 150   9e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002983992.1|  hypothetical protein SELMODRAFT_268803             150   1e-38   
ref|XP_002960146.1|  hypothetical protein SELMODRAFT_266522             150   2e-38   
gb|KDP32490.1|  hypothetical protein JCGZ_13415                         147   1e-37   Jatropha curcas
gb|AFR40441.1|  cellulase                                               136   2e-37   Populus nigra [black poplar]
gb|AFR40405.1|  cellulase                                               136   2e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40409.1|  cellulase                                               136   2e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40402.1|  cellulase                                               136   2e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40406.1|  cellulase                                               136   2e-37   Populus trichocarpa [western balsam poplar]
gb|AFR40430.1|  cellulase                                               135   4e-37   Populus fremontii
ref|NP_001147970.1|  glycoside transferase, six-hairpin, subgroup       145   5e-37   Zea mays [maize]
ref|NP_001288466.1|  endoglucanase 12-like                              145   7e-37   Zea mays [maize]
ref|XP_008813788.1|  PREDICTED: endoglucanase 12-like                   145   8e-37   Phoenix dactylifera
gb|AFR40432.1|  cellulase                                               134   1e-36   Populus fremontii
gb|AFR40424.1|  cellulase                                               134   1e-36   Populus fremontii
gb|AFR40426.1|  cellulase                                               134   1e-36   Populus fremontii
gb|AFR40428.1|  cellulase                                               134   2e-36   Populus fremontii
ref|XP_004976098.1|  PREDICTED: endoglucanase 12-like                   144   2e-36   Setaria italica
sp|Q7XUK4.2|GUN12_ORYSJ  RecName: Full=Endoglucanase 12; AltName:...    143   3e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652472.1|  PREDICTED: endoglucanase 12-like                   143   3e-36   Oryza brachyantha
ref|XP_009602898.1|  PREDICTED: endoglucanase 12                        143   4e-36   Nicotiana tomentosiformis
gb|AFR40408.1|  cellulase                                               132   7e-36   Populus trichocarpa [western balsam poplar]
gb|AFR40412.1|  cellulase                                               132   7e-36   Populus trichocarpa [western balsam poplar]
ref|XP_009782313.1|  PREDICTED: endoglucanase 12                        142   8e-36   Nicotiana sylvestris
ref|XP_002514768.1|  endo-1,4-beta-glucanase, putative                  142   9e-36   Ricinus communis
ref|XP_011010912.1|  PREDICTED: endoglucanase 12                        142   1e-35   Populus euphratica
ref|XP_006353239.1|  PREDICTED: endoglucanase 12-like                   142   1e-35   Solanum tuberosum [potatoes]
ref|XP_008801082.1|  PREDICTED: endoglucanase 12-like                   141   2e-35   Phoenix dactylifera
ref|XP_011077092.1|  PREDICTED: endoglucanase 12                        141   2e-35   Sesamum indicum [beniseed]
ref|XP_004976099.1|  PREDICTED: endoglucanase 12-like                   141   2e-35   Setaria italica
gb|AGG19084.1|  cellulase                                               140   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010065082.1|  PREDICTED: endoglucanase 12                        140   5e-35   Eucalyptus grandis [rose gum]
ref|XP_010929679.1|  PREDICTED: endoglucanase 12-like                   140   5e-35   Elaeis guineensis
ref|XP_003580066.1|  PREDICTED: endoglucanase 12                        140   6e-35   Brachypodium distachyon [annual false brome]
gb|AEO97186.1|  endo-1,4-beta-glucanase                                 139   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004503186.1|  PREDICTED: endoglucanase 25-like                   133   1e-34   
ref|XP_002961082.1|  hypothetical protein SELMODRAFT_75214              139   1e-34   
gb|AFZ78628.1|  korrigan                                                139   2e-34   Populus tomentosa [Chinese white poplar]
gb|AFZ78629.1|  korrigan                                                138   2e-34   Populus tomentosa [Chinese white poplar]
ref|XP_002966925.1|  hypothetical protein SELMODRAFT_408186             138   2e-34   
ref|XP_002312211.1|  endo-1 family protein                              138   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_011014603.1|  PREDICTED: endoglucanase 12-like isoform X1        136   1e-33   Populus euphratica
ref|XP_002446733.1|  hypothetical protein SORBIDRAFT_06g021440          135   3e-33   Sorghum bicolor [broomcorn]
ref|XP_007028162.1|  Six-hairpin glycosidases superfamily protein       134   4e-33   
ref|XP_006468640.1|  PREDICTED: endoglucanase 12-like                   134   7e-33   Citrus sinensis [apfelsine]
ref|XP_010673846.1|  PREDICTED: endoglucanase 12-like                   134   9e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY94707.1|  hypothetical protein OsI_16485                          132   3e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_006448516.1|  hypothetical protein CICLE_v10014583mg             132   4e-32   Citrus clementina [clementine]
gb|EMT15171.1|  Endoglucanase 12                                        131   6e-32   
ref|XP_004250089.1|  PREDICTED: endoglucanase 12                        129   6e-31   Solanum lycopersicum
ref|NP_176738.1|  glycosyl hydrolase 9A2                                128   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415102.1|  PREDICTED: endoglucanase 7-like                    127   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010528623.1|  PREDICTED: endoglucanase 7                         127   3e-30   Tarenaya hassleriana [spider flower]
ref|NP_001288520.1|  uncharacterized protein LOC103641803               126   7e-30   Zea mays [maize]
ref|XP_008791029.1|  PREDICTED: endoglucanase 12-like                   125   7e-30   Phoenix dactylifera
ref|XP_010533225.1|  PREDICTED: endoglucanase 25-like                   125   7e-30   Tarenaya hassleriana [spider flower]
ref|XP_001772986.1|  predicted protein                                  125   9e-30   
ref|XP_003601506.1|  Endoglucanase                                      125   1e-29   Medicago truncatula
ref|XP_010496067.1|  PREDICTED: endoglucanase 7                         124   3e-29   Camelina sativa [gold-of-pleasure]
ref|XP_004152840.1|  PREDICTED: endoglucanase 7-like                    124   3e-29   Cucumis sativus [cucumbers]
ref|XP_004169320.1|  PREDICTED: endoglucanase 7-like                    124   3e-29   
gb|KHN09941.1|  Endoglucanase 7                                         124   4e-29   Glycine soja [wild soybean]
ref|XP_003556773.1|  PREDICTED: endoglucanase 12-like                   124   4e-29   Glycine max [soybeans]
ref|XP_008441913.1|  PREDICTED: endoglucanase 7                         122   2e-28   Cucumis melo [Oriental melon]
ref|XP_002888427.1|  hypothetical protein ARALYDRAFT_894138             121   3e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_009403795.1|  PREDICTED: endoglucanase 12-like                   120   8e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006300882.1|  hypothetical protein CARUB_v10019972mg             119   2e-27   Capsella rubella
ref|XP_009127411.1|  PREDICTED: endoglucanase 7                         119   2e-27   Brassica rapa
ref|XP_004502103.1|  PREDICTED: endoglucanase 12-like                   117   6e-27   Cicer arietinum [garbanzo]
gb|KFK41003.1|  hypothetical protein AALP_AA2G072700                    115   3e-26   Arabis alpina [alpine rockcress]
ref|XP_001775325.1|  predicted protein                                  115   4e-26   
ref|XP_006391540.1|  hypothetical protein EUTSA_v10018270mg             114   1e-25   Eutrema salsugineum [saltwater cress]
gb|AFR40403.1|  cellulase                                             99.4    2e-23   Populus trichocarpa [western balsam poplar]
gb|EMS51342.1|  Endoglucanase 9                                         107   3e-23   Triticum urartu
gb|EPS58029.1|  endo-1,4-beta-glucanase                                 106   8e-23   Genlisea aurea
ref|XP_001759056.1|  predicted protein                                  106   8e-23   
ref|XP_010646848.1|  PREDICTED: endoglucanase 12                        103   3e-22   
gb|EMT00674.1|  Endoglucanase 10                                      97.8    6e-20   
gb|AFR40414.1|  cellulase                                             89.7    7e-20   Populus trichocarpa [western balsam poplar]
gb|EMS52550.1|  Endoglucanase 10                                      94.7    6e-19   Triticum urartu
ref|XP_008370239.1|  PREDICTED: endoglucanase 9-like                  90.5    4e-18   
emb|CDY45056.1|  BnaA08g02190D                                        91.3    1e-17   Brassica napus [oilseed rape]
ref|XP_002515321.1|  endo-1,4-beta-glucanase, putative                90.1    2e-17   Ricinus communis
ref|XP_009339798.1|  PREDICTED: endoglucanase 9-like                  88.2    2e-16   Pyrus x bretschneideri [bai li]
emb|CBI29606.3|  unnamed protein product                              86.3    4e-16   Vitis vinifera
ref|XP_007216021.1|  hypothetical protein PRUPE_ppa014845mg           85.1    1e-15   
ref|XP_001754846.1|  predicted protein                                85.5    1e-15   
ref|XP_008243721.1|  PREDICTED: endoglucanase 9-like                  84.3    2e-15   Prunus mume [ume]
ref|XP_008235173.1|  PREDICTED: endoglucanase 9-like                  84.3    3e-15   Prunus mume [ume]
ref|XP_007199407.1|  hypothetical protein PRUPE_ppa026228mg           84.0    3e-15   Prunus persica
ref|XP_001763929.1|  predicted protein                                83.6    5e-15   
ref|XP_003635672.1|  PREDICTED: endoglucanase 12-like                 79.3    2e-14   Vitis vinifera
ref|XP_006444448.1|  hypothetical protein CICLE_v10024241mg           81.3    3e-14   Citrus clementina [clementine]
ref|XP_006480121.1|  PREDICTED: endoglucanase 25-like                 80.9    4e-14   Citrus sinensis [apfelsine]
ref|XP_009141938.1|  PREDICTED: endoglucanase 21-like                 80.9    4e-14   Brassica rapa
emb|CDP09829.1|  unnamed protein product                              79.7    8e-14   Coffea canephora [robusta coffee]
ref|XP_007146007.1|  hypothetical protein PHAVU_006G0049000g          74.7    1e-13   Phaseolus vulgaris [French bean]
gb|EMT22659.1|  Endoglucanase 12                                      77.0    6e-13   
emb|CDY06962.1|  BnaA04g23530D                                        71.6    3e-12   
gb|KJB49856.1|  hypothetical protein B456_008G141900                  74.3    5e-12   Gossypium raimondii
gb|AID55392.1|  glycoside hydrolase family 9 A6                       74.3    5e-12   Gossypium hirsutum [American cotton]
gb|KDO87072.1|  hypothetical protein CISIN_1g046335mg                 74.3    6e-12   Citrus sinensis [apfelsine]
gb|EYU33243.1|  hypothetical protein MIMGU_mgv1a024415mg              69.3    2e-11   Erythranthe guttata [common monkey flower]
gb|EYU33248.1|  hypothetical protein MIMGU_mgv1a018124mg              68.6    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_010673848.1|  PREDICTED: endoglucanase 12-like                 71.2    5e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010666165.1|  PREDICTED: endoglucanase 14-like                 68.9    2e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006403190.1|  hypothetical protein EUTSA_v10003366mg           68.2    6e-10   
ref|XP_007040357.1|  Glycosyl hydrolase 9B14                          67.4    9e-10   
gb|KHG30445.1|  hypothetical protein F383_13418                       66.6    1e-09   
gb|KJB65384.1|  hypothetical protein B456_010G092700                  66.6    1e-09   
gb|AID55389.1|  glycoside hydrolase family 9 A5                       66.6    1e-09   
emb|CDP14001.1|  unnamed protein product                              65.9    3e-09   
ref|XP_009607784.1|  PREDICTED: endoglucanase 12-like                 65.5    3e-09   
ref|XP_002122707.2|  PREDICTED: endoglucanase 13                      65.9    3e-09   
ref|XP_010413050.1|  PREDICTED: endoglucanase 14-like                 65.5    4e-09   
ref|XP_003611061.1|  Cellulase                                        65.5    4e-09   
ref|XP_010053064.1|  PREDICTED: endoglucanase 1-like                  65.5    4e-09   
ref|XP_007136892.1|  hypothetical protein PHAVU_009G082800g           65.5    4e-09   
gb|AAD28258.1|AF128404_1  cellulase homolog                           65.1    4e-09   
ref|XP_004511554.1|  PREDICTED: endoglucanase-like                    65.1    5e-09   
ref|XP_010688721.1|  PREDICTED: endoglucanase 5                       65.1    5e-09   
gb|ABC94541.1|  endo-1,4-beta-glucanase                               61.2    6e-09   
ref|XP_004241769.1|  PREDICTED: endoglucanase 16                      64.7    6e-09   
gb|KFK37261.1|  hypothetical protein AALP_AA4G234600                  64.7    7e-09   
ref|XP_010264780.1|  PREDICTED: endoglucanase 12-like                 64.7    7e-09   
ref|NP_181982.1|  glycosyl hydrolase 9B9                              64.3    8e-09   
ref|XP_010676410.1|  PREDICTED: endoglucanase-like isoform X1         64.3    8e-09   
ref|XP_006411695.1|  hypothetical protein EUTSA_v10025010mg           64.3    8e-09   
ref|XP_010676411.1|  PREDICTED: endoglucanase-like isoform X2         63.9    9e-09   
ref|XP_009101910.1|  PREDICTED: endoglucanase 23-like                 64.3    9e-09   
ref|XP_001640311.1|  predicted protein                                60.8    9e-09   
ref|XP_009771552.1|  PREDICTED: endoglucanase 13-like                 64.3    1e-08   
ref|XP_011101037.1|  PREDICTED: endoglucanase 6                       64.3    1e-08   
gb|KDO76343.1|  hypothetical protein CISIN_1g042201mg                 64.3    1e-08   
ref|XP_006477515.1|  PREDICTED: endoglucanase-like                    64.3    1e-08   
ref|XP_006439464.1|  hypothetical protein CICLE_v10023813mg           63.9    1e-08   
ref|XP_002440792.1|  hypothetical protein SORBIDRAFT_09g006670        64.3    1e-08   
ref|XP_010436996.1|  PREDICTED: endoglucanase 23-like                 63.9    1e-08   
ref|XP_002454930.1|  hypothetical protein SORBIDRAFT_03g001560        64.3    1e-08   
ref|XP_006355746.1|  PREDICTED: endoglucanase 14-like                 63.9    1e-08   
ref|XP_008775119.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  63.9    1e-08   
gb|AGV22124.1|  endo-1,4-beta-glucanase 2                             63.9    1e-08   
ref|XP_003611057.1|  Endo-1 4-beta-glucanase                          63.9    1e-08   
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  63.9    1e-08   
gb|KJB52202.1|  hypothetical protein B456_008G250400                  63.9    1e-08   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                 63.9    1e-08   
ref|XP_002881965.1|  glycosyl hydrolase family 9 protein              63.5    1e-08   
gb|AID55387.1|  glycoside hydrolase family 9 A4                       63.5    1e-08   
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg              63.5    1e-08   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  63.5    1e-08   
ref|XP_004240228.2|  PREDICTED: endoglucanase 13-like                 63.5    1e-08   
ref|XP_011164235.1|  PREDICTED: endoglucanase 19-like                 63.5    1e-08   
ref|XP_004301501.1|  PREDICTED: endoglucanase 5                       63.9    1e-08   
emb|CDY41954.1|  BnaA01g05260D                                        63.5    1e-08   
ref|XP_010053128.1|  PREDICTED: endoglucanase 6-like                  63.9    1e-08   
ref|XP_002881964.1|  glycosyl hydrolase family 9 protein              63.5    2e-08   
ref|XP_006476392.1|  PREDICTED: endoglucanase 6-like                  63.5    2e-08   
emb|CDX72723.1|  BnaC07g47450D                                        63.5    2e-08   
ref|XP_009144504.1|  PREDICTED: endoglucanase 23                      63.5    2e-08   
ref|XP_004960623.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  63.5    2e-08   
emb|CAN82881.1|  hypothetical protein VITISV_008555                   63.2    2e-08   
ref|XP_002272408.1|  PREDICTED: endoglucanase 13                      63.2    2e-08   
ref|NP_181983.1|  glycosyl hydrolase 9B10                             63.2    2e-08   
emb|CBI25462.3|  unnamed protein product                              63.2    2e-08   
emb|CDP12150.1|  unnamed protein product                              63.5    2e-08   
gb|KEH40907.1|  glycosyl hydrolase family 9 protein                   63.2    2e-08   
gb|ABD62089.1|  endo-1,4-beta-glucancase precursor                    60.1    2e-08   
ref|XP_010112623.1|  hypothetical protein L484_006703                 63.2    2e-08   
ref|NP_001234172.1|  endo-beta-1,4-D-glucanase precursor              63.5    2e-08   
ref|XP_002280120.2|  PREDICTED: endoglucanase 16-like                 63.2    2e-08   
ref|XP_010512853.1|  PREDICTED: endoglucanase 14                      63.2    2e-08   
gb|ABR10607.1|  endo-beta-1,4-glucanase                               63.2    2e-08   
emb|CDY47675.1|  BnaC04g03840D                                        63.2    2e-08   
ref|XP_006654154.1|  PREDICTED: endoglucanase 15-like                 63.2    2e-08   
ref|XP_010031904.1|  PREDICTED: endoglucanase 5                       63.2    2e-08   
gb|AID55390.1|  glycoside hydrolase family 9 B14                      63.2    2e-08   
ref|XP_010094077.1|  Endoglucanase 13                                 62.8    2e-08   
emb|CBI20730.3|  unnamed protein product                              63.2    2e-08   
ref|XP_004149748.1|  PREDICTED: endoglucanase 6-like                  63.2    2e-08   
gb|KEH21213.1|  endo-1,4-beta-glucanase                               63.2    3e-08   
ref|XP_006396968.1|  hypothetical protein EUTSA_v10028514mg           63.2    3e-08   
gb|KCW51302.1|  hypothetical protein EUGRSUZ_J00862                   63.2    3e-08   
ref|XP_002509954.1|  endo-1,4-beta-glucanase, putative                61.2    3e-08   
ref|XP_010431848.1|  PREDICTED: endoglucanase 23                      62.8    3e-08   
ref|XP_009143042.1|  PREDICTED: endoglucanase 14-like                 62.8    3e-08   
gb|KEH33107.1|  glycosyl hydrolase family 9 protein                   62.8    3e-08   
gb|EPS61761.1|  hypothetical protein M569_13033                       62.8    3e-08   
emb|CDX74667.1|  BnaA05g04130D                                        62.8    3e-08   
ref|XP_009383659.1|  PREDICTED: endoglucanase 13                      63.2    3e-08   
emb|CDY05130.1|  BnaC03g29280D                                        63.2    3e-08   
ref|NP_001054920.1|  Os05g0212300                                     63.2    3e-08   
ref|XP_010261581.1|  PREDICTED: endoglucanase 19-like                 63.2    3e-08   
ref|NP_181984.1|  glycosyl hydrolase 9B11                             62.8    3e-08   
ref|XP_008340449.1|  PREDICTED: endoglucanase 5                       63.2    3e-08   
ref|WP_011292599.1|  endoglucanase                                    63.2    3e-08   
emb|CDX74666.1|  BnaA05g04120D                                        62.8    3e-08   
ref|XP_009143044.1|  PREDICTED: endoglucanase 12-like                 62.8    3e-08   
emb|CDX74664.1|  BnaA05g04100D                                        62.8    3e-08   
ref|XP_009346446.1|  PREDICTED: endoglucanase 6-like                  62.8    3e-08   
gb|EAY96964.1|  hypothetical protein OsI_18884                        62.8    3e-08   
ref|XP_010932722.1|  PREDICTED: endoglucanase 8-like                  62.8    3e-08   
ref|XP_002303645.1|  endo-glucanase 2 family protein                  62.8    3e-08   
ref|XP_010435611.1|  PREDICTED: endoglucanase 19 isoform X1           62.8    3e-08   
ref|XP_002874671.1|  hypothetical protein ARALYDRAFT_489943           62.8    3e-08   
ref|XP_011026902.1|  PREDICTED: endoglucanase 6-like                  62.8    3e-08   
ref|XP_008341511.1|  PREDICTED: endoglucanase 6                       62.8    3e-08   
ref|XP_002881963.1|  glycosyl hydrolase family 9 protein              62.8    3e-08   
ref|XP_010435618.1|  PREDICTED: endoglucanase 19 isoform X2           62.8    3e-08   
emb|CDP21985.1|  unnamed protein product                              59.7    3e-08   
gb|AAC35539.1|  contains similarity to glycosyl hydrolases family...  62.8    3e-08   
ref|NP_192843.2|  glycosyl hydrolase 9C3                              62.8    3e-08   
ref|XP_004308724.1|  PREDICTED: endoglucanase 14-like                 62.8    3e-08   
ref|XP_010915660.1|  PREDICTED: endoglucanase 19-like                 62.8    3e-08   
gb|KEH21214.1|  endo-1,4-beta-glucanase                               62.8    3e-08   
gb|KHN32282.1|  Endoglucanase 5                                       62.8    3e-08   
ref|WP_043431762.1|  glycoside hydrolase                              62.8    3e-08   
emb|CDX90780.1|  BnaA03g24600D                                        62.8    3e-08   
emb|CDY47674.1|  BnaC04g03850D                                        62.4    3e-08   
gb|KFK28905.1|  hypothetical protein AALP_AA7G063600                  62.4    3e-08   
ref|XP_010096825.1|  Endoglucanase 6                                  62.4    3e-08   
ref|XP_007163509.1|  hypothetical protein PHAVU_001G239900g           62.4    3e-08   
gb|AGG19087.1|  cellulase                                             62.4    3e-08   
ref|XP_010026746.1|  PREDICTED: endoglucanase 19-like                 61.2    3e-08   
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg              62.4    3e-08   
pdb|1JS4|A  Chain A, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOS...  62.8    3e-08   
ref|XP_009405235.1|  PREDICTED: endoglucanase 13-like                 62.4    3e-08   
ref|XP_011074347.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  62.8    3e-08   
ref|XP_008451938.1|  PREDICTED: endoglucanase 6-like                  62.8    4e-08   
ref|XP_009134219.1|  PREDICTED: endoglucanase 19 isoform X2           62.8    4e-08   
ref|XP_009134218.1|  PREDICTED: endoglucanase 19 isoform X1           62.8    4e-08   
gb|ADX41578.1|  Cel9A                                                 62.8    4e-08   
ref|XP_006286846.1|  hypothetical protein CARUB_v10003874mg           62.4    4e-08   
ref|XP_010455501.1|  PREDICTED: endoglucanase 19-like isoform X2      62.4    4e-08   
gb|EPS71030.1|  hypothetical protein M569_03731                       62.4    4e-08   
ref|XP_010455500.1|  PREDICTED: endoglucanase 19-like isoform X1      62.4    4e-08   
gb|EEE62738.1|  hypothetical protein OsJ_17541                        62.8    4e-08   
emb|CDS02875.1|  hypothetical protein LRAMOSA00278                    62.4    4e-08   
gb|EPX59407.1|  Endo-1,4-beta-xylanase A precursor                    62.8    4e-08   
ref|WP_033300787.1|  endoglucanase                                    62.8    4e-08   
emb|CBI27137.3|  unnamed protein product                              62.4    4e-08   
gb|KJB24217.1|  hypothetical protein B456_004G133700                  62.4    4e-08   
ref|WP_030479897.1|  endoglucanase                                    62.8    4e-08   
gb|AAN04496.2|  endo-1,4-beta-glucanase                               62.4    4e-08   
ref|XP_001774444.1|  predicted protein                                62.4    4e-08   
ref|XP_002277177.2|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5  62.4    4e-08   
gb|AID55382.1|  glycoside hydrolase family 9 C4                       62.4    4e-08   
ref|XP_001768193.1|  predicted protein                                62.4    4e-08   
gb|KHG13636.1|  hypothetical protein F383_04399                       62.4    4e-08   
ref|XP_004501427.1|  PREDICTED: endoglucanase 16-like                 62.0    4e-08   
gb|KJB19010.1|  hypothetical protein B456_003G080800                  62.4    4e-08   
ref|XP_006294088.1|  hypothetical protein CARUB_v10023082mg           62.0    4e-08   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                       62.0    4e-08   
emb|CDX74668.1|  BnaA05g04140D                                        62.0    4e-08   
ref|XP_010446419.1|  PREDICTED: endoglucanase 23                      62.0    5e-08   
ref|XP_009143046.1|  PREDICTED: endoglucanase 14-like                 62.0    5e-08   
gb|KJB24219.1|  hypothetical protein B456_004G133700                  62.0    5e-08   
ref|XP_010506383.1|  PREDICTED: endoglucanase 15-like                 62.0    5e-08   
ref|NP_001048297.1|  Os02g0778600                                     62.0    5e-08   
gb|KJB24218.1|  hypothetical protein B456_004G133700                  62.0    5e-08   
ref|XP_006413937.1|  hypothetical protein EUTSA_v10027553mg           62.0    5e-08   
ref|XP_004503629.1|  PREDICTED: endoglucanase 6-like                  62.0    5e-08   
ref|XP_011022506.1|  PREDICTED: endoglucanase 6                       62.0    5e-08   
gb|KJB19013.1|  hypothetical protein B456_003G080800                  62.0    5e-08   
ref|XP_008786736.1|  PREDICTED: endoglucanase 8-like                  62.0    5e-08   
ref|XP_010913688.1|  PREDICTED: endoglucanase 6                       62.0    5e-08   
ref|XP_008437724.1|  PREDICTED: endoglucanase-like                    62.0    5e-08   
ref|XP_008221053.1|  PREDICTED: endoglucanase 5                       62.0    5e-08   
gb|EAZ07843.1|  hypothetical protein OsI_30101                        62.0    5e-08   
ref|XP_008784873.1|  PREDICTED: endoglucanase 1-like                  62.0    5e-08   
ref|XP_010549156.1|  PREDICTED: endoglucanase 5                       62.0    5e-08   
ref|XP_010424527.1|  PREDICTED: endoglucanase 19-like                 62.0    5e-08   
gb|ABF98747.1|  endo-1,4-beta-glucanase Cel1, putative, expressed     62.0    5e-08   
gb|KFK30485.1|  hypothetical protein AALP_AA7G267500                  62.4    5e-08   
ref|XP_010693008.1|  PREDICTED: endoglucanase 16                      62.0    5e-08   
dbj|BAJ96589.1|  predicted protein                                    62.0    5e-08   
gb|KJB19011.1|  hypothetical protein B456_003G080800                  62.0    6e-08   
gb|EMT30810.1|  Endoglucanase 4                                       61.6    6e-08   
gb|KJB52282.1|  hypothetical protein B456_008G254000                  62.0    6e-08   
ref|XP_009150280.1|  PREDICTED: endoglucanase 16-like                 61.6    6e-08   
gb|EMT30809.1|  Endoglucanase 4                                       61.6    6e-08   
ref|XP_003570500.1|  PREDICTED: endoglucanase 8                       61.6    6e-08   
ref|XP_006439358.1|  hypothetical protein CICLE_v10019301mg           62.0    6e-08   
ref|NP_001042867.2|  Os01g0312800                                     61.6    6e-08   
ref|XP_006858456.1|  hypothetical protein AMTR_s00071p00095020        62.0    6e-08   
ref|WP_013732376.1|  endoglucanase                                    62.0    6e-08   
emb|CDY10895.1|  BnaC01g15100D                                        61.6    6e-08   
ref|XP_003540637.2|  PREDICTED: endoglucanase 5                       62.0    6e-08   
ref|XP_010917237.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  61.6    6e-08   
ref|WP_044141890.1|  endoglucanase                                    62.0    6e-08   
gb|ETT38624.1|  hypothetical protein C161_06036                       62.0    6e-08   
gb|KDO76512.1|  hypothetical protein CISIN_1g006835mg                 62.0    6e-08   
gb|KDO76743.1|  hypothetical protein CISIN_1g010632mg                 61.6    6e-08   
emb|CDY30943.1|  BnaA06g19700D                                        61.6    6e-08   
ref|XP_004143969.1|  PREDICTED: endoglucanase-like                    61.6    6e-08   
gb|KJB19012.1|  hypothetical protein B456_003G080800                  61.6    6e-08   
gb|AAP38171.1|  endo-1,4-beta-glucanase                               61.6    6e-08   
ref|XP_007153086.1|  hypothetical protein PHAVU_003G005700g           61.6    6e-08   
ref|XP_009351718.1|  PREDICTED: endoglucanase 5                       62.0    6e-08   
ref|XP_010314503.1|  PREDICTED: endoglucanase 6-like                  62.0    6e-08   
ref|WP_037655280.1|  endoglucanase                                    62.0    6e-08   
gb|ABC94540.1|  endo-1,4-beta-glucanase                               58.5    6e-08   
ref|XP_009137168.1|  PREDICTED: endoglucanase 20                      61.6    6e-08   
ref|XP_002299478.2|  endo-glucanase 2 family protein                  62.0    6e-08   
ref|XP_006375102.1|  hypothetical protein POPTR_0014s04390g           59.7    6e-08   
gb|AFZ78640.1|  korrigan                                              62.0    6e-08   
ref|XP_008805729.1|  PREDICTED: endoglucanase 13                      62.0    6e-08   
gb|AEO97206.1|  endo-1,4-beta-glucanase                               62.0    6e-08   
ref|XP_006843371.1|  hypothetical protein AMTR_s00053p00085940        61.6    6e-08   
ref|XP_006298937.1|  hypothetical protein CARUB_v10015060mg           61.6    7e-08   
gb|EGJ33758.1|  glycosyl hydrolase family 9                           61.6    7e-08   
gb|AFZ78641.1|  korrigan                                              61.6    7e-08   
ref|XP_009626013.1|  PREDICTED: endoglucanase 6-like                  61.6    7e-08   
gb|KJB52283.1|  hypothetical protein B456_008G254000                  61.6    7e-08   
ref|XP_008239042.1|  PREDICTED: endoglucanase 6                       61.6    7e-08   
ref|WP_036269084.1|  hypothetical protein                             61.6    7e-08   
ref|NP_001042421.1|  Os01g0219600                                     61.6    7e-08   
ref|WP_043615544.1|  endoglucanase                                    62.0    7e-08   
ref|XP_007210281.1|  hypothetical protein PRUPE_ppa002939mg           61.6    7e-08   
emb|CAI68020.1|  endo-beta-1,4-glucanase                              61.6    7e-08   
ref|WP_044492536.1|  glycosyl hydrolase family 9                      61.6    7e-08   
ref|XP_008232281.1|  PREDICTED: endoglucanase 14-like                 60.8    7e-08   
ref|XP_006843620.1|  hypothetical protein AMTR_s00007p00146230        59.7    7e-08   
ref|XP_004309535.1|  PREDICTED: endoglucanase CX-like                 61.6    7e-08   
gb|KHN32164.1|  Endoglucanase 16                                      61.2    7e-08   
gb|ETT50503.1|  hypothetical protein C170_16175                       62.0    7e-08   
ref|WP_036669167.1|  glycoside hydrolase                              62.0    7e-08   
ref|XP_006285298.1|  hypothetical protein CARUB_v10006679mg           61.6    7e-08   



>ref|XP_009770880.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=619

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 154/165 (93%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEIHA DSATDDDRSRNL D DRAALSR+LDETQQSWLLGPTEQKKK+
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDDRSRNLGDFDRAALSRNLDETQQSWLLGPTEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+FKWTVGS+LAAA+L G I +IVK  PRH   NPPPDNYT+ALHKALM
Sbjct  61   YVDLGCIIVSRKIFKWTVGSILAAALLAGFITMIVKLAPRHKHHNPPPDNYTVALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDA
Sbjct  121  FFNAQKSGKLPKHNNVSWRGNSCLKDGKSDDSTMFKNLVGGYYDA  165



>gb|KJB70737.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=498

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP+EQ KKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPSEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG+++ +AVL GLI LIVKTVPRHH   PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLVVSAVLAGLITLIVKTVPRHHHGKPPPDNYTLALHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSGKLPKHNNVSWRGNSC+RDGKSD  T  KDLVGGYYDA
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDGKSDPGTTMKDLVGGYYDA  166



>ref|XP_006358489.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=617

 Score =   246 bits (628),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIH  DSATDDDRSRNLQD DRAA+SRSLDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHTADSATDDDRSRNLQDFDRAAMSRSLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWTVG ++AAA+L G I +IVK VP+H   NPPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCIIAAALLAGFITMIVKLVPKHKHHNPPPDNYTLALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDA  163



>ref|NP_001233943.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
 gb|AAC49704.1| endo-1,4-beta-glucanase [Solanum lycopersicum]
Length=617

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIH  DSATDDDRSRNLQD DRAA+SRSLDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHTADSATDDDRSRNLQDFDRAAMSRSLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWTVG ++AAA+L G I +IVK VPRH   NPPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCIIAAALLAGFITMIVKLVPRHKHHNPPPDNYTLALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDA  163



>gb|KJB70736.1| hypothetical protein B456_011G089500 [Gossypium raimondii]
Length=621

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 152/166 (92%), Gaps = 1/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP+EQ KKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPSEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG+++ +AVL GLI LIVKTVPRHH   PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLVVSAVLAGLITLIVKTVPRHHHGKPPPDNYTLALHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSGKLPKHNNVSWRGNSC+RDGKSD  T  KDLVGGYYDA
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDGKSDPGTTMKDLVGGYYDA  166



>ref|XP_009600540.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=617

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL D DRAALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLGDFDRAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWTVG +LAAA+L G I +IVK  PRH   NPPPDNYT+ALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCILAAALLAGFITMIVKLAPRHKHHNPPPDNYTVALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDA  163



>gb|AIE16186.1| endo-1,4-beta-glucanase [Nicotiana tabacum]
Length=617

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL D DRAALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLGDFDRAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWTVG +LAAA+L G I +IVK  PRH   NPPPDNYT+ALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTVGCILAAALLAGFITMIVKLAPRHKHHNPPPDNYTVALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNSC++DGKSDD+T+FK+LVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSCLQDGKSDDSTMFKNLVGGYYDA  163



>ref|XP_010533226.1| PREDICTED: endoglucanase 25 [Tarenaya hassleriana]
Length=622

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGPTEQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPTEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++LAA  L G I LIVKTVPRHH  +PPPDNYT+ALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTILAAGFLAGFITLIVKTVPRHHHKHPPPDNYTVALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC++DGK    + +KDLVGGYYDA
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCLQDGKGTSGSFYKDLVGGYYDA  165



>gb|AID55380.1| glycoside hydrolase family 9 A2 [Gossypium hirsutum]
Length=621

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 141/166 (85%), Positives = 150/166 (90%), Gaps = 1/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP+EQ KKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPSEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG+++ +AVL GLI LIVKTVPRHH    PPDNYTL LHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLVVSAVLAGLITLIVKTVPRHHHGKAPPDNYTLTLHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSGKLPKHNNVSWRGNSC+RDGKSD  T  KDLVGGYYDA
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDGKSDPGTTMKDLVGGYYDA  166



>ref|XP_006431347.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 ref|XP_006470776.1| PREDICTED: endoglucanase 25-like [Citrus sinensis]
 gb|ESR44587.1| hypothetical protein CICLE_v10000600mg [Citrus clementina]
 gb|KDO53874.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=621

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSM+GRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGPTE+KKK+
Sbjct  1    MSMFGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPTEKKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L +A+L G I LIVKTVPRHH  +  PDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSALLAGFITLIVKTVPRHHHSHARPDNYTLALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC++DGKS  ++I KDLVGG+YDA
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCLKDGKSASSSISKDLVGGFYDA  165



>gb|KDO53875.1| hypothetical protein CISIN_1g007014mg [Citrus sinensis]
Length=620

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSM+GRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGPTE+KKK+
Sbjct  1    MSMFGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPTEKKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L +A+L G I LIVKTVPRHH  +  PDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSALLAGFITLIVKTVPRHHHSHARPDNYTLALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC++DGKS  ++I KDLVGG+YDA
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCLKDGKSASSSISKDLVGGFYDA  165



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 136/165 (82%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSM+GRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMFGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L + +L G I LIVKTVPRHH  + PPDNYT ALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGLLAGFITLIVKTVPRHHHAHGPPDNYTRALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGK+PKHNNVSWRGNSC++DGKSD +T+ KDLVGGYYDA
Sbjct  121  FFNAQRSGKMPKHNNVSWRGNSCLQDGKSDPSTLMKDLVGGYYDA  165



>ref|XP_009765308.1| PREDICTED: endoglucanase 25-like [Nicotiana sylvestris]
Length=616

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGG LEI+A DSATDDDRSRNLQD D+AALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRKVFKWT+G ++AAA++ G + LIVKTVP+H + +PPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKVFKWTLGCIIAAALIAGFVTLIVKTVPKHRQRSPPPDNYTLALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRG+S M+DGKSDD+T+FK+LVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGSSGMQDGKSDDSTMFKNLVGGYYDA  163



>ref|XP_010088712.1| Endoglucanase 25 [Morus notabilis]
 gb|EXB36893.1| Endoglucanase 25 [Morus notabilis]
Length=622

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 150/167 (90%), Gaps = 2/167 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALS R LDETQQSWLLGPT EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSSRPLDETQQSWLLGPTGEQKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG+++ +A+L G I LIVKTVPRH   + PPDNYTLALHKA
Sbjct  61   KKYVDLGCIIVSRKIFIWTVGTLVVSALLAGFITLIVKTVPRHKHGHAPPDNYTLALHKA  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC+ DGKSD +T+FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCVHDGKSDSSTLFKDLSGGFYDA  167



>emb|CAN68337.1| hypothetical protein VITISV_025978 [Vitis vinifera]
Length=616

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVGS+L A  L G I LIVKTVPRHH P+ PPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGSILVAGFLAGFITLIVKTVPRHHHPHAPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNS M DGKS+  + +KDLVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMNDGKSETGSFYKDLVGGYYDA  163



>ref|NP_001284449.1| endoglucanase 25-like [Cucumis melo]
 dbj|BAF30815.1| endoglucanase [Cucumis melo]
Length=622

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L +  L GLI LIVKTVPRHH P+PPPDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGFLAGLITLIVKTVPRHHHPHPPPDNYTLALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC RDG    +++FKDL GGYYDA
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCTRDGDG-SSSLFKDLSGGYYDA  164



>ref|XP_009595607.1| PREDICTED: endoglucanase 25-like [Nicotiana tomentosiformis]
Length=616

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGG LEI+A DSATDDDRSRNLQD DRAALSR+LDETQQSWLLGPTE+KKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDRAALSRNLDETQQSWLLGPTEKKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRKVFKWT+G ++AAA++ G + LIVKT+P+H   +PPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKVFKWTLGCIIAAALIAGFVTLIVKTLPKHRHRSPPPDNYTLALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRG+S M+DGKSDD+T+FK+LVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGSSGMQDGKSDDSTMFKNLVGGYYDA  163



>emb|CDP17765.1| unnamed protein product [Coffea canephora]
Length=616

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVGS+LAA +LVG I LIVKTVPRHH   PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGSILAAGLLVGFITLIVKTVPRHHHKGPPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNSC+ DGKS  ++  K+LVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGNSCLNDGKSQSSSAIKNLVGGYYDA  163



>ref|XP_004133745.1| PREDICTED: endoglucanase 25-like [Cucumis sativus]
 gb|KGN56301.1| hypothetical protein Csa_3G113920 [Cucumis sativus]
Length=622

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 149/165 (90%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L +  L GLI LIVKTVPRHH P+PPPDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGFLAGLITLIVKTVPRHHHPHPPPDNYTLALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC RDG    +++FKDL GGYYDA
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCTRDGDG-SSSLFKDLSGGYYDA  164



>ref|XP_011092233.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=617

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 147/165 (89%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGG LEI A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGSLEIAA-DSATDDDRSRNLQDYDRAALSRPLDETQQSWLLGPGEQKKKK  59

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++LAA  L G + LIVKTVPRHH   PPPDNYTLAL+KALM
Sbjct  60   YVDLGCIIVSRKIFVWTVGTILAAGFLAGFVTLIVKTVPRHHHRPPPPDNYTLALNKALM  119

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC+ DGKSD +T+FKDL GGYYDA
Sbjct  120  FFNAQRSGKLPKHNNVSWRGNSCLNDGKSDSSTLFKDLTGGYYDA  164



>gb|KJB66549.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=496

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>ref|XP_002519394.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF43011.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=621

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            MSMYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGP EQ KKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPAEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG+++ +A+L G I LIVKTVPRHH   PPPDNYTL LHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGALVVSALLAGFITLIVKTVPRHHHSKPPPDNYTLGLHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSG+LPKHNNVSWRG+SC+ DGKS   TIFKDL GGYYDA
Sbjct  121  MFFNAQRSGRLPKHNNVSWRGSSCVNDGKSATGTIFKDLAGGYYDA  166



>ref|XP_010521418.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=620

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG++LAA  L G I LIVKTVPRHH  +PPPDNYT+ALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGTILAAGFLAGFITLIVKTVPRHHHKHPPPDNYTVALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK    + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGTSGSFYKDLVGGYYDA  163



>gb|KDP32467.1| hypothetical protein JCGZ_13392 [Jatropha curcas]
Length=620

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPAEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGALLVSAFLAGFITLIVKTVPRHRHSKPPPDNYTLALHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQ+SGKLPKHNNVSWRGNSC  DGKS    +FKDL GGYYDA
Sbjct  121  MFFNAQKSGKLPKHNNVSWRGNSCTHDGKSATDALFKDLSGGYYDA  166



>emb|CAB51903.1| cellulase [Brassica napus]
Length=621

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHHR  PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHRKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDA  163



>emb|CDX83181.1| BnaA03g23250D [Brassica napus]
Length=621

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHHR  PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHRKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDA  163



>ref|XP_009134026.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHHR  PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHRKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDA  163



>ref|XP_006356407.1| PREDICTED: endoglucanase 25-like [Solanum tuberosum]
Length=616

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGG LEI+A DSATDDDRSRNLQD D+AALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRKVFKWTVG ++AAA++ G + LIVKTVP+H   NPPPDNYTLAL KALMFF
Sbjct  61   DLGCIIVSRKVFKWTVGCIIAAALIAGFVTLIVKTVPKHRHHNPPPDNYTLALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRG+S ++DGK+D +T FK+LVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGSSALQDGKTDGSTTFKNLVGGYYDA  163



>emb|CDY21449.1| BnaC03g27480D [Brassica napus]
Length=621

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDIDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH+ NPPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHQKNPPPDNYTVALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRGNS ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKGDSGSFYKDLVGGYYDA  163



>ref|XP_004238641.1| PREDICTED: endoglucanase 25-like [Solanum lycopersicum]
Length=616

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGG LEI+A DSATDDDRSRNLQD D+AALSR+LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRKVFKWT+G ++AAA++ G + LIVKTVP+H   NPPPDNYTLAL KA+MFF
Sbjct  61   DLGCIIVSRKVFKWTLGCIIAAALIAGFVTLIVKTVPKHRHHNPPPDNYTLALRKAIMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRG+S ++DGKSD +T FK+LVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGSSALQDGKSDGSTTFKNLVGGYYDA  163



>gb|AAQ08018.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68793.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium raimondii]
 gb|ADY68795.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|AEN70795.1| endo-1,4-beta-glucanase [Gossypium thurberi]
 gb|AEN70796.1| endo-1,4-beta-glucanase [Gossypium laxum]
 gb|AEN70800.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70813.1| endo-1,4-beta-glucanase [Gossypium davidsonii]
 gb|AEN70814.1| endo-1,4-beta-glucanase [Gossypium klotzschianum]
 gb|AEN70815.1| endo-1,4-beta-glucanase [Gossypium aridum]
 gb|AEN70817.1| endo-1,4-beta-glucanase [Gossypium lobatum]
 gb|AEN70818.1| endo-1,4-beta-glucanase [Gossypium trilobum]
 gb|AID55374.1| glycoside hydrolase family 9 A1 [Gossypium hirsutum]
 gb|KJB66547.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=619

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|KJB66548.1| hypothetical protein B456_010G143300 [Gossypium raimondii]
Length=618

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|ADY68794.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQEKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AEN70810.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AEN70797.1| endo-1,4-beta-glucanase [Gossypium schwendimanii]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AAP83128.1| endo-1,4-beta-glucanase [Gossypium hirsutum]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AEN70798.1| endo-1,4-beta-glucanase [Gossypium turneri]
 gb|AEN70811.1| endo-1,4-beta-glucanase [Gossypium armourianum]
 gb|AEN70812.1| endo-1,4-beta-glucanase [Gossypium harknessii]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLTGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|ADY68792.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium herbaceum 
subsp. africanum]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AEN70809.1| endo-1,4-beta-glucanase [Gossypium hirsutum subsp. latifolium]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AAS87601.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium hirsutum]
 gb|ADY68790.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70799.1| endo-1,4-beta-glucanase [Gossypium mustelinum]
 gb|AEN70801.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70805.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70807.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|ADY68791.1| membrane-anchored endo-1,4-beta-glucanase [Gossypium barbadense]
 gb|AEN70802.1| endo-1,4-beta-glucanase [Gossypium darwinii]
 gb|AEN70803.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70804.1| endo-1,4-beta-glucanase [Gossypium tomentosum]
 gb|AEN70806.1| endo-1,4-beta-glucanase [Gossypium barbadense var. brasiliense]
 gb|AEN70808.1| endo-1,4-beta-glucanase [Gossypium barbadense var. peruvianum]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>gb|AEN70816.1| endo-1,4-beta-glucanase [Gossypium gossypioides]
Length=619

 Score =   233 bits (595),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG++L +A+L GLI LIVKTVPRHH  + PPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGTLLVSALLAGLITLIVKTVPRHHHRHSPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRGNS ++DGKSD + + KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGNSGLQDGKSDPSVLMKDLVGGYYDA  164



>ref|XP_004171003.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Cucumis 
sativus]
Length=622

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 148/165 (90%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRD WGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDXWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L +  L GLI LIVKTVPRHH P+PPPDNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGTLLVSGFLAGLITLIVKTVPRHHHPHPPPDNYTLALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC RDG    +++FKDL GGYYDA
Sbjct  121  FFNAQRSGKLPKHNNVSWRGNSCTRDGDG-SSSLFKDLSGGYYDA  164



>gb|AGV22123.1| endo-1,4-beta-glucanase 1 [Betula luminifera]
Length=618

 Score =   233 bits (594),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++ +A L G I LIVK VPRHH  +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGTLIVSAFLAGFITLIVKMVPRHHHSHPPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            N QRSGKLPKHNNVSWRG+SC+ DG ++ + I+KDLVGGYYDA
Sbjct  121  NGQRSGKLPKHNNVSWRGSSCLDDGIAEKSPIYKDLVGGYYDA  163



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   238 bits (606),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVGS+L A  L G I LIVKTVPRHH P+ PPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGSILVAGFLAGFITLIVKTVPRHHHPHAPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNS M DGKS+  + +KDLVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMNDGKSETGSFYKDLVGGYYDA  163



>ref|XP_006402246.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43699.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=620

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPR+H  NPPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRNHHKNPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRGNS ++DGK  DA+ +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKG-DASFYKDLVGGYYDA  162



>ref|XP_006402245.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
 gb|ESQ43698.1| hypothetical protein EUTSA_v10012932mg [Eutrema salsugineum]
Length=648

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 149/163 (91%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEIHATDSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPR+H  NPPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRNHHKNPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRGNS ++DGK  DA+ +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGNSGLQDGKG-DASFYKDLVGGYYDA  162



>ref|XP_011022354.1| PREDICTED: endoglucanase 25-like [Populus euphratica]
Length=619

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|KFK26611.1| hypothetical protein AALP_AA8G271400 [Arabis alpina]
Length=621

 Score =   231 bits (588),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 133/163 (82%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPR+H  +PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRNHHKHPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLP+HNNVSWRGNS ++DGK    + +KDLVGGYYDA
Sbjct  121  NAQRSGKLPRHNNVSWRGNSGLQDGKGTPGSFYKDLVGGYYDA  163



>gb|AEO97184.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97211.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLGDGKGKQGSFYKDLVGGYYDA  164



>dbj|BAH57006.1| AT5G49720 [Arabidopsis thaliana]
Length=555

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>ref|XP_006385837.1| endo-1 family protein [Populus trichocarpa]
 gb|ERP63634.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   230 bits (587),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLGDGKGKQGSFYKDLVGGYYDA  164



>gb|AHA41508.1| endo-1,4 -beta-glucanase [Populus deltoides]
Length=619

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGC+IVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCVIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQRSGKLPKHNNVSWRGSSCLGDGKGKQGSFYKDLVGGYYDA  164



>ref|NP_199783.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
 sp|Q38890.1|GUN25_ARATH RecName: Full=Endoglucanase 25; AltName: Full=Cellulase homolog 
OR16pep; AltName: Full=Endo-1,4-beta glucanase 25; AltName: 
Full=Protein KORRIGAN; AltName: Full=Protein RADIALLY SWOLLEN 
2 [Arabidopsis thaliana]
 gb|AAB60304.1| cellulase [Arabidopsis thaliana]
 gb|AAC33467.1| cellulase [Arabidopsis thaliana]
 gb|AAC35344.1| cellulase [Arabidopsis thaliana]
 gb|AAC83240.1| endo-1,4-beta-D-glucanase KORRIGAN [Arabidopsis thaliana]
 dbj|BAA98160.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
 gb|AED95850.1| endo-1,4-beta-D-glucanase [Arabidopsis thaliana]
Length=621

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>gb|AAN72232.1| At5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>ref|XP_007147545.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
 gb|ESW19539.1| hypothetical protein PHAVU_006G133700g [Phaseolus vulgaris]
Length=619

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSAT++DRSRNLQDLDRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATEEDRSRNLQDLDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+VL AA L G I LIV T+PRHH  +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFVWTVGTVLFAAFLAGFIALIVNTIPRHHHKHPPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNS M+DGKS D ++  KDLVGG+YDA
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMQDGKSSDTSSAIKDLVGGFYDA  164



>ref|XP_002865753.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42012.1| hypothetical protein ARALYDRAFT_495032 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSR++F WTVG+++AAA+L G I LIVKTVPRHH  +PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRQIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKSPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>gb|AAT75041.1| Cel9A [Populus tremula x Populus tremuloides]
Length=619

 Score =   229 bits (585),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQVSFYKDLVGGYYDA  164



>gb|AEO97239.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97240.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97241.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97243.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97244.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97245.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97247.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97248.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97250.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97251.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97254.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97256.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97258.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97259.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97263.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97266.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97269.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97270.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97272.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|AEO97182.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97209.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97236.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97237.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97242.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97246.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97249.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97253.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97255.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97257.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97260.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97261.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97262.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97264.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97268.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97271.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97273.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97274.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78626.1| korrigan [Populus tomentosa]
Length=610

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|AEO97238.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|AEO97265.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>ref|XP_010441020.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHHKTPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SG+LPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>gb|AEO97252.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97267.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHRHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>ref|XP_010442441.1| PREDICTED: endoglucanase 25 [Camelina sativa]
Length=621

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHHKTPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SG+LPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>ref|XP_003594425.1| Endoglucanase [Medicago truncatula]
 gb|ABD32918.1| Glycoside transferase, six-hairpin, subgroup [Medicago truncatula]
 gb|AES64676.1| membrane-anchored endo-1,4-beta-glucanase [Medicago truncatula]
Length=622

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 149/167 (89%), Gaps = 2/167 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            MSMYGRDPWGGPLEI+A DSATD+DRSRNL +LDRAALSR LDETQQSWLLGPTEQ KKK
Sbjct  1    MSMYGRDPWGGPLEINATDSATDEDRSRNLNELDRAALSRPLDETQQSWLLGPTEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG++L AA + G + LIVKTVPRHH+ +PPPDNYTLALHKAL
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTILFAAFVAGFVTLIVKTVPRHHKKHPPPDNYTLALHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDAT-IFKDLVGGYYDA  619
            MFFNAQ+SGKLPKHNNVSWRGNS M+DGK D  +   KDLVGGYYDA
Sbjct  121  MFFNAQKSGKLPKHNNVSWRGNSGMQDGKGDGVSAAIKDLVGGYYDA  167



>ref|XP_009123553.1| PREDICTED: endoglucanase 25 [Brassica rapa]
Length=621

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLNDVDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG V+AAA+L G I LIVKTVPRHH  NP PDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGIVVAAALLAGFITLIVKTVPRHHNKNPAPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRG+S ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGSSGLQDGKGDSGSFYKDLVGGYYDA  163



>emb|CDY37768.1| BnaA10g05530D [Brassica napus]
Length=621

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLNDVDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG V+AAA+L G I LIVKTVPRHH  NP PDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGIVVAAALLAGFITLIVKTVPRHHHKNPAPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRG+S ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGSSGLQDGKGDSGSFYKDLVGGYYDA  163



>ref|XP_010482263.1| PREDICTED: endoglucanase 25-like [Camelina sativa]
Length=621

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH  NPPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFITLIVKTVPRHHHKNPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SG+LPKHNNVSWRGNS ++DG+ +  + +KDLVGGYYDA
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGRGETGSFYKDLVGGYYDA  163



>ref|XP_006281810.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
 gb|EOA14708.1| hypothetical protein CARUB_v10027986mg [Capsella rubella]
Length=621

 Score =   228 bits (580),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I+LIVKTVPRHH+ +PPPDNYTLALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTIVAAALLAGFIILIVKTVPRHHKKDPPPDNYTLALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SG+LPKHNNVSWRGNS ++DG+ +  + +KDLVGGYYDA
Sbjct  121  NAQKSGRLPKHNNVSWRGNSGLQDGRGETGSFYKDLVGGYYDA  163



>ref|XP_007222007.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
 gb|EMJ23206.1| hypothetical protein PRUPE_ppa002911mg [Prunus persica]
Length=622

 Score =   228 bits (580),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 137/167 (82%), Positives = 150/167 (90%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRHHR  PPPDNYTLALHK+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHHRGRPPPDNYTLALHKS  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDASTTFKDLAGGFYDA  166



>emb|CDX71601.1| BnaC09g26420D [Brassica napus]
Length=621

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNL D+DRAALSR LDETQQSWLLGPTEQKKK++V
Sbjct  1    MYGRDPWGGPLEINATDSATDDDRSRNLNDVDRAALSRPLDETQQSWLLGPTEQKKKKFV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG V+AAA+L G I LI+KTVPRHH  NP PDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGIVVAAALLAGFITLIIKTVPRHHHKNPAPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNVSWRG+S ++DGK D  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPRHNNVSWRGSSGLQDGKGDSGSFYKDLVGGYYDA  163



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGG LEI+A DSATDDDRSRNL DLDRA+LSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGSLEINAADSATDDDRSRNLNDLDRASLSRPLDETQQSWLLGPAEQKKKK  60

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVGS++AAA+L GLI +IV+ VPRH   + P DNYTLALHKALM
Sbjct  61   YVDLGCIIVSRKIFVWTVGSIVAAALLGGLITVIVEAVPRHRHNHTPADNYTLALHKALM  120

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FFNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  165



>dbj|BAF42036.1| cellulase1 [Pyrus communis]
Length=622

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTTDSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHSRPPPDNYTLALRKS  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC+RDG +D +T FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLRDG-NDPSTTFKDLAGGFYDA  166



>dbj|BAC22690.1| endo-1,4-beta-D-glucanase [Pyrus communis]
Length=621

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPTEQKKK  301
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ ++KK
Sbjct  1    MSMYGRDPWGGPLEINTTDSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+L
Sbjct  61   KYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHSRPPPDNYTLALRKSL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSGKLPKHNNVSWRGNSC+RDG +D +T FKDL GG+YDA
Sbjct  121  MFFNAQRSGKLPKHNNVSWRGNSCLRDG-NDPSTTFKDLAGGFYDA  165



>gb|AAS45400.1| endo-1,4-beta-glucanase [Populus tremuloides]
Length=619

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR-Y  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQKKK+ Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKIY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+  WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKICVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|ADB82903.1| membrane-bound endo-beta-1,4-glucanase [Populus alba x Populus 
grandidentata]
Length=619

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AA +LVGLI LIVKTVPRHH  + P DNYTLAL KALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAGLLVGLITLIVKTVPRHHHSHAPADNYTLALRKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FN QRSGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNGQRSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|ABD62083.1| endo-1,4-beta-glucancase precursor [Glycine max]
Length=604

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWT+G+VL AA L GLI LIV TVPRH   +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTLGTVLFAAFLAGLIALIVNTVPRHRHKHPPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNS M+DGKS D +   KDLVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMQDGKSSDHSAAIKDLVGGYYDA  164



>gb|AAK59818.1| AT5g49720/K2I5_8 [Arabidopsis thaliana]
Length=621

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+ V
Sbjct  1    MYGRDPWGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKDV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>gb|AAM63370.1| cellulase homolog OR16pep precursor [Arabidopsis thaliana]
Length=621

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDP GGPLEI+  DSATDDDRSRNL DLDRAALSR LDETQQSWLLGPTEQKKK+YV
Sbjct  1    MYGRDPSGGPLEINTADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPTEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+F WTVG+++AAA+L G I LIVKTVPRHH   PPPDNYT+ALHKAL FF
Sbjct  61   DLGCIIVSRKIFVWTVGTLVAAALLAGFITLIVKTVPRHHPKTPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPKHNNVSWRGNS ++DGK +  + +KDLVGGYYDA
Sbjct  121  NAQKSGKLPKHNNVSWRGNSGLQDGKGETGSFYKDLVGGYYDA  163



>ref|XP_008339246.1| PREDICTED: endoglucanase 25-like [Malus domestica]
Length=622

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 148/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRHH   PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHHHARPPPDNYTLALRKS  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDPSTTFKDLAGGFYDA  166



>ref|XP_003535026.1| PREDICTED: endoglucanase 25 [Glycine max]
 gb|KHN40745.1| Endoglucanase 25 [Glycine soja]
Length=618

 Score =   225 bits (573),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWT+G++L AA L GLI LIV TVPRH   +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTLGTILFAAFLAGLIALIVNTVPRHRHKHPPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNS M+DGKS D +   KDLVGGYYDA
Sbjct  121  NAQRSGKLPKHNNVSWRGNSGMQDGKSSDHSAAIKDLVGGYYDA  164



>ref|XP_008218604.1| PREDICTED: endoglucanase 25 [Prunus mume]
Length=1109

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 149/167 (89%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH R  PPPDNYTLALHK+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHPRGRPPPDNYTLALHKS  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDASTTFKDLAGGFYDA  166



>ref|XP_004486415.1| PREDICTED: endoglucanase 25-like [Cicer arietinum]
Length=620

 Score =   224 bits (572),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGGPLEI+A DSATD+DRSRNLQ+LDRAALSR LDETQQSWLLGPTEQ KKK+Y
Sbjct  1    MYGRDPWGGPLEINATDSATDEDRSRNLQELDRAALSRPLDETQQSWLLGPTEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVG ++ AA + G + LIVKTVPRHH  +PPPDNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGIIVFAAFVAGFVTLIVKTVPRHHHKHPPPDNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDAT-IFKDLVGGYYDA  619
            FNAQ+SGKLPKHNNVSWRG S M+DGK D  +   KDLVGGYYDA
Sbjct  121  FNAQKSGKLPKHNNVSWRGTSGMQDGKGDGVSAAIKDLVGGYYDA  165



>ref|XP_010266669.1| PREDICTED: endoglucanase 9-like [Nelumbo nucifera]
Length=619

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAAL-SRSLDETQQSWLLGPTEQKKK  301
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQD DRAAL SR LDETQQSWLLGP+EQKKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATDDDRSRNLQDFDRAALNSRPLDETQQSWLLGPSEQKKK  60

Query  302  R-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            + YVDLGCIIVSRK+F WTVG++LAA  + G + LIVKTVPRHH    PPDNYTLALHKA
Sbjct  61   KKYVDLGCIIVSRKLFVWTVGTILAAGFIAGFVTLIVKTVPRHHHSRAPPDNYTLALHKA  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHNNVSWRGNS MRDG SD+ ++ K+LVGGYYDA
Sbjct  121  LMFFNAQRSGPLPKHNNVSWRGNSGMRDGLSDN-SVNKNLVGGYYDA  166



>gb|AEO97185.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97212.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=610

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>ref|XP_002299405.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE84210.1| endo-1 family protein [Populus trichocarpa]
Length=619

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>gb|AEO97183.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97210.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97275.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97276.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97277.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97278.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97279.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97280.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97281.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97282.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97284.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97285.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97286.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97287.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97289.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97290.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97293.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97295.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97296.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97298.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97301.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97304.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97307.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97311.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97312.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97313.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AFZ78627.1| korrigan [Populus tomentosa]
Length=610

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DNYTLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNYTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>ref|XP_003546229.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=618

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCIIVSRK+FKWT+G++L AA L GLI LIV TVPRH   +PPPDNYTLALHKALMFF
Sbjct  61   DLGCIIVSRKIFKWTLGTLLFAAFLAGLIALIVNTVPRHRHKHPPPDNYTLALHKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDD-ATIFKDLVGGYYDA  619
            N QRSGKLPKHNNVSWRGNS M+DGKS D +   KDLVGGYYDA
Sbjct  121  NGQRSGKLPKHNNVSWRGNSGMQDGKSSDHSAAIKDLVGGYYDA  164



>ref|XP_006413454.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
 gb|ESQ54907.1| hypothetical protein EUTSA_v10024681mg [Eutrema salsugineum]
Length=624

 Score =   222 bits (566),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DS TDDDRSRNLQ+LDRAA SR LD TQQSWLLGPTE KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSLTDDDRSRNLQELDRAAFSRPLDATQQSWLLGPTEPKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGC++VSRK+F WT+G+ +  A L G I  IVK VPRH    P PDN+TLALHKAL+FF
Sbjct  61   DLGCLLVSRKIFLWTLGTFVLTAFLAGSITTIVKKVPRHKHEPPKPDNFTLALHKALLFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +AQ+SGKLP+HNNVSWRG+SC++DGK D   ++KDLVGGYYDA
Sbjct  121  HAQKSGKLPEHNNVSWRGSSCLQDGKGDQGQVYKDLVGGYYDA  163



>gb|AEO97283.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97288.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97291.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97292.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97294.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97297.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97299.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97300.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97302.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97303.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97305.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97306.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97308.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97309.1| endo-1,4-beta-glucanase [Populus tomentosa]
 gb|AEO97310.1| endo-1,4-beta-glucanase [Populus tomentosa]
Length=610

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCIIVSRK+F WTVGS++AAA+LVGLI +IV+ VPRH   + P DN+TLALHKALMF
Sbjct  61   VDLGCIIVSRKIFVWTVGSIVAAALLVGLITVIVEAVPRHRHNHTPADNFTLALHKALMF  120

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPKHNNVSWRG+SC+ DGK    + +KDLVGGYYDA
Sbjct  121  FNAQKSGKLPKHNNVSWRGSSCLSDGKGKQGSFYKDLVGGYYDA  164



>ref|XP_006858422.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
 gb|ERN19889.1| hypothetical protein AMTR_s00071p00064260 [Amborella trichopoda]
Length=617

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEI+A DSATDDDRSRNLQ+ DRAALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGPLEINA-DSATDDDRSRNLQEFDRAALSRQLDETQQSWLLGPGEQKKKK  59

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+FKWTVGS+L   +L GLI LIVKTVPRHH   PPPDNYT ALHKALM
Sbjct  60   YVDLGCIIVSRKLFKWTVGSILVCGLLAGLITLIVKTVPRHHHAKPPPDNYTQALHKALM  119

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSG LPKHNNVSWRGNS M+DG SD +   K+LVGG+YDA
Sbjct  120  FFNAQRSGPLPKHNNVSWRGNSGMKDGLSDPSAR-KNLVGGFYDA  163



>gb|EYU35397.1| hypothetical protein MIMGU_mgv1a003033mg [Erythranthe guttata]
Length=613

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 4/163 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            M+GRDPWGGPLEI A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MFGRDPWGGPLEIAA-DSATDDDRSRNLQDYDRAALSRPLDETQQSWLLGPGEQKKKKYV  59

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGC+IVSRK+F WTVG+++AA +L GLIVLIVKTVPRHH   PPPDNYTLAL+KALMFF
Sbjct  60   DLGCVIVSRKIFLWTVGTLVAAGLLAGLIVLIVKTVPRHHHRPPPPDNYTLALNKALMFF  119

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSGKLPKHNNVSWRGNSC++DG   +  +FKDL GG+YDA
Sbjct  120  NAQRSGKLPKHNNVSWRGNSCLKDG---EPGLFKDLTGGFYDA  159



>gb|ABR15471.1| endoglucanase [Pinus taeda]
Length=619

 Score =   220 bits (561),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGG LEI+A DSATDDDRSRNLQD DR+ALSR LDETQQSWLLGP EQKKK+
Sbjct  1    MSMYGRDPWGGALEINA-DSATDDDRSRNLQDFDRSALSRQLDETQQSWLLGPGEQKKKK  59

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCI+ SR VFKW V S+L +  + GL+ LIVK VPRH    PPPD+YT ALHKALM
Sbjct  60   YVDLGCIVCSRTVFKWIVISILLSGSIAGLVTLIVKLVPRHKHSAPPPDSYTKALHKALM  119

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSG LPKHNNVSWRGNSCMRDG SD  +   +LVGG+YDA
Sbjct  120  FFNAQRSGPLPKHNNVSWRGNSCMRDGLSDPGSNHANLVGGFYDA  164



>ref|XP_009355455.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Pyrus x bretschneideri]
Length=1064

 Score =   224 bits (571),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 146/167 (87%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A+L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSALLAGFITLIVKTVPRHRHARPPPDNYTLALRKS  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG    AT FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDGNDPSAT-FKDLAGGFYDA  166



>ref|XP_008379019.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25 [Malus domestica]
Length=1066

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 3/167 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGPLEI+  DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ E+KK
Sbjct  1    MSMYGRDPWGGPLEINTADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEKKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  61   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHARPPPDNYTLALRKS  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC++DG +D +T FKDL GG+YDA
Sbjct  121  LMFFNAQRSGKLPKHNNVSWRGNSCLKDG-NDPSTTFKDLAGGFYDA  166



>ref|XP_010529892.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 144/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKK  301
            M+MY RDPWGGPLEIHA DSATDDDRSRNLQD   AA SR LDETQQSWLLGP+EQ KKK
Sbjct  1    MAMYVRDPWGGPLEIHAADSATDDDRSRNLQDAGHAAYSRPLDETQQSWLLGPSEQKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVG++LAA  L GLI LI+K VPR+H  +PPPDNYT+AL KAL
Sbjct  61   KYVDLGCIIVSRKIFIWTVGTILAAGFLAGLIALIMKFVPRNHHKHPPPDNYTVALGKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSGKLPK+NNVSWRGNSC++DGK    + +KDLVGGYYDA
Sbjct  121  MFFNAQRSGKLPKYNNVSWRGNSCLQDGKGTRGSFYKDLVGGYYDA  166



>ref|XP_004301591.2| PREDICTED: endoglucanase 25 [Fragaria vesca subsp. vesca]
Length=1115

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 149/165 (90%), Gaps = 5/165 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKKKR  304
            MYGRDPWGGPLEI A DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKKK+
Sbjct  1    MYGRDPWGGPLEI-AADSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKKKK  59

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCIIVSRK+F WTVG++L + +L GLIVLIVKTVPRHH   PPPDNYT+ALHKALM
Sbjct  60   YVDLGCIIVSRKIFLWTVGTLLVSGLLAGLIVLIVKTVPRHHHAKPPPDNYTVALHKALM  119

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQ+SGKLPKHNNVSWRGNSC++DG  +  TIFKDLVGGYYDA
Sbjct  120  FFNAQKSGKLPKHNNVSWRGNSCLKDG--EPGTIFKDLVGGYYDA  162



>gb|AEL88496.1| membrane-bound endo-1,4-beta-glucanase [Picea glauca]
Length=617

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 135/163 (83%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DSATDDDRSRNLQD DR+ALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGPLEINA-DSATDDDRSRNLQDFDRSALSRQLDETQQSWLLGPGEQKKKKYV  59

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+ SR VFKW V S+L +  + GL+ LIVK VPRH+   PPPD+YT ALHKALMFF
Sbjct  60   DLGCIVCSRTVFKWIVISILLSGSIAGLVTLIVKLVPRHNNSAPPPDSYTKALHKALMFF  119

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSG LPKHNNVSWRGNS MRDG SD       LVGG+YDA
Sbjct  120  NAQRSGPLPKHNNVSWRGNSGMRDGLSDPGAAHASLVGGFYDA  162



>ref|XP_009340771.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 25-like [Pyrus 
x bretschneideri]
Length=619

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 143/167 (86%), Gaps = 6/167 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPT-EQKK  298
            MSMYGRDPWGGP      DSATDDDRSRNLQDLDRAALS R LDETQQSWLLGP+ EQKK
Sbjct  1    MSMYGRDPWGGPXTA---DSATDDDRSRNLQDLDRAALSSRPLDETQQSWLLGPSGEQKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCIIVSRK+F WTVG++L +A L G I LIVKTVPRH    PPPDNYTLAL K+
Sbjct  58   KKYVDLGCIIVSRKIFVWTVGTLLVSAFLAGFITLIVKTVPRHRHARPPPDNYTLALRKS  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSGKLPKHNNVSWRGNSC+RDG +D +T FKDL GG+YDA
Sbjct  118  LMFFNAQRSGKLPKHNNVSWRGNSCLRDG-NDPSTTFKDLAGGFYDA  163



>gb|KCW62543.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=500

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  298
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  299  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +LMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDA
Sbjct  121  SLMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDTSWTLKDLVGGYYDA  168



>ref|XP_003529689.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 138/168 (82%), Gaps = 7/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKK--  298
            MSMYGRDPWGGPLEIHA DSATDD+RSRNLQ+LDR AL    DETQQSWLLG  EQKK  
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDERSRNLQELDRGAL----DETQQSWLLGAGEQKKNK  56

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K YVDLGCIIVSRK+F WT+G++   A L   I LIVKTVPRHH   PPPDNYT+ALHKA
Sbjct  57   KTYVDLGCIIVSRKLFIWTLGTLAVFAFLSAFITLIVKTVPRHHHKPPPPDNYTIALHKA  116

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDA-TIFKDLVGGYYDA  619
            L+FFNAQ+SGKLP+HNNVSWRGNSC+ DGK D    + KDLVGGYYDA
Sbjct  117  LLFFNAQKSGKLPRHNNVSWRGNSCLHDGKDDGVPPVIKDLVGGYYDA  164



>ref|XP_010682188.1| PREDICTED: endoglucanase 25 [Beta vulgaris subsp. vulgaris]
Length=619

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 142/166 (86%), Gaps = 4/166 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKKKR  304
            MYGRDPWGGPLEI A DSATDDDRSRNLQD DRAALS  R LDETQQSWLLGP EQKKK+
Sbjct  1    MYGRDPWGGPLEI-AADSATDDDRSRNLQDYDRAALSSSRQLDETQQSWLLGPAEQKKKK  59

Query  305  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
             YVDLGCIIVSRK+F WTVGS+L A +L GLI LIVK  PRHH+P PPPDNYT  LHKAL
Sbjct  60   KYVDLGCIIVSRKIFFWTVGSILGAGLLAGLIALIVKLAPRHHKPPPPPDNYTQGLHKAL  119

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQ+SGKLPKHNNVSWRGNSC+ DGK +  T +KDL GG+YDA
Sbjct  120  MFFNAQKSGKLPKHNNVSWRGNSCLEDGKGESGTFYKDLKGGFYDA  165



>gb|AFD33696.1| korrigan [Eucalyptus camaldulensis]
Length=623

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  298
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  299  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDA
Sbjct  121  ALMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDSSWTLKDLVGGYYDA  168



>gb|ABR16291.1| unknown [Picea sitchensis]
 gb|ACN40901.1| unknown [Picea sitchensis]
Length=617

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGG LEI+A DSATDDDRSRNLQD DR+ALSR LDETQQSWLLGP EQKKK+YV
Sbjct  1    MYGRDPWGGALEINA-DSATDDDRSRNLQDFDRSALSRQLDETQQSWLLGPGEQKKKKYV  59

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+ SR VFKW V S+L +  + GL+ LIVK VPRH+   PPPD+YT ALHKALMFF
Sbjct  60   DLGCIVCSRTVFKWIVISILLSGSIAGLVTLIVKLVPRHNNSAPPPDSYTKALHKALMFF  119

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQRSG LPKHNNVSWRGNS MRDG SD       LVGG+YDA
Sbjct  120  NAQRSGPLPKHNNVSWRGNSGMRDGLSDPGAAHASLVGGFYDA  162



>gb|EPS69180.1| hypothetical protein M569_05586 [Genlisea aurea]
Length=615

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPT-EQKKK  301
            MSMYGRDPWGG LEI A DSATDD+RSRNLQD DRAALSR LDETQQSWLLG T E KKK
Sbjct  1    MSMYGRDPWGGSLEI-AGDSATDDERSRNLQDYDRAALSRPLDETQQSWLLGRTGEMKKK  59

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCIIVSRK+F WTVGS+LAAA L G I +IVK VPRHH   PP DNYT+ALH AL
Sbjct  60   KYVDLGCIIVSRKIFVWTVGSILAAAFLAGFITMIVKLVPRHHHKPPPEDNYTVALHDAL  119

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSGKLPKHNNVSWRGNSC+ DG++   +IF DL GGYYDA
Sbjct  120  MFFNAQRSGKLPKHNNVSWRGNSCVNDGET--GSIFSDLSGGYYDA  163



>ref|XP_003550680.1| PREDICTED: endoglucanase 25-like [Glycine max]
Length=619

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 140/168 (83%), Gaps = 7/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ--KK  298
            MSMYGRDPWGGPLEIHA DSATDD+RSRNLQ+LDR A    LDETQQSWLLG  EQ  KK
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDERSRNLQELDRGA----LDETQQSWLLGAGEQKKKK  56

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            KRYVDLGCIIVSRK+F WT+G++   A L G I LIVKTVPRHH   PPPDNYT+ALHKA
Sbjct  57   KRYVDLGCIIVSRKLFIWTLGTLAVCAFLAGFITLIVKTVPRHHHKPPPPDNYTIALHKA  116

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDA-TIFKDLVGGYYDA  619
            L+FFNAQ+SGKLP+HNNVSWRGNS ++DGK D    + KDLVGGYYDA
Sbjct  117  LLFFNAQKSGKLPRHNNVSWRGNSGLQDGKGDGVPPVIKDLVGGYYDA  164



>ref|XP_010065200.1| PREDICTED: endoglucanase 25-like [Eucalyptus grandis]
 gb|KCW62542.1| hypothetical protein EUGRSUZ_G00035 [Eucalyptus grandis]
Length=623

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  298
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  299  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +LMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDA
Sbjct  121  SLMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDTSWTLKDLVGGYYDA  168



>ref|XP_009400506.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 142/167 (85%), Gaps = 5/167 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLG----PTEQKK  298
            M+GRDPWGGPLEI   DSATDDDRSRNLQ+ DRAALSR LDETQQSWLL     P+ +KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRNLQEYDRAALSRQLDETQQSWLLAAPGDPSGKKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            KRYVDLGCI+VSRK+F WT+GSVL   +L+GLI+LIVKTVP  HRP PPPD YTLALHKA
Sbjct  61   KRYVDLGCIVVSRKLFLWTLGSVLGVGLLIGLIMLIVKTVPHRHRPPPPPDEYTLALHKA  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHNNVSWRGNS M+DG SDDA I + LVGGYYDA
Sbjct  121  LMFFNAQRSGPLPKHNNVSWRGNSGMKDGLSDDA-IRRSLVGGYYDA  166



>gb|AFY03622.1| endo-1,4-beta-glucanase [Eucalyptus globulus]
Length=623

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 3/168 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTEQKK  298
            MSMYGRDPWGGPLEI+A DSAT+D+RSRNL D DRAALS  R LDETQQSWLLG  EQKK
Sbjct  1    MSMYGRDPWGGPLEINAADSATEDERSRNLNDYDRAALSNSRPLDETQQSWLLGQGEQKK  60

Query  299  KR-YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K+ YVDLGCIIVSRK+F WTVGS+L   +L GLI LIVKTVPRHH  + PPDNYTLALHK
Sbjct  61   KKKYVDLGCIIVSRKIFVWTVGSILVCGLLAGLITLIVKTVPRHHGKHGPPDNYTLALHK  120

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +LMFFNAQRSGKLPKHNNVSWRGNS ++DGKSD +   KDLVGGYYDA
Sbjct  121  SLMFFNAQRSGKLPKHNNVSWRGNSGLQDGKSDXSWTLKDLVGGYYDA  168



>ref|XP_007154086.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
 gb|ESW26080.1| hypothetical protein PHAVU_003G089600g [Phaseolus vulgaris]
Length=620

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 143/169 (85%), Gaps = 8/169 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEIHA DSATDD+RSRNLQ+LDR AL    DETQQSWLLG  EQKKK+
Sbjct  1    MSMYGRDPWGGPLEIHATDSATDDERSRNLQELDRPAL----DETQQSWLLGAGEQKKKK  56

Query  305  --YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
              YVDLGCIIVSRK+F WT+G++  +AVL GLI LIVKTVPRHH    PPDNYTLALHKA
Sbjct  57   KKYVDLGCIIVSRKIFIWTLGTLAVSAVLAGLITLIVKTVPRHHHKPSPPDNYTLALHKA  116

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDAT--IFKDLVGGYYDA  619
            L+FFNAQ+SGKLP+HNNVSWRGNSCM DGK  + T  + KDL+GGYYDA
Sbjct  117  LLFFNAQKSGKLPRHNNVSWRGNSCMDDGKKSEGTSGVIKDLIGGYYDA  165



>ref|XP_010433798.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=622

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  307
            MYGRDPWGGPLEI+A DS  D+DR SRNLQDLDRAALSR LDETQQSWLLGP   KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSVIDEDRRSRNLQDLDRAALSRPLDETQQSWLLGPKVLKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCI+VSRK+F WT+G ++  A + G I LIVKTVPRH +  P PDNYTLAL++ALMF
Sbjct  61   VDLGCILVSRKIFLWTLGIIVVTAFISGFITLIVKTVPRHTQKPPSPDNYTLALNEALMF  120

Query  488  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPK N  NVSWRG+SC++DGK D    +KDLVGGYYDA
Sbjct  121  FNAQQSGKLPKGNIYNVSWRGDSCLQDGKEDPGQCYKDLVGGYYDA  166



>gb|KHN14382.1| Endoglucanase 25 [Glycine soja]
Length=652

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 144/198 (73%), Gaps = 35/198 (18%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQS--------------  268
            MY RD WGGPLEI+A DSAT+D+RSRNLQD+DRAALSR LDETQQS              
Sbjct  1    MYSRDSWGGPLEINATDSATEDERSRNLQDVDRAALSRPLDETQQSWLLGPGEQKKKRSR  60

Query  269  --------------------WLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlv  388
                                WLLGP EQKKK+YVDLGCIIVSRK+FKWT+G++L AA L 
Sbjct  61   NLQDVDRAALSRPLDETQQSWLLGPGEQKKKKYVDLGCIIVSRKIFKWTLGTILFAAFLA  120

Query  389  glivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGK  568
            GLI LIV TVPRH   +PPPDNYTLALHKALMFFN QRSGKLPKHNNVSWRGNS M+DGK
Sbjct  121  GLIALIVNTVPRHRHKHPPPDNYTLALHKALMFFNGQRSGKLPKHNNVSWRGNSGMQDGK  180

Query  569  SDD-ATIFKDLVGGYYDA  619
            S D +   KDLVGGYYDA
Sbjct  181  SSDHSAAIKDLVGGYYDA  198



>ref|XP_010439066.1| PREDICTED: endoglucanase 21 [Camelina sativa]
Length=618

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  307
            MYGRDPWGGPLEI+A DS  D+DR SRNLQDLDRAALSR LDETQQSWLLGP   KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSVIDEDRRSRNLQDLDRAALSRPLDETQQSWLLGPKVLKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCI+VSRK+F WT+G ++  A + G I LIVKTVPRH    P PDNYTLAL++ALMF
Sbjct  61   VDLGCILVSRKIFLWTLGIIVVTAFISGFITLIVKTVPRHTHKPPSPDNYTLALNQALMF  120

Query  488  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPK N  NVSWRG+SC++DGK D    +KDLVGGYYDA
Sbjct  121  FNAQQSGKLPKGNIYNVSWRGDSCLQDGKGDPGQCYKDLVGGYYDA  166



>gb|EPS66085.1| hypothetical protein M569_08689 [Genlisea aurea]
Length=615

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPT-EQKKK  301
            MS+YGRDPWGGPLEI A DSATDD+RSRN QD DRAALSR+LDETQQSWLLG T E KKK
Sbjct  1    MSIYGRDPWGGPLEIAA-DSATDDERSRNFQDYDRAALSRTLDETQQSWLLGRTGEVKKK  59

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            RYVDLG IIVSRK+F WTVGS+LAA  L G I +IVK VPRHHRP PP DNYT ALH AL
Sbjct  60   RYVDLGFIIVSRKIFIWTVGSLLAAGFLAGFITMIVKLVPRHHRPPPPEDNYTAALHDAL  119

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSG+LPKHNNVSWRGNSCM DG+ +  T F+DL GGYYDA
Sbjct  120  MFFNAQRSGRLPKHNNVSWRGNSCMNDGEPN--TPFQDLSGGYYDA  163



>ref|XP_010448587.1| PREDICTED: endoglucanase 21-like [Camelina sativa]
Length=620

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  307
            MYGRDPWGGPLEI+A DS  D+DR SRNLQDLDRAALSR LDETQQSWLLGP   KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADSVIDEDRRSRNLQDLDRAALSRPLDETQQSWLLGPKVLKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCI+VSRK+F WT+G ++  A + G I LI KTVPRH    P PDNYTLAL++ALMF
Sbjct  61   VDLGCILVSRKIFLWTLGIIVVTAFISGFITLIAKTVPRHTHKPPSPDNYTLALNEALMF  120

Query  488  FNAQRSGKLPKHN--NVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPK N  NVSW+G+SC++DGK D    +KDLVGGYYDA
Sbjct  121  FNAQQSGKLPKGNIYNVSWKGDSCLQDGKGDQGQCYKDLVGGYYDA  166



>gb|KFK22234.1| hypothetical protein AALP_AAs42893U000400 [Arabis alpina]
Length=616

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 136/163 (83%), Gaps = 4/163 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DS TDDDRSRNLQDLDR+   R LDETQQSWLLGPTE KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSTTDDDRSRNLQDLDRSTRPRPLDETQQSWLLGPTEHKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI++SRK+F W++G++L  A L G + LI KT+PR H  NPPPDNYT+ALHKAL FF
Sbjct  61   DLGCILLSRKIFLWSLGTILLTASLAGFVTLITKTLPRPHFKNPPPDNYTIALHKALKFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+ NNVSWRG+SC++DG       +KDLVGGYYDA
Sbjct  121  NAQKSGKLPEGNNVSWRGDSCLKDGDFS----YKDLVGGYYDA  159



>ref|XP_009395086.1| PREDICTED: endoglucanase 10-like [Musa acuminata subsp. malaccensis]
Length=619

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 141/167 (84%), Gaps = 5/167 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLG----PTEQKK  298
            M+GRDPWGG LEI   DSATDDDRSRNLQD DRAALSR LDETQQSWLL     P+ +KK
Sbjct  1    MFGRDPWGGSLEISNADSATDDDRSRNLQDYDRAALSRQLDETQQSWLLAAPGDPSGKKK  60

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            KRYVDLGC++VSRK+F WTVGSVL   +L+G I+LI+KTVP HHRP PPPD YT ALHKA
Sbjct  61   KRYVDLGCVVVSRKLFLWTVGSVLGIGLLIGFIMLIIKTVPHHHRPPPPPDEYTQALHKA  120

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHNNVSWRGNS M+DG SDD ++ K+LVGGYYDA
Sbjct  121  LMFFNAQRSGPLPKHNNVSWRGNSGMKDGLSDD-SVKKNLVGGYYDA  166



>gb|ABP96983.1| cellulase [Colocasia esculenta]
Length=618

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 145/166 (87%), Gaps = 4/166 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--KKK  301
            M+G +PWGGPLEI   DSATDDDRSRNLQDLDRAALSR LDETQQSWLL GP +Q  KKK
Sbjct  1    MFGHNPWGGPLEISNADSATDDDRSRNLQDLDRAALSRQLDETQQSWLLAGPGDQGKKKK  60

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            RYVDLGC++VSRK F WTVGSVLA  +LVGLI+LI+KTVP HHRP PPPD+YT ALHKAL
Sbjct  61   RYVDLGCMVVSRKHFLWTVGSVLAVGLLVGLIMLIIKTVPHHHRPPPPPDSYTQALHKAL  120

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSG +P+HNNVSWRGNS M+DG SD+AT  K+LVGGYYDA
Sbjct  121  MFFNAQRSGPIPRHNNVSWRGNSGMKDGISDNATK-KNLVGGYYDA  165



>ref|XP_002465324.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
 gb|EER92322.1| hypothetical protein SORBIDRAFT_01g036480 [Sorghum bicolor]
Length=620

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 143/168 (85%), Gaps = 5/168 (3%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI   DSATDDDRSRNL D+DR A+SR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEICHPDSATDDDRSRNL-DIDRGAMSRTLDETQQSWLLAGPGDQARK  59

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD+GC++VSRK+F WT+G +LAAAV  G++  I K +PR HRP PPPD+YT+ALHK
Sbjct  60   KKKYVDIGCLVVSRKLFVWTLGVLLAAAVFAGVVAGIAKAIPRRHRPPPPPDDYTVALHK  119

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQRSGKLPKHNN+ WRGNSCM+DG SD A + + LVGGYYDA
Sbjct  120  ALMFFNAQRSGKLPKHNNIPWRGNSCMKDGLSDPA-VRRSLVGGYYDA  166



>ref|XP_002867672.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43931.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=620

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 133/164 (81%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DS TDDDRSRNLQDLDRA  SR LDETQQSWLLGP   KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSLTDDDRSRNLQDLDRATPSRPLDETQQSWLLGPKVLKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+VSRK+F WT+G ++  A+L G I LIVKT+P H    PP DNYT+AL  AL FF
Sbjct  61   DLGCILVSRKIFLWTLGIIVVTALLSGFITLIVKTLPHHKPKKPPLDNYTIALPIALKFF  120

Query  491  NAQRSGKLPKHNN-VSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK+NN V WRG+SC++DGK D    +KDLVGGYYDA
Sbjct  121  NAQQSGKLPKNNNSVKWRGDSCLQDGKGDPGQYYKDLVGGYYDA  164



>ref|XP_010909007.1| PREDICTED: endoglucanase 10-like [Elaeis guineensis]
Length=617

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 142/166 (86%), Gaps = 5/166 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTE--QKKK  301
            M+GRDPWGGPLEI  N+SATDDDRSRNLQDLDRAALSR LDETQQSWLL GP +  +KKK
Sbjct  1    MFGRDPWGGPLEI-TNESATDDDRSRNLQDLDRAALSRPLDETQQSWLLAGPGDAGKKKK  59

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            RY+DLGC++VSRK F WTVGSVL    L+GLI+LIVKTVP HH   PPPD YT ALHKAL
Sbjct  60   RYIDLGCLVVSRKHFLWTVGSVLGVGFLIGLIMLIVKTVPHHHPRPPPPDEYTKALHKAL  119

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSG +PKHNNVSWRGNS M+DG SD+A + K+LVGGYYDA
Sbjct  120  MFFNAQRSGPIPKHNNVSWRGNSGMKDGISDNA-VRKNLVGGYYDA  164



>ref|XP_004984503.1| PREDICTED: endoglucanase 9-like [Setaria italica]
Length=619

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI   DSATDDDRSRNL D+DR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CPDSATDDDRSRNL-DIDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD+GC++VSRK+F WT+G +LAAAV  G++  I K +PR HRP PPPD+YT+ALHK
Sbjct  59   KKKYVDIGCLVVSRKLFVWTLGVLLAAAVFAGVVAGIAKAIPRRHRPPPPPDDYTVALHK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQRSGKLPKHNNV WRGNSCM+DG SD A + + LVGGYYDA
Sbjct  119  ALMFFNAQRSGKLPKHNNVPWRGNSCMKDGLSDPA-VRRSLVGGYYDA  165



>ref|XP_008782747.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 145/171 (85%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  292
            MSMYGRDPWGGPLEI   DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNL-DLDRAALSTSSRPLDETQQSWLLAGPGDQ  59

Query  293  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
              KKK+YVDLGC+IVSRK+F WTVG+++A A L GLI LIVKT+PRHH P PPPDNYTLA
Sbjct  60   GKKKKKYVDLGCLIVSRKIFIWTVGTIVATAALAGLITLIVKTIPRHHHPKPPPDNYTLA  119

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDA
Sbjct  120  LHKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGLS-DTSYGRSLVGGFYDA  169



>ref|XP_010921267.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 144/171 (84%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  292
            MSMYGRDPWGGPLEI   DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNL-DLDRAALSTSSRPLDETQQSWLLAGPGDQ  59

Query  293  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
              KKK+YVDLGC+IVSRK+F WTVG+++A A L G I LIVKTVPRHH P PPPDNYTLA
Sbjct  60   GKKKKKYVDLGCLIVSRKLFIWTVGTIVATAALAGFITLIVKTVPRHHHPKPPPDNYTLA  119

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDA
Sbjct  120  LHKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGIS-DTSYGRSLVGGFYDA  169



>ref|XP_008793381.1| PREDICTED: endoglucanase 9-like [Phoenix dactylifera]
Length=622

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 143/171 (84%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  292
            MSMYGRDPWGGPLEI   DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP EQ
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNL-DLDRAALSTSSRPLDETQQSWLLAGPGEQ  59

Query  293  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
               KK+YVDLGC+IVSRK+F WTVG+++A A L G + LIVKTVPRHH P PPPDNYTLA
Sbjct  60   GKTKKKYVDLGCLIVSRKIFIWTVGTIVATAALAGFVTLIVKTVPRHHHPQPPPDNYTLA  119

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDA
Sbjct  120  LHKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGIS-DPSYGRSLVGGFYDA  169



>ref|NP_194157.1| endoglucanase 21 [Arabidopsis thaliana]
 sp|Q9STW8.1|GUN21_ARATH RecName: Full=Endoglucanase 21; AltName: Full=Endo-1,4-beta glucanase 
21 [Arabidopsis thaliana]
 emb|CAB45061.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 emb|CAB79336.1| endo-1, 4-beta-glucanase like protein [Arabidopsis thaliana]
 gb|AEE84879.1| endoglucanase 21 [Arabidopsis thaliana]
Length=620

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 135/164 (82%), Gaps = 1/164 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DS TDDDRSRNLQDLDRA  SR LDETQQSWLLGP   KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSMTDDDRSRNLQDLDRATPSRPLDETQQSWLLGPKVLKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+VSRK+F WT+G+++  A+L G I LIVKT+P HH   PPPDNYT+AL  AL FF
Sbjct  61   DLGCILVSRKIFLWTLGTIVVTALLSGFITLIVKTLPHHHHKEPPPDNYTIALRTALKFF  120

Query  491  NAQRSGKLPKH-NNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK+  NVSWR +SC++DGK D    +KDLVGGYYDA
Sbjct  121  NAQQSGKLPKNIYNVSWRHDSCLQDGKGDPGQCYKDLVGGYYDA  164



>ref|XP_006283336.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
 gb|EOA16234.1| hypothetical protein CARUB_v10004382mg [Capsella rubella]
Length=622

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDR-SRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRY  307
            MYGRDPWGGPLEI+A D+  DDDR SRNLQDLDRA LSR LDETQQSWLLGP E KKK+Y
Sbjct  1    MYGRDPWGGPLEINAADTLIDDDRRSRNLQDLDRAGLSRPLDETQQSWLLGPKELKKKKY  60

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            VDLGCI+VSRK+F WT+G V+A A L G I LIV+TVP H    P PDNYTLAL +AL F
Sbjct  61   VDLGCILVSRKIFLWTLGIVVATAFLSGFITLIVRTVPHHKHKPPSPDNYTLALRQALNF  120

Query  488  FNAQRSGKLPKH--NNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SGKLPK   NNV+WRG+SC++DGK D    + DLVGGYYDA
Sbjct  121  FNAQQSGKLPKKNINNVTWRGDSCLQDGKGDQGQSYTDLVGGYYDA  166



>ref|XP_008803421.1| PREDICTED: endoglucanase 10-like [Phoenix dactylifera]
Length=617

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 139/166 (84%), Gaps = 5/166 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL---GPTEQKKK  301
            M+GRDPWGGPLEI +N+SATDDDRSRNLQD+DRAALSR LDETQQSWLL   G T  KKK
Sbjct  1    MFGRDPWGGPLEI-SNESATDDDRSRNLQDVDRAALSRPLDETQQSWLLAGPGDTSNKKK  59

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            RY+DLGC++VSRK F WTVGSVL    L+GLI+LIVKTVP HH P PP D YT ALHKAL
Sbjct  60   RYIDLGCMVVSRKHFLWTVGSVLGVGFLIGLIMLIVKTVPHHHPPPPPADEYTKALHKAL  119

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            MFFNAQRSG + KHNNVSWRGNS MRDG SD+A   K+LVGGYYDA
Sbjct  120  MFFNAQRSGPIRKHNNVSWRGNSGMRDGLSDNAAR-KNLVGGYYDA  164



>ref|XP_009417855.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=620

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 148/170 (87%), Gaps = 8/170 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  292
            MSMYGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEIHA-DSATDDDRSRNL-DLDRAALSMTSRQLDETQQSWLLAGPGDQ  58

Query  293  -KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLAL  469
             KKK+YVDLGC+IVSRK+F W++G+V+AAA L GLI LIVKTVPRHHRP PPPDNYTLAL
Sbjct  59   GKKKKYVDLGCLIVSRKLFLWSLGAVVAAAALAGLITLIVKTVPRHHRPRPPPDNYTLAL  118

Query  470  HKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            HKALMFFNAQRSG +PKHNNVSWRGNS M+DG S D +  K LVGG+YDA
Sbjct  119  HKALMFFNAQRSGPIPKHNNVSWRGNSGMKDGIS-DPSYGKSLVGGFYDA  167



>ref|NP_001183308.1| hypothetical protein [Zea mays]
 gb|ACR36366.1| unknown [Zea mays]
 tpg|DAA45168.1| TPA: hypothetical protein ZEAMMB73_159477 [Zea mays]
Length=619

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTE--QK  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL D+DR ALSR+LDETQQSWLL GP +  +K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DIDRGALSRTLDETQQSWLLAGPGDPGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD+GC++VSRK+F WT+G +LAAAV  G++  I K +PR HRP PPPD+YT+ALHK
Sbjct  59   KKKYVDIGCLVVSRKLFVWTLGVLLAAAVFAGVVAGIAKAIPRRHRPPPPPDDYTVALHK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFN QRSGKLPKHNN+ WRGNSCM+DG SD A + + LVGGYYDA
Sbjct  119  ALMFFNGQRSGKLPKHNNIPWRGNSCMKDGLSDPA-VRRSLVGGYYDA  165



>ref|NP_001050004.1| Os03g0329500 [Oryza sativa Japonica Group]
 sp|P0C1U4.1|GUN9_ORYSJ RecName: Full=Endoglucanase 9; AltName: Full=Endo-1,4-beta glucanase 
9; AltName: Full=OsCel9D; AltName: Full=OsGLU1 [Oryza 
sativa Japonica Group]
 gb|ABF95745.1| membrane-anchored endo-1,4-beta-glucanase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11918.1| Os03g0329500 [Oryza sativa Japonica Group]
 dbj|BAF37261.1| endo-beta-1,4-D-glucanase [Oryza sativa]
 gb|EAY89858.1| hypothetical protein OsI_11408 [Oryza sativa Indica Group]
Length=619

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 144/168 (86%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVDLGC++VSRK+F WTVG +LAAAV  GL+  I K +PRHHRP PPPD++T+AL K
Sbjct  59   KKKYVDLGCLVVSRKLFVWTVGVLLAAAVFAGLVAGIAKAIPRHHRPPPPPDDFTVALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPK+NNV WRGNSCM+DG SD A + + LVGGYYDA
Sbjct  119  ALMFFNAQKSGKLPKNNNVHWRGNSCMKDGLSDPA-VGRSLVGGYYDA  165



>ref|NP_001147537.1| endo-1,4-beta-glucanase [Zea mays]
 gb|ACG27857.1| endo-1,4-beta-glucanase [Zea mays]
 gb|AFW88475.1| endo-1,4-beta-glucanase [Zea mays]
Length=620

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 141/168 (84%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPT---EQK  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL D+DRAALSR+LDETQQSWLL  T    +K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DIDRAALSRTLDETQQSWLLAGTADQPRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K +YVD+GC++VSRK+F WT+G +LAAAV  G +  I K +PR HRP PPPD+YT+ALHK
Sbjct  59   KNKYVDIGCLLVSRKLFVWTLGVLLAAAVFAGAVAGIAKAIPRRHRPLPPPDDYTVALHK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFF+AQRSGKLPKHNN+ WRGNSCM+DG SD A + + LVGGYYDA
Sbjct  119  ALMFFHAQRSGKLPKHNNIHWRGNSCMKDGLSDPA-VRRSLVGGYYDA  165



>ref|XP_006650027.1| PREDICTED: endoglucanase 9-like [Oryza brachyantha]
Length=619

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVDLGC++VSRK F WTVG +LAA +  GL+  I K +PRHHRP PPPD++T+AL K
Sbjct  59   KKKYVDLGCLVVSRKHFVWTVGVLLAAGMFAGLVAGIAKAIPRHHRPPPPPDDFTVALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPKHNNV WRGNSC++DG SD A + + LVGGY+DA
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGNSCLKDGLSDPA-VRRSLVGGYFDA  165



>emb|CDX92628.1| BnaC07g38860D [Brassica napus]
Length=619

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 130/163 (80%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DS TDDDRSRNLQ+LDR+AL R LD TQ+SWLLGP  +KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSITDDDRSRNLQELDRSALPRPLDATQRSWLLGPPVRKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+VSRK+F WT+G++L    L G I +IV+ VP H    P  DNYTLAL+K L+FF
Sbjct  61   DLGCILVSRKIFLWTLGTLLVTTFLAGSITMIVRHVPHHKHEKPQQDNYTLALNKTLLFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK NNVSWRGNSCM+D    +    +D+VGGYYDA
Sbjct  121  NAQKSGKLPKKNNVSWRGNSCMKDVDEGEYPP-RDVVGGYYDA  162



>ref|XP_009406859.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=623

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 141/172 (82%), Gaps = 9/172 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLG-PTEQ  292
            MSMYGRDPWGGPLEI   DSATDDDRSRNL D DRAA+S   R LDETQQSWLL  P +Q
Sbjct  1    MSMYGRDPWGGPLEISHADSATDDDRSRNL-DSDRAAMSTTSRQLDETQQSWLLAAPGDQ  59

Query  293  ---KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  463
               KK +YVDLGC+IVSRK+F WTVG+V+A AVL   I LIVKT+PRHHRP PPPDNYTL
Sbjct  60   GTKKKNKYVDLGCLIVSRKLFLWTVGTVVATAVLAAFITLIVKTIPRHHRPRPPPDNYTL  119

Query  464  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALHKALMFFNAQRSG +PKHNNVSWRGNS MRDG S D +  K LVGGYYDA
Sbjct  120  ALHKALMFFNAQRSGPIPKHNNVSWRGNSGMRDGLS-DPSYGKSLVGGYYDA  170



>ref|XP_011088109.1| PREDICTED: endoglucanase 25-like [Sesamum indicum]
Length=596

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 126/165 (76%), Gaps = 22/165 (13%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKR  304
            MSMYGRDPWGGPLEI A DSATDDDRSRNLQD DRAALSR LDETQQSWLLGP EQKKK 
Sbjct  1    MSMYGRDPWGGPLEI-AADSATDDDRSRNLQDYDRAALSRPLDETQQSWLLGPGEQKKK-  58

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
              +L    ++  +                   LIVKTVPRHH   PPPDNYTLAL+KALM
Sbjct  59   --NLAAGFLAGFI------------------TLIVKTVPRHHHRPPPPDNYTLALNKALM  98

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQRSGKLPKHNNVSWRGNSC+ DG+SD +T+FKDL GGYYDA
Sbjct  99   FFNAQRSGKLPKHNNVSWRGNSCLNDGESDSSTLFKDLTGGYYDA  143



>ref|XP_010938102.1| PREDICTED: endoglucanase 9-like [Elaeis guineensis]
Length=622

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 140/171 (82%), Gaps = 8/171 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  292
            MSMYGRDPWGGPLEI   DSATDDDRSRN+ DLDRAALS   R LDETQQSWLL GP +Q
Sbjct  1    MSMYGRDPWGGPLEISNADSATDDDRSRNM-DLDRAALSTSSRPLDETQQSWLLAGPGDQ  59

Query  293  --KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
               KK+YVDLGC+IVSRK+F WTVG ++A A L G I LIVKTVPRHH P  PPDNYTLA
Sbjct  60   GKTKKKYVDLGCLIVSRKLFIWTVGIIVAVAALAGFITLIVKTVPRHHHPQAPPDNYTLA  119

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L KALMFFNAQRSG+LPKHNNVSWRGNS M+DG S D +  + LVGG+YDA
Sbjct  120  LRKALMFFNAQRSGRLPKHNNVSWRGNSGMKDGIS-DPSYGRSLVGGFYDA  169



>ref|XP_003557996.1| PREDICTED: endoglucanase 9 [Brachypodium distachyon]
Length=621

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ-KK  298
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q +K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQARK  58

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++VSRK+F WTVG ++AAA   G++  I + +P+HH   PPPD YT+AL KA
Sbjct  59   KKYVDLGCLVVSRKLFVWTVGVLVAAAAFAGIVAGIAQAIPKHHPQPPPPDEYTVALRKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQ+SGKLPKHNNV WRG+SC++DG SD A   +DL GGYYD 
Sbjct  119  LMFFNAQKSGKLPKHNNVPWRGDSCLKDGSSDQA-FRRDLSGGYYDG  164



>gb|EEE58992.1| hypothetical protein OsJ_10702 [Oryza sativa Japonica Group]
Length=619

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 143/168 (85%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDR ALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRGALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVDLGC++VSRK+F  TVG +LAAAV  GL+  I K +PRHHRP PPPD++T+AL K
Sbjct  59   KKKYVDLGCLVVSRKLFVVTVGVLLAAAVFAGLVAGIAKAIPRHHRPPPPPDDFTVALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPK+NNV WRGNSCM+DG SD A + + LVGGYYDA
Sbjct  119  ALMFFNAQKSGKLPKNNNVHWRGNSCMKDGLSDPA-VGRSLVGGYYDA  165



>ref|XP_009137436.1| PREDICTED: endoglucanase 21-like [Brassica rapa]
 emb|CDY10998.1| BnaA03g46570D [Brassica napus]
Length=619

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGRDPWGGPLEI+A DS TDDDRSRNLQ+LDR+ L R LD TQ+SWLLGP  +KKK+YV
Sbjct  1    MYGRDPWGGPLEINAADSITDDDRSRNLQELDRSTLRRPLDATQRSWLLGPPVRKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            D+GC+ VSRK+F WT+G++L    L G I +IV+ VP H    P  DNYTLAL+K L+FF
Sbjct  61   DIGCMQVSRKIFLWTLGTLLVTTFLAGSITMIVRHVPHHKHEKPQQDNYTLALNKTLLFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK NNVSWRGNSCM+D    +    +D+VGGYYDA
Sbjct  121  NAQKSGKLPKKNNVSWRGNSCMKDVDEGEYPP-RDVVGGYYDA  162



>ref|XP_009399913.1| PREDICTED: endoglucanase 9-like [Musa acuminata subsp. malaccensis]
Length=691

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 147/171 (86%), Gaps = 9/171 (5%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLL-GPTEQ  292
            MS+YGRDPWGGPLEIHA DSATDDDRSRNL DLDRAALS   R LDETQQSWLL GP ++
Sbjct  71   MSIYGRDPWGGPLEIHA-DSATDDDRSRNL-DLDRAALSMTSRQLDETQQSWLLAGPGDK  128

Query  293  KKKR--YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
             KK+  YVDLGC+IVSRK+F WTVG+V+AAA L GLI LIVKTVP HHRP PPPDNYTLA
Sbjct  129  GKKKKKYVDLGCLIVSRKIFLWTVGAVVAAAALAGLITLIVKTVPHHHRPRPPPDNYTLA  188

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKALMFFNAQRSG++PKHNNVSWRGNS M+DG S D +  + LVGG+YDA
Sbjct  189  LHKALMFFNAQRSGRIPKHNNVSWRGNSGMKDGFS-DPSYGRSLVGGFYDA  238



>dbj|BAK04500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRHH P  PPD +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHHAPPTPPDQFTLALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD+A   +DL GGYYD 
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDEA-FRRDLSGGYYDG  165



>gb|AGK26802.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 139/168 (83%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD+ T  +DL GGYYD 
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDE-TSRRDLSGGYYDG  165



>gb|AGK26803.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KKRYVDLGC++VSRK+F W++G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWSLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD 
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDG  165



>gb|AGK26798.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26799.1| endo-beta-1,4-glucanase [Triticum aestivum]
 gb|AGK26800.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD 
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDG  165



>gb|AGK26801.1| endo-beta-1,4-glucanase [Triticum aestivum]
Length=622

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = +2

Query  125  MSMYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ--K  295
            MSMYGRDPWGGPLEI  +DSATDDDRSRNL DLDRAALSR+LDETQQSWLL GP +Q  K
Sbjct  1    MSMYGRDPWGGPLEI-CHDSATDDDRSRNL-DLDRAALSRTLDETQQSWLLAGPGDQGRK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KKRYVDLGC++VSRK+F WT+G +LAAA L G+   I K VPRH  P  P D +TLAL K
Sbjct  59   KKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAAGIAKAVPRHQAPPAPLDQFTLALRK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD 
Sbjct  119  ALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDG  165



>emb|CDY03467.1| BnaC01g16150D [Brassica napus]
Length=561

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGR P  G LEI+A +S TDDDRSR +Q+LDRA L   LD T++SWLL P + KKK+YV
Sbjct  1    MYGRHPLTGSLEINAAESITDDDRSRKMQELDRATLPPPLDATRRSWLLEPPQPKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+VSRK+F WT+G+VL   +L G I +IV+ +P H    P PDNYT+AL KALMFF
Sbjct  61   DLGCILVSRKIFLWTLGAVLVTTLLAGSITMIVRHMPHHKPTEPKPDNYTVALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNV+WRG+SCM+DGK      +KDLVGGYYDA
Sbjct  121  NAQKSGKLPEHNNVTWRGDSCMQDGKDQTGGFYKDLVGGYYDA  163



>emb|CDY34271.1| BnaA01g13740D [Brassica napus]
Length=561

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGR P   PLEI+A DS TDDDRSR LQ+ DRA L   LD T++SWLL P + KKK+YV
Sbjct  1    MYGRHPLTVPLEINAADSITDDDRSRKLQEHDRATLPPPLDATRRSWLLEPPQPKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGC++VSRK+F WT+G+VL   +L G I +IV+ +P H +  P P+NYT+AL KALMFF
Sbjct  61   DLGCMLVSRKIFLWTLGTVLVTTLLAGSITMIVRHMPHHKQTEPEPENYTVALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNV+WRG+SC++DGK      +KDLVGGYYDA
Sbjct  121  NAQKSGKLPEHNNVTWRGDSCLQDGKDQTGGFYKDLVGGYYDA  163



>ref|XP_009137865.1| PREDICTED: endoglucanase 21 [Brassica rapa]
Length=610

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MYGR P   PLEI+A DS TDDDRSR LQ+ DRA L   LD T++SWLL P + KKK+YV
Sbjct  1    MYGRHPLTVPLEINAADSITDDDRSRKLQEHDRATLPPPLDATRRSWLLEPPQPKKKKYV  60

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGC++VSRK+F WT+G+VL   +L G I +IV+ +P H +  P P+NYT+AL KALMFF
Sbjct  61   DLGCMLVSRKIFLWTLGTVLVTTLLAGSITMIVRHMPHHKQTEPEPENYTVALRKALMFF  120

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP+HNNV+WRG+SC++DGK      +KDLVGGYYDA
Sbjct  121  NAQKSGKLPEHNNVTWRGDSCLQDGKDQTGGFYKDLVGGYYDA  163



>tpg|DAA51201.1| TPA: endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   170 bits (430),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 132/167 (79%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            KRYVDLGC++V RKVF WTVG++L   V +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KRYVDLGCVVVDRKVFMWTVGTILGLGVFIGFVIMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGFYDA  163



>ref|XP_002463915.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
 gb|EER90913.1| hypothetical protein SORBIDRAFT_01g008860 [Sorghum bicolor]
Length=621

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 132/167 (79%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDA  163



>ref|NP_001151770.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
 gb|ACG44266.1| endo-1,4-beta-glucanase Cel1 [Zea mays]
Length=621

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 132/167 (79%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            KRYVDLGC++V RKVF WTVG+VL   V +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KRYVDLGCLVVDRKVFMWTVGTVLGLGVFIGFVIMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGFYDA  163



>emb|CDI66528.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
 emb|CDI66541.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 132/167 (79%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDA  163



>emb|CDI66566.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=621

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 132/167 (79%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDA  163



>gb|ACN28577.1| unknown [Zea mays]
 gb|ACN34658.1| unknown [Zea mays]
 gb|AFW67687.1| hypothetical protein ZEAMMB73_593933 [Zea mays]
Length=621

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 132/167 (79%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            KRYVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KRYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ + LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGFYDA  163



>ref|NP_001051192.1| Os03g0736300 [Oryza sativa Japonica Group]
 sp|Q84R49.1|GUN10_ORYSJ RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; AltName: Full=OsGLU2 [Oryza sativa Japonica Group]
 gb|AAP03405.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|AAR07086.1| putative endo-1,4-beta-glucanase [Oryza sativa Japonica Group]
 gb|ABF98746.1| endo-1,4-beta-glucanase Cel1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13106.1| Os03g0736300 [Oryza sativa Japonica Group]
 dbj|BAG91933.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76139.1| hypothetical protein OsI_13426 [Oryza sativa Indica Group]
 gb|EEE59884.1| hypothetical protein OsJ_12485 [Oryza sativa Japonica Group]
Length=620

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    R AL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RGALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC+++ RK+F WTVG++L   + +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCMVLDRKIFMWTVGTILGVGLFIGFVMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T+ K LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTVRKSLVGGFYDA  163



>ref|XP_004981854.1| PREDICTED: endoglucanase 10-like [Setaria italica]
Length=621

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 131/167 (78%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC+++ RK+F WTVG++L   V +G I++IVK VP    P PPPD YT A+HKA
Sbjct  58   KKYVDLGCVVLDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQAVHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNSCM+DG S D+T  + LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSCMKDGLS-DSTTRRSLVGGFYDA  163



>emb|CBB36505.1| Hordeum vulgare protein similar to endo-1,4-b-glucanase BAA94257 
[Saccharum hybrid cultivar R570]
Length=626

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 132/172 (77%), Gaps = 13/172 (8%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQR-----SGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQR     SG LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDA
Sbjct  118  LMFFNAQRCEYHLSGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDA  168



>ref|XP_006650552.1| PREDICTED: endoglucanase 10-like [Oryza brachyantha]
Length=618

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 129/167 (77%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGPLEI   DSATDDDRSR+L    R AL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPLEISNADSATDDDRSRDLD---RGALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++V RK+F WTVG+++   + +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCMVVDRKIFMWTVGTIVGVGLFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNS M+DG S D+T  K LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGNSGMKDGLS-DSTARKSLVGGFYDA  163



>ref|XP_010277803.1| PREDICTED: endoglucanase 12-like [Nelumbo nucifera]
Length=615

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 132/163 (81%), Gaps = 3/163 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            M+  + WGG  EI+A DS T+D+RSRN++  DRAALS++LDETQQSWLLGP E+KKK+YV
Sbjct  1    MHSANHWGGSFEINA-DSTTEDERSRNME-YDRAALSQNLDETQQSWLLGPKEKKKKKYV  58

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+ SRK FKWT+ S+L A +++ L  +IVKT+P+H   +PPPDNYT ALHKAL+FF
Sbjct  59   DLGCIVCSRKAFKWTLWSILIAFLVIALPTIIVKTLPKHKSRSPPPDNYTNALHKALLFF  118

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK+N VSWRG+S ++DG SD   I   LVGGYYDA
Sbjct  119  NAQKSGKLPKNNGVSWRGDSGLKDG-SDMPEIKGGLVGGYYDA  160



>ref|XP_006858738.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
 gb|ERN20205.1| hypothetical protein AMTR_s00066p00128970 [Amborella trichopoda]
Length=619

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 131/168 (78%), Gaps = 8/168 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-----RSLDETQQSWLLGPTEQK  295
            M+G + WGG  EIH  DSATDD+RSRN+ D+DRAALS     ++LDETQQSWLLGP+E K
Sbjct  1    MHGGNHWGGSFEIHG-DSATDDERSRNM-DIDRAALSHHSHSQNLDETQQSWLLGPSEPK  58

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K +Y+DLGC++ SRK F+++V +V+ A V++ L ++IVK++P+HH   P PDNYTLALHK
Sbjct  59   KNKYIDLGCVVCSRKAFRYSVWTVVIALVVIVLPIVIVKSLPKHHPKPPKPDNYTLALHK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALMFFNAQ+SG+LP+ N V WR +S ++DG SD   +   LVGGYYDA
Sbjct  119  ALMFFNAQKSGRLPRSNGVPWRHDSGLQDG-SDAKDVKGGLVGGYYDA  165



>emb|CDI66602.1| Endoglucanase 10 [Saccharum hybrid cultivar R570]
Length=624

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 130/170 (76%), Gaps = 11/170 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+ RDPWGGPLEI   DSATDDDRSR+L    RAAL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFRRDPWGGPLEISNADSATDDDRSRDLD---RAALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC++V RK+F WTVG++L   V +G I++IVK VP    P PPPD YT ALHKA
Sbjct  58   KKYVDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQR---SGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQR    G LPKHN VSWRGNSCM+DG S D+T+ + LVGGYYDA
Sbjct  118  LMFFNAQRCEFPGPLPKHNGVSWRGNSCMKDGLS-DSTVRRSLVGGYYDA  166



>ref|XP_009385674.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=617

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGPTEQKKK-R  304
            M+  + WGG  EIH  D  TDD+ SRN+ DLDRAALSR  LDETQQSWLLGP E KKK +
Sbjct  1    MHSMNHWGGSFEIH--DPTTDDEHSRNM-DLDRAALSRQQLDETQQSWLLGPQEAKKKDK  57

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGC++V RKV KWT  +VL A V++G+ + I K++P+H +  PPPD YT ALHKALM
Sbjct  58   YVDLGCMVVKRKVLKWTFYAVLIAFVVIGVPITIAKSIPKHKKAPPPPDRYTEALHKALM  117

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FFNAQ+SG+LPK+N + WRG+S ++DG S+   +   LVGGYYDA
Sbjct  118  FFNAQKSGRLPKNNGIPWRGDSGLKDG-SEGTDVKGGLVGGYYDA  161



>gb|ACZ82300.1| beta-1,4 glycosidase [Phyllostachys edulis]
Length=617

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 128/167 (77%), Gaps = 8/167 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGGP+EI   DSATDDDRSR+L    R AL R LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGPMEISNADSATDDDRSRDLD---RGALMRQLDETQQSWLLAGPGDQAGKKK  57

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K YVDLGC+++ RK+F WTVG++L   + +G +++IVK VP    P PPPD YT ALHKA
Sbjct  58   KTYVDLGCMVIDRKIFVWTVGTILGVGLFIGFVMMIVKLVPHKRPPPPPPDQYTQALHKA  117

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRG S M+DG SD+ T+ + LVGG+YDA
Sbjct  118  LMFFNAQRSGPLPKHNGVSWRGKSAMKDGLSDN-TVRRSLVGGFYDA  163



>dbj|BAJ94336.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 127/167 (76%), Gaps = 7/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGG LEI   DSATDDDRSR+L     A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATDDDRSRDLDR--GAMMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVD+GC+++ RK+F WTVG VL   + VG +++IVK VP    P PPPD YTLALHKA
Sbjct  59   KKYVDIGCMVIDRKIFMWTVGLVLGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNS M+DG S D+T+ K LVGG+YDA
Sbjct  119  LMFFNAQRSGHLPKHNGVSWRGNSGMKDGLS-DSTVKKSLVGGFYDA  164



>emb|CDP21162.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 121/161 (75%), Gaps = 6/161 (4%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKKKRYVDL  316
            WGG LEI   DSAT+D++SRN++  DRA++S    + LDETQQSWLLGP E+KKK+YVDL
Sbjct  5    WGGSLEISTTDSATEDEKSRNME-WDRASVSYQHYQHLDETQQSWLLGPPERKKKKYVDL  63

Query  317  GCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNA  496
            GC++ S K  KWTV  +L A  ++GL V+IVK VP+H     PPDNYTLALHKAL+FFNA
Sbjct  64   GCVVCSTKALKWTVYGILIAFFVIGLPVMIVKLVPKHKHHPSPPDNYTLALHKALLFFNA  123

Query  497  QRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            Q+SGKLPK+N + WRGNS + DG S    +   LVGGYYDA
Sbjct  124  QKSGKLPKNNGIPWRGNSGLSDG-SKLTDVKGGLVGGYYDA  163



>dbj|BAA94257.1| endo-1,4-beta-glucanase Cel1 [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 126/167 (75%), Gaps = 7/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGG LEI   DSATDDDRSR+L     A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATDDDRSRDLDR--GAMMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVD+GC+++ RK+F WTVG VL   + VG +++IVK VP    P PPPD YTLALHKA
Sbjct  59   KKYVDIGCMVIDRKIFMWTVGLVLGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNS M+DG   D+T+ K LVGG+YDA
Sbjct  119  LMFFNAQRSGHLPKHNGVSWRGNSGMKDGLP-DSTVKKSLVGGFYDA  164



>gb|EYU39502.1| hypothetical protein MIMGU_mgv1a002977mg [Erythranthe guttata]
 gb|EYU39503.1| hypothetical protein MIMGU_mgv1a002977mg [Erythranthe guttata]
Length=620

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 125/163 (77%), Gaps = 8/163 (5%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALSR------SLDETQQSWLLGPTEQKKKRYV  310
            WGG LEI+  DSA D+DR+RN  D DRA++SR      +L+ETQ+SWLLGP ++KKK+YV
Sbjct  5    WGGTLEINGGDSANDEDRNRN-ADWDRASISRREYENDNLNETQKSWLLGPPDKKKKKYV  63

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGC++ SR   KWT+ S+L A +++GL ++I K++P+H     PPDNYT+ALHKAL+FF
Sbjct  64   DLGCVVCSRSALKWTILSILIAFIVIGLPIIIAKSLPKHKEAPTPPDNYTIALHKALLFF  123

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK+N + WRG+S ++DG SD   +   LVGGYYDA
Sbjct  124  NAQKSGKLPKNNGIPWRGDSGLQDG-SDQTDLKGGLVGGYYDA  165



>gb|ACT54547.1| endo-1,4-beta-glucanase [Dimocarpus longan]
Length=628

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 121/174 (70%), Gaps = 12/174 (7%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHAN----DSATDDDRSRNLQDLDRAALSRS-------LDETQQSWLL  277
            M+G + WGG  EI  N       TDD++SRN+   D+A+L  S       LDETQQSWLL
Sbjct  1    MHGGNHWGGSFEIVNNGDHPHHHTDDEKSRNMDQWDKASLQHSQSQRYHHLDETQQSWLL  60

Query  278  GPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnY  457
            GP E KKK+YVDLGC++ SRK  KWT+ S + A +++ L ++I KT+P+H    PPPDNY
Sbjct  61   GPPEAKKKKYVDLGCVVCSRKALKWTLWSFVIAFIVIALPIIIAKTIPKHKPRPPPPDNY  120

Query  458  TLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            TLALHKAL+FFNAQ+SGKLPK+N + WRGNS + DG +    +   LVGGYYDA
Sbjct  121  TLALHKALLFFNAQKSGKLPKNNGIPWRGNSGLSDGNA-TTDVKGGLVGGYYDA  173



>ref|XP_003560035.1| PREDICTED: endoglucanase 10 [Brachypodium distachyon]
Length=621

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 126/167 (75%), Gaps = 7/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGG LEI   DSATDDDRSR+L     A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATDDDRSRDLDR--GALMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVD+GC+++ RK+F WTVG++L   + +G +++IVK VP    P PPPD YT ALHKA
Sbjct  59   KKYVDIGCMVIDRKIFLWTVGTILGVGLFIGFVMMIVKLVPHKKPPPPPPDQYTQALHKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN VSWRGNS M+DG S D+T  K LVGG+YDA
Sbjct  119  LMFFNAQRSGPLPKHNGVSWRGNSGMKDGLS-DSTARKSLVGGFYDA  164



>gb|EMT18790.1| Endoglucanase 9 [Aegilops tauschii]
Length=604

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +2

Query  185  ATDDDRSRNLQDLDRAALSRSLDETQQSWLLG-PTEQ--KKKRYVDLGCIIVSRKVFKWT  355
            ATDDDR RNL DLDRAALSR+LDETQQ WLLG P +Q  KKKRYVDLGC++VSRK+F W+
Sbjct  2    ATDDDRRRNL-DLDRAALSRTLDETQQGWLLGGPGDQGRKKKRYVDLGCLLVSRKLFLWS  60

Query  356  vgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVS  535
            +G +LAAA L G+   I K VPRH  P  PPD +TLAL KALMFFNAQ+SGKLPKHNNV 
Sbjct  61   LGLLLAAAALAGIAAGIAKAVPRHQAPPAPPDQFTLALRKALMFFNAQKSGKLPKHNNVP  120

Query  536  WRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            WRG+SC++DG+SD  T  +DL GGYYD 
Sbjct  121  WRGDSCLKDGRSDQ-TSRRDLSGGYYDG  147



>ref|XP_010930303.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=618

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 6/166 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGP--TEQKKK  301
            M+  + WGG  EIHA D +TDD+ SRN+ DLDRAA+ R  LDETQQSWLLGP  + QKK 
Sbjct  1    MHSGNQWGGSFEIHA-DPSTDDEHSRNM-DLDRAAVYRQQLDETQQSWLLGPQDSTQKKD  58

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCII  RKV  W V + L A V++G+ ++IVK++P+H    PPPD Y +ALHKAL
Sbjct  59   KYVDLGCIICKRKVVWWIVWTALIAFVVIGIPIIIVKSLPKHKEKAPPPDQYAMALHKAL  118

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +FFNAQ+SG+LPK N + WRGNS +RDG  D   I   LVGGYYDA
Sbjct  119  LFFNAQKSGRLPKSNGIPWRGNSGLRDG-FDQPDIKGGLVGGYYDA  163



>gb|AAM13693.1| endo-1,4-beta-glucanase [Triticum aestivum]
Length=620

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 125/167 (75%), Gaps = 7/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLL-GPTEQ---KK  298
            M+GRDPWGG LEI   DSATDDDRSR+L     A +   LDETQQSWLL GP +Q   KK
Sbjct  1    MFGRDPWGGTLEISNADSATDDDRSRDLDR--GAMMRHQLDETQQSWLLAGPGDQAGKKK  58

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVD+GC+++ RK+F WTVG +L   + VG +++IVK VP    P PPPD YTLALHKA
Sbjct  59   KKYVDIGCMVIDRKIFMWTVGLILGVGLFVGFVMMIVKLVPHKKPPPPPPDQYTLALHKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LMFFNAQRSG LPKHN V  RGNS M+DG S D+T+ K LVGG+YDA
Sbjct  119  LMFFNAQRSGHLPKHNGVXGRGNSGMKDGLS-DSTVKKSLVGGFYDA  164



>ref|XP_002983992.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
 gb|EFJ15004.1| hypothetical protein SELMODRAFT_268803 [Selaginella moellendorffii]
Length=610

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 5/157 (3%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  328
            WGGPLE+   +   DDD+SR+++ LDRAAL + L+ETQQSWLLG  E+KKK+ VDLGCI+
Sbjct  2    WGGPLEVFQLE-GHDDDQSRSME-LDRAALQK-LEETQQSWLLGAGEKKKKQVVDLGCIV  58

Query  329  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  508
             SRK+F   V +++A  +++G  VLIVKT P+H R  PPPDNYT+ALHK LMFFNAQ+SG
Sbjct  59   CSRKLFTGIVTALVAVGLIIGFTVLIVKTAPKHRRHAPPPDNYTVALHKTLMFFNAQKSG  118

Query  509  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            KLPKHNNVS+RGNS M+DG   D  I  +L+GGYYDA
Sbjct  119  KLPKHNNVSFRGNSGMQDGV--DPGIHGNLIGGYYDA  153



>ref|XP_002960146.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
 gb|EFJ37685.1| hypothetical protein SELMODRAFT_266522 [Selaginella moellendorffii]
Length=620

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 123/157 (78%), Gaps = 5/157 (3%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  328
            WGGPLE+   +   DDD+SR+++ LDRAAL + L+ETQQSWLLG  E+KKK+ VDLGCI+
Sbjct  2    WGGPLEVFQLE-GHDDDQSRSME-LDRAALQK-LEETQQSWLLGAGEKKKKQVVDLGCIV  58

Query  329  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  508
             SRK+F   V +++A  +++G  VLIVKT P+H R  PPPDNYT+ALHK LMFFNAQ+SG
Sbjct  59   CSRKLFTGIVTALVAVGLIIGFTVLIVKTAPKHRRHAPPPDNYTVALHKTLMFFNAQKSG  118

Query  509  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            KLPKHNNVS+RGNS M+DG   D  I  +L+GGYYDA
Sbjct  119  KLPKHNNVSFRGNSGMQDGV--DPGIHGNLIGGYYDA  153



>gb|KDP32490.1| hypothetical protein JCGZ_13415 [Jatropha curcas]
Length=623

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 120/171 (70%), Gaps = 11/171 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEI-HANDSATDDDRSRNLQDLDRAALS-------RSLDETQQSWLLGPT  286
            M+  + WGG  EI +  +S T+D+RSRN++  DR AL         +LDETQQSWLL P 
Sbjct  1    MHSGNNWGGSFEIINGAESTTEDERSRNME-WDRGALQSQQQRYHNNLDETQQSWLLYPQ  59

Query  287  EQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
            E KKK+YVD GCI+ SRK  KWTV S+L A +++ L  +I KT+P+H    PPPDNYTLA
Sbjct  60   ETKKKKYVDFGCIVCSRKALKWTVYSILIAFLVIALPTIIAKTLPKHKSHPPPPDNYTLA  119

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKAL+FFNAQRSGKLPK+N + WRG+S ++DG   D      LVGGYYDA
Sbjct  120  LHKALLFFNAQRSGKLPKNNGIPWRGDSGLQDGNDTDYK--GGLVGGYYDA  168



>gb|AFR40441.1| cellulase, partial [Populus nigra]
 gb|AFR40445.1| cellulase, partial [Populus nigra]
 gb|AFR40449.1| cellulase, partial [Populus nigra]
Length=89

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40405.1| cellulase, partial [Populus trichocarpa]
Length=85

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40409.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40418.1| cellulase, partial [Populus alba]
 gb|AFR40422.1| cellulase, partial [Populus alba]
 gb|AFR40423.1| cellulase, partial [Populus alba]
 gb|AFR40442.1| cellulase, partial [Populus nigra]
 gb|AFR40443.1| cellulase, partial [Populus nigra]
Length=88

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40402.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40404.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40407.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40410.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40411.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40413.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40416.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40417.1| cellulase, partial [Populus alba]
 gb|AFR40419.1| cellulase, partial [Populus alba]
 gb|AFR40420.1| cellulase, partial [Populus alba]
 gb|AFR40421.1| cellulase, partial [Populus alba]
 gb|AFR40436.1| cellulase, partial [Populus nigra]
 gb|AFR40437.1| cellulase, partial [Populus nigra]
 gb|AFR40438.1| cellulase, partial [Populus nigra]
 gb|AFR40439.1| cellulase, partial [Populus nigra]
 gb|AFR40440.1| cellulase, partial [Populus nigra]
 gb|AFR40444.1| cellulase, partial [Populus nigra]
 gb|AFR40446.1| cellulase, partial [Populus nigra]
 gb|AFR40447.1| cellulase, partial [Populus nigra]
 gb|AFR40448.1| cellulase, partial [Populus nigra]
Length=89

 Score =   136 bits (343),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40406.1| cellulase, partial [Populus trichocarpa]
 gb|AFR40415.1| cellulase, partial [Populus trichocarpa]
Length=86

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>gb|AFR40430.1| cellulase, partial [Populus fremontii]
Length=81

 Score =   135 bits (341),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/76 (87%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGCIIVSRK+F WT
Sbjct  61   VDLGCIIVSRKIFVWT  76



>ref|NP_001147970.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|ACG29288.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
Length=623

 Score =   145 bits (367),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 117/168 (70%), Gaps = 9/168 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  298
            MY  + WGG  EI   D A +DD SRN+ DLDR ALS      LDETQQSWLLGP E KK
Sbjct  1    MYSANHWGGSFEI--ADGAAEDDHSRNM-DLDRGALSARQHHELDETQQSWLLGPPEAKK  57

Query  299  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K +YVDLGC++V RK+  W +  V+AA VL+GL ++I K++P      PPPD YT ALHK
Sbjct  58   KDKYVDLGCVVVKRKLLWWALWCVVAAFVLIGLPIIIAKSIPHKKPGPPPPDQYTEALHK  117

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SG LPK+N + WRGNS + DG SD   +   LVGGYYDA
Sbjct  118  ALLFFNAQKSGHLPKNNGIKWRGNSGLSDG-SDAKDVKGGLVGGYYDA  164



>ref|NP_001288466.1| endoglucanase 12-like [Zea mays]
 gb|ACG29946.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|AFW60051.1| glycoside transferase, six-hairpin, subgroup [Zea mays]
 gb|AGG19096.1| cellulase [Zea mays]
Length=623

 Score =   145 bits (366),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 117/168 (70%), Gaps = 9/168 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  298
            MY  + WGG  EI   D A +DD SRN+ DLDR ALS      LDETQQSWLLGP E KK
Sbjct  1    MYSANHWGGSFEI--ADGAAEDDHSRNM-DLDRGALSARQHHELDETQQSWLLGPPEAKK  57

Query  299  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K +YVDLGCI+V RK+  W +  V+AA VL+GL ++I K++P      PPPD YT ALHK
Sbjct  58   KDKYVDLGCIVVKRKMLWWALWCVVAAFVLIGLPIIIAKSIPHKKPGPPPPDQYTDALHK  117

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SG LPK+N + WRGNS + DG SD   +   LVGGYYDA
Sbjct  118  ALLFFNAQKSGHLPKNNGIKWRGNSGLSDG-SDAKDVKGGLVGGYYDA  164



>ref|XP_008813788.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 119/166 (72%), Gaps = 6/166 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGPTEQKKKR-  304
            M+  + WGG  EIH  D  TDD+  R++ DLDRAA+SR  LDETQQSWLL P +  KK+ 
Sbjct  1    MHSGNHWGGTFEIHV-DPVTDDEHGRSM-DLDRAAVSRQQLDETQQSWLLEPQDSSKKKD  58

Query  305  -YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
             YVDLGC++  RKV  W + + L A V++G+ ++I K++P+H     PPD YT+ALHKAL
Sbjct  59   EYVDLGCVVCKRKVVGWIMWTALVAFVVIGIPIIIAKSLPKHKEKELPPDQYTMALHKAL  118

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +FFNAQ+SG+LPK+N +SWRGNS ++DG  D   I   LVGGYYDA
Sbjct  119  LFFNAQKSGRLPKNNGISWRGNSGLKDG-FDQPDIEGGLVGGYYDA  163



>gb|AFR40432.1| cellulase, partial [Populus fremontii]
 gb|AFR40435.1| cellulase, partial [Populus fremontii]
Length=89

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCFIVSRKIFVWT  76



>gb|AFR40424.1| cellulase, partial [Populus fremontii]
 gb|AFR40425.1| cellulase, partial [Populus fremontii]
 gb|AFR40429.1| cellulase, partial [Populus fremontii]
 gb|AFR40433.1| cellulase, partial [Populus fremontii]
 gb|AFR40434.1| cellulase, partial [Populus fremontii]
Length=88

 Score =   134 bits (338),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCFIVSRKIFVWT  76



>gb|AFR40426.1| cellulase, partial [Populus fremontii]
 gb|AFR40427.1| cellulase, partial [Populus fremontii]
 gb|AFR40431.1| cellulase, partial [Populus fremontii]
Length=87

 Score =   134 bits (337),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCFIVSRKIFVWT  76



>gb|AFR40428.1| cellulase, partial [Populus fremontii]
Length=87

 Score =   134 bits (336),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLGC IVSRK+F WT
Sbjct  61   VDLGCXIVSRKIFVWT  76



>ref|XP_004976098.1| PREDICTED: endoglucanase 12-like [Setaria italica]
Length=623

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 113/168 (67%), Gaps = 9/168 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  298
            MY  + WGG  EI   D A +DD SRN+ DLDR ALS      LDETQQSWLLGP E KK
Sbjct  1    MYSGNQWGGSFEI--GDGAAEDDHSRNM-DLDRGALSARQHHELDETQQSWLLGPPEAKK  57

Query  299  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K +YVDLGC++V RKV  W +  ++ A VL+GL ++I K +P      PP D YT  LHK
Sbjct  58   KDKYVDLGCVVVKRKVLWWALWCLVGAFVLIGLPIIIAKAIPHKKPRPPPDDQYTEVLHK  117

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL FFNAQ+SG+LPK+N V WRGNS + DG SD   +   LVGGYYDA
Sbjct  118  ALRFFNAQKSGRLPKNNGVPWRGNSGLSDG-SDAKDVKGGLVGGYYDA  164



>sp|Q7XUK4.2|GUN12_ORYSJ RecName: Full=Endoglucanase 12; AltName: Full=Endo-1,4-beta glucanase 
12; AltName: Full=OsGLU3 [Oryza sativa Japonica Group]
 emb|CAD41250.2| OSJNBa0067K08.14 [Oryza sativa Japonica Group]
 emb|CAH67495.1| H0306B06.10 [Oryza sativa Indica Group]
 emb|CAH67511.1| OSIGBa0092E01.6 [Oryza sativa Indica Group]
 dbj|BAL14837.1| endo-1,4-b-D-glucanase [Oryza sativa Japonica Group]
Length=623

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKKK  301
            MY  + WGG  EI A D A +DD SRN+ DLDR ALS     LDETQQSWLLGP E KKK
Sbjct  1    MYSANHWGGSFEIAA-DGAAEDDHSRNM-DLDRGALSARQHQLDETQQSWLLGPPEAKKK  58

Query  302  -RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
             +YVDLGC++V RK+  W + ++LAA +L+GL V+I K++P+     PPPD YT ALHKA
Sbjct  59   DKYVDLGCVVVKRKLLWWVLWTLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L+FFNAQ+SG+LPK+N + WRGNS + DG SD   +   LVGGYYDA
Sbjct  119  LLFFNAQKSGRLPKNNGIKWRGNSGLSDG-SDLTDVKGGLVGGYYDA  164



>ref|XP_006652472.1| PREDICTED: endoglucanase 12-like [Oryza brachyantha]
Length=629

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 120/167 (72%), Gaps = 7/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKKK  301
            MY  + WGG  EI A D A +DD SRN+ DLDR ALS     LDETQQSWLLGP E KKK
Sbjct  1    MYSANHWGGSFEIAA-DGAAEDDHSRNM-DLDRGALSARQHQLDETQQSWLLGPPEAKKK  58

Query  302  -RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
             +YVDLGC++V RK+  W +  +LAA +L+GL V+I K++P+     PPPD YT ALHKA
Sbjct  59   DKYVDLGCVVVKRKLLWWILWVLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKA  118

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L+FFNAQ+SG+LPK+N + WRGNS + DG SD   +   LVGGYYDA
Sbjct  119  LLFFNAQKSGRLPKNNGIKWRGNSGLSDG-SDLTDVKGGLVGGYYDA  164



>ref|XP_009602898.1| PREDICTED: endoglucanase 12 [Nicotiana tomentosiformis]
Length=635

 Score =   143 bits (360),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 124/182 (68%), Gaps = 21/182 (12%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALSR-----------------SLD  253
            M+  + WGG LEI    + +A + DRSRNL D DRA+++                  +LD
Sbjct  1    MHSANHWGGSLEIANTGDSTAEEYDRSRNL-DWDRASVNHHQKQQQYNNYDQYSHRHNLD  59

Query  254  ETQQSWLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhr  433
            ETQQSWLLGP E+KKK+YVDLGCI+ SRK FK+T+  ++ A +++ L  +I K++P+H  
Sbjct  60   ETQQSWLLGPPEKKKKKYVDLGCIVCSRKAFKYTIYGIIIAFLVIALPTIIAKSLPKHKT  119

Query  434  pnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYY  613
               PPDNYT+ALHKAL+FFNAQ+SGKLPK+N V WRG+S ++DG S    +   L+GGYY
Sbjct  120  RPSPPDNYTIALHKALLFFNAQKSGKLPKNNEVPWRGDSGLQDG-SKLTDVKGGLIGGYY  178

Query  614  DA  619
            DA
Sbjct  179  DA  180



>gb|AFR40408.1| cellulase, partial [Populus trichocarpa]
Length=87

 Score =   132 bits (333),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLG IIVSRK+F WT
Sbjct  61   VDLGXIIVSRKIFVWT  76



>gb|AFR40412.1| cellulase, partial [Populus trichocarpa]
Length=89

 Score =   132 bits (333),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/76 (86%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ-KKKRY  307
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ KKK+Y
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQKKKKKY  60

Query  308  VDLGCIIVSRKVFKWT  355
            VDLG IIVSRK+F WT
Sbjct  61   VDLGXIIVSRKIFVWT  76



>ref|XP_009782313.1| PREDICTED: endoglucanase 12 [Nicotiana sylvestris]
Length=634

 Score =   142 bits (358),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 123/181 (68%), Gaps = 20/181 (11%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDD--DRSRNLQDLDRAALS----------------RSLDE  256
            M+  + WGG LEI  N  +T +  DRSRNL D D+A+++                 +LDE
Sbjct  1    MHSANHWGGSLEIANNGDSTAEEYDRSRNL-DWDKASINHQQQQQYNNYDQYSQRHNLDE  59

Query  257  TQQSWLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrp  436
            TQQSWLLGP E+KKK++VDLGCI+ SRK FK+T+  ++ A +++ L  +I KT+P+H   
Sbjct  60   TQQSWLLGPPEKKKKKHVDLGCIVCSRKAFKYTIYGIIIAFLVIALPTIIAKTLPKHKTR  119

Query  437  npppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYD  616
              PPDNYT+ALHKAL+FFNAQ+SGKLPK N + WRG+S ++DG S    +   L+GGYYD
Sbjct  120  PSPPDNYTIALHKALLFFNAQKSGKLPKSNGIPWRGDSGLKDG-SKLTDVKGGLIGGYYD  178

Query  617  A  619
            A
Sbjct  179  A  179



>ref|XP_002514768.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF47322.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=624

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 120/173 (69%), Gaps = 14/173 (8%)
 Frame = +2

Query  131  MYGRDPWGGPLEI-HANDSATDDDRSRNLQDLDRAAL--------SRSLDETQQSWLLGP  283
            M+  + WGG  EI +  +S  +D RSRN++  DR AL        + +LDETQQSWLL P
Sbjct  1    MHSGNNWGGSFEIMNGAESTAEDQRSRNIE-WDRGALHSQQHYHHNHNLDETQQSWLLYP  59

Query  284  TEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  463
             E KKK+Y+D GCI+ S K FKWT+ S+L A +++ L  ++ KT+P+H    PPPDNYTL
Sbjct  60   QETKKKKYIDFGCIVCSHKAFKWTLYSILIAFLVIALPTIVAKTLPKHKSSPPPPDNYTL  119

Query  464  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFK-DLVGGYYDA  619
            ALHKAL+FFNAQRSGKLPK+N + WRG+S ++DG   D   FK  L GGYYDA
Sbjct  120  ALHKALLFFNAQRSGKLPKNNGIPWRGDSGLQDGNDTD---FKAGLDGGYYDA  169



>ref|XP_011010912.1| PREDICTED: endoglucanase 12 [Populus euphratica]
 ref|XP_011010993.1| PREDICTED: endoglucanase 12 [Populus euphratica]
Length=620

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 120/167 (72%), Gaps = 6/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH-ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKK  298
            M+  + WGG LEI+   +S TDDD+SRN++  D+AAL      LDETQQSWLL P E KK
Sbjct  1    MHSANHWGGSLEIYNGTESTTDDDKSRNME-WDKAALQPQHHHLDETQQSWLLYPQETKK  59

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGC+  S K  KWT+ + + A +++ L  ++VKT+P+H+   PPPDNYTLAL KA
Sbjct  60   KKYVDLGCVACSHKALKWTLYAFVFALLVIALPTIVVKTLPKHNSQPPPPDNYTLALRKA  119

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L+FFNAQ+SGKL K+N + WRG+S ++DG   D +    LVGGYYDA
Sbjct  120  LLFFNAQKSGKLHKNNGIPWRGDSGLQDGNGTDFSK-AGLVGGYYDA  165



>ref|XP_006353239.1| PREDICTED: endoglucanase 12-like [Solanum tuberosum]
Length=634

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 116/176 (66%), Gaps = 21/176 (12%)
 Frame = +2

Query  149  WGGPLEIH---ANDSATDDD-RSRNLQDLDRAAL---------------SRSLDETQQSW  271
            WGG LEI      +S TDDD RSRN  DLDRA++               SR+LDETQQSW
Sbjct  6    WGGALEIATTTGGESTTDDDNRSRNF-DLDRASVNQLQRYDNYDRSTQSSRNLDETQQSW  64

Query  272  LLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppd  451
            LLGP E+KKK+YVDLGCII SRK  K+T+  ++ A  ++ L  ++VK  P+H      PD
Sbjct  65   LLGPPEKKKKKYVDLGCIICSRKALKYTLIGIIVAFAVIALPTIVVKVWPKHKSQPSLPD  124

Query  452  nYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NYT ALHK LMFF+AQ+SGKLPK N + WRG+S ++DG S    +   LVGGYYDA
Sbjct  125  NYTFALHKVLMFFDAQKSGKLPKTNGIPWRGDSGLQDG-SKLTDVKGGLVGGYYDA  179



>ref|XP_008801082.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=618

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 120/166 (72%), Gaps = 6/166 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSR-SLDETQQSWLLGPTE--QKKK  301
            M+  + WGG  EIH  D ATDD+ SR+L DLDR ALSR  LDETQQSWLL P +  QKK 
Sbjct  1    MHSGNQWGGAFEIHV-DPATDDEHSRSL-DLDRGALSRHQLDETQQSWLLEPQDGSQKKD  58

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGC++  RKV  W + S L A V+VG+ ++IVK++P+H    PPPD Y +AL KAL
Sbjct  59   KYVDLGCVVCKRKVLWWVIWSALIAFVVVGIPIIIVKSLPKHKEKAPPPDRYAMALQKAL  118

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +FFNAQ+SG+LPK+N + WRG+S ++DG  D   I   LVGGYYDA
Sbjct  119  LFFNAQKSGRLPKNNGIPWRGDSGLKDG-FDQPDIKGGLVGGYYDA  163



>ref|XP_011077092.1| PREDICTED: endoglucanase 12 [Sesamum indicum]
Length=620

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 126/163 (77%), Gaps = 8/163 (5%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALSR-----SLDETQQSWLLGPTEQKKKR-YV  310
            WGG LEI+  DS T+D++SRN+ D DRA++S      +LDETQQSWLLGP+++KKK+ YV
Sbjct  5    WGGTLEINGADSTTEDEKSRNM-DWDRASISHQGYHHTLDETQQSWLLGPSDKKKKKKYV  63

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+ SR   KWT+GS+L A  ++GL ++I K++P+H    PPPDNYT+ALHKAL+FF
Sbjct  64   DLGCIVCSRTALKWTLGSILVAFFVIGLPIIIAKSIPKHKPRPPPPDNYTVALHKALLFF  123

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLPK+N + WRG+S ++DG  +   +   LVGGYYDA
Sbjct  124  NAQKSGKLPKNNGIPWRGDSGLQDGL-NQTDLKGGLVGGYYDA  165



>ref|XP_004976099.1| PREDICTED: endoglucanase 12-like [Setaria italica]
Length=629

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 115/169 (68%), Gaps = 9/169 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS------LDETQQSWLLGPTEQ  292
            MY  + WGG  EI A D A++DD SRN+ DLD  AL  +      LDETQQ WLLGP  +
Sbjct  1    MYSANHWGGSFEI-ATDGASEDDDSRNM-DLDPGALQSARQLRHELDETQQGWLLGPPAK  58

Query  293  KKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALH  472
            KK R+VDLGC++V RKV  W    ++A  VLVGL V+I K++PR     PPPD Y  ALH
Sbjct  59   KKNRHVDLGCVVVKRKVLWWAFWGLVAGFVLVGLPVIISKSIPRKTPRPPPPDQYAEALH  118

Query  473  KALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            KAL+FFNAQ+SG+LP+ N + WRGNS ++DG SD   +   LVGGYYDA
Sbjct  119  KALLFFNAQKSGRLPRSNGIPWRGNSGLKDG-SDAKDVKGGLVGGYYDA  166



>gb|AGG19084.1| cellulase [Hordeum vulgare subsp. vulgare]
Length=619

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 118/166 (71%), Gaps = 9/166 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS--LDETQQSWLLGPTEQKKK-  301
            M+ ++ WGG  +I       +DD+SRN+ D+DR AL     LDETQQSWLLGP E KKK 
Sbjct  1    MHSQNHWGGTFDI----DGAEDDQSRNM-DIDRGALQHQHQLDETQQSWLLGPPEAKKKD  55

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            RYVDLGC++V RK+  W + +VL A VL+G+ ++I K +P+     PPPD YT ALHKAL
Sbjct  56   RYVDLGCVVVKRKLLWWMLWAVLGAFVLIGVPIIIAKNIPKKKHHAPPPDKYTDALHKAL  115

Query  482  MFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +FFNAQ+SGKLPK+N + WRGNS M+DG +D   +   LVGGYYDA
Sbjct  116  LFFNAQKSGKLPKNNGIPWRGNSGMKDG-ADLPDVKGGLVGGYYDA  160



>ref|XP_010065082.1| PREDICTED: endoglucanase 12 [Eucalyptus grandis]
 gb|KCW87984.1| hypothetical protein EUGRSUZ_A00393 [Eucalyptus grandis]
Length=629

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 117/171 (68%), Gaps = 12/171 (7%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDS--ATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQ  292
            M+ R+ WGG  EI+  DS  A DD RSR   + DRAAL       LDETQQSWLLG   Q
Sbjct  1    MHARNHWGGSFEINGGDSSAAEDDQRSR---EWDRAALQPQQHHELDETQQSWLLGNHNQ  57

Query  293  K--KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
            +  K +YVDLGC++ SRK  KWT  + +AA  L+ L V+IVKTVPRH    PPPDNYT+A
Sbjct  58   RPQKNKYVDLGCVVCSRKALKWTGWAFVAAFFLIALPVIIVKTVPRHKARPPPPDNYTVA  117

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKAL+FFNAQ+SGKLPK+N + WRGNS + DG      +   LVGGYYDA
Sbjct  118  LHKALLFFNAQKSGKLPKNNPIPWRGNSGLTDGNG-TTDVKGGLVGGYYDA  167



>ref|XP_010929679.1| PREDICTED: endoglucanase 12-like [Elaeis guineensis]
Length=619

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSR-SLDETQQSWLLGPTE---QKK  298
            MY  + WGGP EIH +   ++D++SRN+ DLDRAAL R  LDET+Q WLL P +   +KK
Sbjct  1    MYSTNHWGGPFEIHVDPMLSEDEQSRNM-DLDRAALQRQELDETEQGWLLRPQDTEMKKK  59

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K+YVDLGCI+  R++ KW + SVL   ++VG+ V++ KT+P+H  P  PPDNY +ALH A
Sbjct  60   KKYVDLGCILCKREMLKWLILSVLIGFIVVGIPVIVAKTLPKHREPVSPPDNYAVALHMA  119

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L FF+AQ+SG+LPK+N+V WRGNS + DG    A +   LVGGYYD+
Sbjct  120  LKFFDAQKSGRLPKNNDVPWRGNSGLEDGIG-LADLKGGLVGGYYDS  165



>ref|XP_003580066.1| PREDICTED: endoglucanase 12 [Brachypodium distachyon]
Length=622

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 118/168 (70%), Gaps = 10/168 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS----LDETQQSWLLGPTEQKK  298
            M+ ++ WGG  EI       +DD SRN+ D+DR AL       LDETQQSWLLGP E KK
Sbjct  1    MHSQNHWGGSFEI---ADGAEDDHSRNM-DIDRGALQHQQHHQLDETQQSWLLGPPEAKK  56

Query  299  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K +YVDLGC++V RK+  W + +VL A VL+GL ++I K++P+     PPPD YT ALHK
Sbjct  57   KDKYVDLGCVVVKRKLLWWILWAVLGAFVLIGLPIIIAKSIPKKKPHAPPPDKYTDALHK  116

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SGKLPK+N + WRGNS ++DG SD   +   LVGGYYDA
Sbjct  117  ALLFFNAQKSGKLPKNNGIPWRGNSGLKDG-SDLTDVKGGLVGGYYDA  163



>gb|AEO97186.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97213.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=621

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 116/168 (69%), Gaps = 7/168 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  295
            M+  + WGG  EI+  A +S TDD++SRN++  D+AAL      LDETQQSWLL   E K
Sbjct  1    MHSANHWGGSFEIYNGAAESTTDDEKSRNME-WDKAALQPQRHHLDETQQSWLLYRQETK  59

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD GCI  S +  KWT+ + + A +++ L  ++ KT+P+H     PPDNYTLALHK
Sbjct  60   KKKYVDFGCIACSHRALKWTLYAFVFAVLVILLPTVLAKTLPKHRSKPSPPDNYTLALHK  119

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SGKLPK+N + WR +S ++DG   D +    LVGGYYDA
Sbjct  120  ALLFFNAQKSGKLPKNNGIPWREDSGLQDGNGSDFSKL-GLVGGYYDA  166



>ref|XP_004503186.1| PREDICTED: endoglucanase 25-like [Cicer arietinum]
Length=212

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 1/114 (1%)
 Frame = +2

Query  161  LEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCIIVSRK  340
            +EI+A DSATD+ RS NLQ+LDRAALSR LDETQQSWLLGP EQKKK YVDLGCIIVSRK
Sbjct  78   VEINATDSATDEVRSWNLQELDRAALSRPLDETQQSWLLGPIEQKKK-YVDLGCIIVSRK  136

Query  341  VFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQR  502
            +F WTVG ++ AA + G + LIVKTVPRHH  +PP DNYTLALHKALMFFNAQ+
Sbjct  137  IFVWTVGMIVFAAFVDGFVTLIVKTVPRHHHKHPPHDNYTLALHKALMFFNAQK  190



>ref|XP_002961082.1| hypothetical protein SELMODRAFT_75214 [Selaginella moellendorffii]
 gb|EFJ38621.1| hypothetical protein SELMODRAFT_75214 [Selaginella moellendorffii]
Length=613

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 120/163 (74%), Gaps = 8/163 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MY  + WGGPLE+  + S  ++D+S    DLDRAAL + L+ETQQSWLLG  E+K+K+ +
Sbjct  1    MY-HNSWGGPLEL--DPSVNEEDQSNRSMDLDRAALQK-LEETQQSWLLGAGEKKRKKTI  56

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+ S+K+F   V ++LA   + G  VLIVKT PRHHR   PPDNYTLALHKAL FF
Sbjct  57   DLGCIVCSQKLFLGIVYAILAVGFIAGFTVLIVKTAPRHHRHPSPPDNYTLALHKALKFF  116

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP  NN+S+RG+S ++DG  + A    DLVGGYYDA
Sbjct  117  NAQKSGKLPHGNNISYRGDSGLKDGSDNQA----DLVGGYYDA  155



>gb|AFZ78628.1| korrigan [Populus tomentosa]
Length=691

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 116/168 (69%), Gaps = 7/168 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  295
            M+  + WGG  EI+  A +S TDD++SRN++  D+AAL      LDETQQSWLL   E K
Sbjct  1    MHSANHWGGSFEIYNGAAESTTDDEKSRNME-WDKAALQPQRHHLDETQQSWLLYRQETK  59

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD GCI  S +  KWT+ + + A +++ L  ++ KT+P+H     PPDNYTLALHK
Sbjct  60   KKKYVDFGCIACSHRALKWTLYAFVFAVLVILLPTVLAKTLPKHRSKPSPPDNYTLALHK  119

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SGKLPK+N + WR +S ++DG   D +    LVGGYYDA
Sbjct  120  ALLFFNAQKSGKLPKNNGIPWREDSGLQDGNGSDFSKL-GLVGGYYDA  166



>gb|AFZ78629.1| korrigan [Populus tomentosa]
Length=621

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 118/168 (70%), Gaps = 7/168 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  295
            M+  + WGG LEI+  + +S TDD++SRN++  D+AAL      LDETQQSWLL P E K
Sbjct  1    MHSANHWGGSLEIYNGSAESTTDDEKSRNME-WDKAALQPQHHHLDETQQSWLLYPQETK  59

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD+GC+  S K  KWT+ + + A +++ L  ++ +T+P+H     PPDNYT+AL K
Sbjct  60   KKKYVDMGCVACSHKALKWTLYAFVFALLVIALPTILAETLPKHKSKPTPPDNYTIALQK  119

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SGKL K+N + WRG+S ++DG   D +    LVGGYYDA
Sbjct  120  ALLFFNAQKSGKLHKNNGIPWRGDSGLQDGNGTDFSK-AGLVGGYYDA  166



>ref|XP_002966925.1| hypothetical protein SELMODRAFT_408186 [Selaginella moellendorffii]
 gb|EFJ31524.1| hypothetical protein SELMODRAFT_408186 [Selaginella moellendorffii]
Length=613

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 121/163 (74%), Gaps = 8/163 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYV  310
            MY  + WGGPLE+  + S  ++D+S    DLDRAAL + L+ETQQSWLLG  E+K+K+ +
Sbjct  1    MY-HNSWGGPLEL--DPSVNEEDQSNRSMDLDRAALQK-LEETQQSWLLGAGEKKRKKTI  56

Query  311  DLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFF  490
            DLGCI+ S+K+F   V ++LA   + G  VLIVKT PRHHR + PPDNYT+ALHKAL FF
Sbjct  57   DLGCIVCSQKLFLGIVYAILAVGFIAGFTVLIVKTAPRHHRHSSPPDNYTIALHKALKFF  116

Query  491  NAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            NAQ+SGKLP  NN+S+RG+S ++DG  + A    DLVGGYYDA
Sbjct  117  NAQKSGKLPHGNNISYRGDSGLKDGSDNQA----DLVGGYYDA  155



>ref|XP_002312211.1| endo-1 family protein [Populus trichocarpa]
 gb|EEE89578.1| endo-1 family protein [Populus trichocarpa]
 gb|AEO97187.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97214.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=620

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 121/167 (72%), Gaps = 6/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH-ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKK  298
            M+  + WGG LEI+   +S TDD++SRN++  D+AAL      LDETQQSWLL P E KK
Sbjct  1    MHSANHWGGSLEIYNGAESTTDDEKSRNME-WDKAALQPQHHHLDETQQSWLLYPQETKK  59

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
            K++VDLGC+  S K  KWT+ + + A +++ L +++VKT+P+H+   PPPDNYTLAL KA
Sbjct  60   KKHVDLGCVACSHKALKWTLYAFVFALLVIALPIILVKTLPKHNSKPPPPDNYTLALRKA  119

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L+FFNAQ+SGKL K+N + WRG+S ++DG   D +    LVGGYYDA
Sbjct  120  LLFFNAQKSGKLHKNNGIPWRGDSGLQDGNGTDFSK-AGLVGGYYDA  165



>ref|XP_011014603.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014609.1| PREDICTED: endoglucanase 12-like isoform X1 [Populus euphratica]
 ref|XP_011014618.1| PREDICTED: endoglucanase 12-like isoform X2 [Populus euphratica]
Length=621

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIH--ANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQK  295
            M+  + WGG  EI+  A +S TD ++SRN++  D+AAL      LDETQQSWLL   E K
Sbjct  1    MHSANHWGGSFEIYNGAAESTTDYEKSRNMER-DKAALHPQRHHLDETQQSWLLYRQETK  59

Query  296  KKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            KK+YVD GCI  S +  KWT+ + + A +++ L  ++ KT+P+H     PPDNYTLALHK
Sbjct  60   KKKYVDFGCIACSHRALKWTLYAFVFAVLVILLPTVLAKTLPKHRSKPSPPDNYTLALHK  119

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SGKLPK+N + WR +S ++DG   D +    LVGGYYDA
Sbjct  120  ALLFFNAQKSGKLPKNNGIPWREDSGLQDGNGSDFSKL-GLVGGYYDA  166



>ref|XP_002446733.1| hypothetical protein SORBIDRAFT_06g021440 [Sorghum bicolor]
 gb|EES11061.1| hypothetical protein SORBIDRAFT_06g021440 [Sorghum bicolor]
Length=630

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 116/168 (69%), Gaps = 8/168 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  298
            MY  + WGG  +I   D A+++D SRN  D+D  ALS      LDETQQ WLLGP E KK
Sbjct  1    MYSANHWGGSFDI-TTDGASEEDDSRN-TDVDGGALSARQHHELDETQQGWLLGPPEAKK  58

Query  299  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            K R+VDLGC++V RKV  W    ++A  VLVGL +++ K++PR   P PPPD Y  ALHK
Sbjct  59   KGRHVDLGCVLVKRKVLWWAFWGLVAGFVLVGLPIIVYKSIPRRAPPPPPPDQYAEALHK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SG++PK+N + WRGNS ++DG SD   +   LVGGYYDA
Sbjct  119  ALLFFNAQKSGRIPKNNGIPWRGNSGLKDG-SDAKDVKGGLVGGYYDA  165



>ref|XP_007028162.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
 gb|EOY08664.1| Six-hairpin glycosidases superfamily protein [Theobroma cacao]
Length=619

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 124/169 (73%), Gaps = 12/169 (7%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-----RSLDETQQSWLLGPTEQK  295
            M+ R+ WGG  +++  +    +++S N  + DRAAL      RSLDETQQ WLLGP + K
Sbjct  1    MHARNHWGGSFDVNHGE----EEKSWN-TEWDRAALQSQQQDRSLDETQQGWLLGPPQTK  55

Query  296  KK-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALH  472
            KK +YVDLGCI+ SRK FKWT+ S+L+A +++ + ++I K++P+H R  PPPDNYT+AL 
Sbjct  56   KKDKYVDLGCIVCSRKAFKWTLISILSAFIVIAVPIIIAKSLPKHTRRPPPPDNYTVALR  115

Query  473  KALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            KAL+FFNAQ+SG LPK+N +SWRGNS + DGK ++  +   LVGGYYDA
Sbjct  116  KALLFFNAQKSGNLPKNNGISWRGNSGLNDGK-EEMDLKGWLVGGYYDA  163



>ref|XP_006468640.1| PREDICTED: endoglucanase 12-like [Citrus sinensis]
Length=637

 Score =   134 bits (337),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 117/183 (64%), Gaps = 21/183 (11%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDD---------------DRSRNLQDLDRAALS----RSLD  253
            M+G + WGG LEI  ++S  +                  S +  D DRAAL       LD
Sbjct  1    MHGGNHWGGSLEIVNSNSIAEGFADSNNNRSNNNNNNHSSSSTDDWDRAALHSQRFHHLD  60

Query  254  ETQQSWLLGPTE-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhh  430
            ETQQSWLLGP E  KK RYVDLGCI+VSRK  KWTV S L A +++GL V+I K++P+H 
Sbjct  61   ETQQSWLLGPKETNKKNRYVDLGCIVVSRKALKWTVASFLIAFLVIGLPVIIAKSLPKHK  120

Query  431  rpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGY  610
               P PD+YT ALHKAL+FFNAQ+SGKLPK+N + WRGNS + DG S    +   LVGGY
Sbjct  121  SAPPSPDDYTHALHKALLFFNAQKSGKLPKNNGIPWRGNSGLSDGNS-TTDVKGGLVGGY  179

Query  611  YDA  619
            YDA
Sbjct  180  YDA  182



>ref|XP_010673846.1| PREDICTED: endoglucanase 12-like [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 116/179 (65%), Gaps = 17/179 (9%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAAL-------------SRSLDETQQSW  271
            M+  + WGG  E+   +   +D+RSR +++ DRA+L             S  LD  QQSW
Sbjct  1    MHNPNLWGGNYEVQIINKDVEDERSREMENWDRASLLYQEQLHQNGHNNSHELDHVQQSW  60

Query  272  LLGPTEQKKKR---YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnp  442
            LL P E +K R   YVDLGCI+V +K  KW   S L A +L+ + ++I K++P+H    P
Sbjct  61   LLAPQESRKNRKNMYVDLGCIVVKKKFLKWVFWSFLIAFILIAMPIIIAKSLPKHKHGPP  120

Query  443  ppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            PPDNYTLALHKAL+FFNAQ+SGKLPK N ++WRGNS ++DG S  + +   LVGGYYD+
Sbjct  121  PPDNYTLALHKALLFFNAQKSGKLPKKNGIAWRGNSGLKDG-SKLSDVKGGLVGGYYDS  178



>gb|EAY94707.1| hypothetical protein OsI_16485 [Oryza sativa Indica Group]
 gb|EAZ31232.1| hypothetical protein OsJ_15332 [Oryza sativa Japonica Group]
Length=641

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 121/185 (65%), Gaps = 25/185 (14%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTEQKKK  301
            MY  + WGG  EI A D A +DD SRN+ DLDR ALS     LDETQQSWLLGP E KKK
Sbjct  1    MYSANHWGGSFEIAA-DGAAEDDHSRNM-DLDRGALSARQHQLDETQQSWLLGPPEAKKK  58

Query  302  -RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
             +YVDLGC++V RK+  W + ++LAA +L+GL V+I K++P+     PPPD YT ALHKA
Sbjct  59   DKYVDLGCVVVKRKLLWWVLWTLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKA  118

Query  479  LMFFNAQRS------------------GKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVG  604
            L+FFNAQ+S                  G+LPK+N + WRGNS + DG SD   +   LVG
Sbjct  119  LLFFNAQKSLLSLTNNFGHVSFSALTAGRLPKNNGIKWRGNSGLSDG-SDLTDVKGGLVG  177

Query  605  GYYDA  619
            GYYDA
Sbjct  178  GYYDA  182



>ref|XP_006448516.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
 gb|ESR61756.1| hypothetical protein CICLE_v10014583mg [Citrus clementina]
Length=637

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 116/183 (63%), Gaps = 21/183 (11%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDD---------------DRSRNLQDLDRAALS----RSLD  253
            M+G + WGG LEI  ++S  +                  S +  D DRAAL       LD
Sbjct  1    MHGGNHWGGSLEIVNSNSIAEGFADSNHNRSNNNNNNHSSSSTDDWDRAALHSQRFHHLD  60

Query  254  ETQQSWLLGPTE-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhh  430
            ETQQSWLLGP E  KK RYVDLGCI+VS K  KWTV S L A +++GL V+I K++P+H 
Sbjct  61   ETQQSWLLGPKETNKKNRYVDLGCIVVSHKALKWTVASFLIAFLVIGLPVIIAKSLPKHK  120

Query  431  rpnpppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGY  610
               P PD+YT ALHKAL+FFNAQ+SGKLPK+N + WRGNS + DG S    +   LVGGY
Sbjct  121  SAPPSPDDYTHALHKALLFFNAQKSGKLPKNNGIPWRGNSGLSDGNS-TTDVKGGLVGGY  179

Query  611  YDA  619
            YDA
Sbjct  180  YDA  182



>gb|EMT15171.1| Endoglucanase 12 [Aegilops tauschii]
Length=619

 Score =   131 bits (330),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 118/165 (72%), Gaps = 5/165 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS-RSLDETQQSWLLGPTEQKKK-R  304
            M+ ++ WGG  EI  + S  +D+ SRN+ D+D  AL  R LDETQ+SWLLGP E KKK +
Sbjct  1    MHSQNHWGGSFEI-TDPSEVEDNHSRNM-DIDPGALQQRQLDETQKSWLLGPPETKKKDK  58

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            Y+DLGC++V RK+    +G+VL A +L+GL ++I K++P+     P PD YT ALHKAL+
Sbjct  59   YIDLGCVLVKRKLLWSMLGAVLGAFLLIGLPIIIAKSIPKKPSRAPAPDKYTQALHKALL  118

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FF+AQ+SGKLPK N + WRGNS ++DG SD   +   LVGGYYDA
Sbjct  119  FFDAQKSGKLPKKNGIPWRGNSGLKDG-SDLRDVKGGLVGGYYDA  162



>ref|XP_004250089.1| PREDICTED: endoglucanase 12 [Solanum lycopersicum]
Length=635

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 115/177 (65%), Gaps = 22/177 (12%)
 Frame = +2

Query  149  WGGPLEIHANDSAT-----DDDRSRNLQDLDRAAL---------------SRSLDETQQS  268
            WGG LEI    +       DD+RSRN  DLDRA++               SR+LDETQQS
Sbjct  6    WGGALEIATTTTGGESTTDDDNRSRNF-DLDRASVNQLQRYDIYDRSTQSSRNLDETQQS  64

Query  269  WLLGPTEQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnppp  448
            WLLGP  +KKK+YVDLGC+I SRK  K+T+  ++ A  ++ L  ++VK  P+H    P P
Sbjct  65   WLLGPPVKKKKKYVDLGCVICSRKALKYTLIGIIVAFAVIALPTIVVKVWPKHKSQPPLP  124

Query  449  dnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            DNYT ALHKALMFF+AQ+SGKLPK N + WRG+S ++DG S    +   LVGGYYDA
Sbjct  125  DNYTFALHKALMFFDAQKSGKLPKSNRIPWRGDSGLQDG-SKLTDVKGGLVGGYYDA  180



>ref|NP_176738.1| glycosyl hydrolase 9A2 [Arabidopsis thaliana]
 sp|O04478.1|GUN7_ARATH RecName: Full=Endoglucanase 7; AltName: Full=Endo-1,4-beta glucanase 
7 [Arabidopsis thaliana]
 gb|AAB60922.1| F5I14.14 [Arabidopsis thaliana]
 dbj|BAF01264.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34400.1| glycosyl hydrolase 9A2 [Arabidopsis thaliana]
Length=623

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 117/171 (68%), Gaps = 11/171 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALSR---SLDETQQSWLLGPTE--  289
            M+  + WGG L+   +D  +A +++R RN  + DR A+      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRIAAEEEERLRNTTEWDRGAIHSQRSELDETQQGWLLAPQDNW  60

Query  290  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
             +KKK+YV+LGC+ VSR VF WTVGS+    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSRTVFLWTVGSIAVLFLVVALPIIIVKSLPRHKSAPPPPDNYTLA  120

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKAL FF+AQ+SGKLPK N VSWRG+S  +DG  D   +   LVGGYYD 
Sbjct  121  LHKALQFFDAQKSGKLPKKNKVSWRGDSGTKDGLPD---VVGGLVGGYYDG  168



>ref|XP_010415102.1| PREDICTED: endoglucanase 7-like [Camelina sativa]
Length=623

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 118/170 (69%), Gaps = 11/170 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTE--  289
            M+  + WGG L+   +D  +A +++R RN+ D DR A+      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRAAADEEERRRNMTDWDRGAIHSQRHELDETQQGWLLAPQDSW  60

Query  290  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
             +KKK+YV+LGC+ VSR V  WTVG++    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSRTVCMWTVGAIAVLFIVVALPIIIVKSLPRHKSIPPPPDNYTLA  120

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYD  616
            LHKA+ FF+AQ+SGKLPK N VSWRG+S ++DG  D   +   LVGGYYD
Sbjct  121  LHKAIKFFDAQKSGKLPKKNKVSWRGDSGLKDGLPD---VVGGLVGGYYD  167



>ref|XP_010528623.1| PREDICTED: endoglucanase 7 [Tarenaya hassleriana]
Length=632

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 120/180 (67%), Gaps = 20/180 (11%)
 Frame = +2

Query  131  MYGRDPWGGPLEI----HANDSATDDDRSRNLQDLDRAAL---------SRSLDETQQSW  271
            M+  + WGG L+      A  +A ++ R R   + DR A+          R LDETQQSW
Sbjct  1    MHPGNLWGGTLDAADGDRAATAAEEELRLREAAEWDRGAIHSQRLMGESQRYLDETQQSW  60

Query  272  LLGPTE----QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpn  439
            LL P E    +KKK++V+LGC+ VSRK F WTVGS+  A V+VGL +++ K++PRH    
Sbjct  61   LLSPQETLRNKKKKKHVNLGCVSVSRKAFLWTVGSIAVAFVVVGLPIIVAKSLPRHKSAP  120

Query  440  pppdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            PPPDNYTLALHKAL+FFNAQ+SGKLPK+N +SWRG+S + DG ++ A     LVGGYYD 
Sbjct  121  PPPDNYTLALHKALLFFNAQKSGKLPKNNGISWRGDSGLNDGSAEVA---GGLVGGYYDG  177



>ref|NP_001288520.1| uncharacterized protein LOC103641803 [Zea mays]
 gb|AFW58720.1| hypothetical protein ZEAMMB73_822588 [Zea mays]
 gb|AGG19093.1| cellulase [Zea mays]
Length=626

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 111/168 (66%), Gaps = 8/168 (5%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS----RSLDETQQSWLLGPTEQKK  298
            M+  + WGG  +I   D A++DD  RN  D+D  ALS      LDETQQ WLL P   KK
Sbjct  1    MHSVNHWGGSFDI-TTDVASEDDDCRN-TDVDAGALSARQHHELDETQQGWLLSPEGAKK  58

Query  299  K-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHK  475
            + R+VDLGC++V RKV +W    ++A  VLVGL V + K++P      PPPD Y  ALHK
Sbjct  59   RSRHVDLGCVVVKRKVLRWAFWGLVAGFVLVGLPVTVYKSIPHRPPRPPPPDRYAEALHK  118

Query  476  ALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL+FFNAQ+SG++P++N + WRG+S ++DG SD   +   LVGGYYDA
Sbjct  119  ALLFFNAQKSGRIPRNNGIPWRGDSGLKDG-SDAKDVKGGLVGGYYDA  165



>ref|XP_008791029.1| PREDICTED: endoglucanase 12-like [Phoenix dactylifera]
Length=616

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 115/165 (70%), Gaps = 5/165 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSR-SLDETQQSWLLGPTE-QKKKR  304
            MY  + WGGP EI   DS+T+D++SR + DLDRA L R  LD T+Q WLL P + +KK +
Sbjct  1    MYSANHWGGPFEIQV-DSSTEDEQSRYV-DLDRAVLQRQELDTTEQGWLLRPRDAEKKSK  58

Query  305  YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALM  484
            YVDLGCI+   +  +W + S L   V+VG+ +++ KT+P+H  P  PPDNYT+ALH AL 
Sbjct  59   YVDLGCILCKWETLRWVIWSALIGFVVVGIPIIVAKTLPKHREPISPPDNYTVALHMALK  118

Query  485  FFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FF+AQ+SG+LPK+N+V WRGNS + DG      +   LVGGYYD+
Sbjct  119  FFDAQKSGRLPKNNDVLWRGNSGLEDGIG-FTELKGGLVGGYYDS  162



>ref|XP_010533225.1| PREDICTED: endoglucanase 25-like [Tarenaya hassleriana]
Length=623

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 111/177 (63%), Gaps = 35/177 (20%)
 Frame = +2

Query  161  LEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCIIVSRK  340
            + I A DS+T DDRS NLQDLD AA         +S LLGP+E+KKK Y+DL     SRK
Sbjct  1    MSIDAADSSTGDDRSWNLQDLDHAA------AVSRSSLLGPSERKKK-YIDL----ASRK  49

Query  341  VFKWTvgsvlaaavlvglivlivKTVprhhr------------------------pnppp  448
            +  WTVG++LAA  L G I L VK VPRH+                           PP 
Sbjct  50   IVLWTVGTILAAGFLAGFITLNVKNVPRHNHKHWPQDSYPIALHKALETASRHRDQTPPR  109

Query  449  dnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +NYT ALHKALMFFNAQRSG+LPKHNNV WRG+SC++DGK    + +KDLVGGYYDA
Sbjct  110  NNYTAALHKALMFFNAQRSGELPKHNNVPWRGDSCLQDGKGTSGSFYKDLVGGYYDA  166



>ref|XP_001772986.1| predicted protein [Physcomitrella patens]
 gb|EDQ62211.1| predicted protein [Physcomitrella patens]
Length=610

 Score =   125 bits (314),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  328
            WGGP+E+  +  A DD RSRNL D+DRA++ +SL+ETQQSWLL P  +KKK+ +DLGC++
Sbjct  5    WGGPMEMATDSGAEDDTRSRNL-DVDRASV-KSLEETQQSWLLEPKTKKKKKEIDLGCMV  62

Query  329  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  508
             SRK+F    G++ AA+ +VGL +LI K  PR H   PP DNYT+AL  AL FF+AQ+SG
Sbjct  63   CSRKLFLIIFGTIFAASAIVGLSILIWKVAPRKHHRPPPLDNYTVALKLALKFFDAQKSG  122

Query  509  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +LPK NN+SWRG S +RDG+        +L GG+YDA
Sbjct  123  RLPKTNNISWRGTSALRDGRDAVGGNPTNLSGGFYDA  159



>ref|XP_003601506.1| Endoglucanase [Medicago truncatula]
 gb|AES71757.1| endo-1,4-beta-glucanase [Medicago truncatula]
Length=624

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 109/171 (64%), Gaps = 10/171 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHAN-DSATDDDRSRNLQDLDRAAL------SRSLDETQQSWLLG-PT  286
            M+ R+ WGG  E+ +N +  + D+ SR     D+AAL         LDET QSW+L  P 
Sbjct  1    MHSRNQWGGSFELSSNSEVPSGDETSRTGDQWDKAALLDHGNRREGLDETLQSWILERPN  60

Query  287  EQKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
             +KK +YVD GCI++S K  KW  G +      +GL ++I K +P+HH    PPDNYTLA
Sbjct  61   MKKKTKYVDFGCIVLSHKALKWIFGIIFVGFCAIGLPIIIAKALPKHHPSPIPPDNYTLA  120

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKAL FFNAQ+SG+LPK N +SWR NS ++DGK  D    K LVGGYYDA
Sbjct  121  LHKALRFFNAQKSGRLPKSNGISWRRNSGLQDGKDTDDK--KGLVGGYYDA  169



>ref|XP_010496067.1| PREDICTED: endoglucanase 7 [Camelina sativa]
Length=623

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 119/171 (70%), Gaps = 11/171 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALS---RSLDETQQSWLLGPTE--  289
            M+  + WGG L+   +D  +A +++R+RN+ D D+ ++      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRAAADEEERTRNMTDWDKGSIHSQRHELDETQQGWLLAPQDSW  60

Query  290  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
             +KKK+YV+LGC+ VSR V  WTVG++    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSRTVCMWTVGAIAVLFIVVALPIIIVKSLPRHKSIPPPPDNYTLA  120

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKA+ FF+AQ+SGKLPK + VSWRG+S ++DG  D   +   LVGGYYD 
Sbjct  121  LHKAIKFFDAQKSGKLPKKDKVSWRGDSGLKDGLPD---VVGGLVGGYYDG  168



>ref|XP_004152840.1| PREDICTED: endoglucanase 7-like [Cucumis sativus]
 gb|KGN61236.1| hypothetical protein Csa_2G072990 [Cucumis sativus]
Length=627

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 117/172 (68%), Gaps = 11/172 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSA--TDDDRSRNLQDLDRAALS------RSLDETQQSWLLGPT  286
            M G + WGGPLE+  N+     D DR    +D DRAAL         LDETQ+SWLLGP 
Sbjct  1    MQGGNHWGGPLEVIDNNGGGGEDHDRRTAAEDWDRAALQSQTFNQNELDETQRSWLLGPP  60

Query  287  E-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  463
            + +KKK+YVDLGC++VSRK  KW++ S+L A  ++GL +++ KT PRHH P  PPD Y+ 
Sbjct  61   DGKKKKKYVDLGCVMVSRKALKWSLISILIAFCVIGLPIIVAKTWPRHHPPPLPPDRYSE  120

Query  464  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL KAL+FFNAQ+SG+L K NN++WRGNS + DG    A     LVGGYYD+
Sbjct  121  ALRKALLFFNAQKSGRLGKSNNITWRGNSGLNDGNETLAK--GGLVGGYYDS  170



>ref|XP_004169320.1| PREDICTED: endoglucanase 7-like [Cucumis sativus]
Length=627

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 117/172 (68%), Gaps = 11/172 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSA--TDDDRSRNLQDLDRAALS------RSLDETQQSWLLGPT  286
            M G + WGGPLE+  N+     D DR    +D DRAAL         LDETQ+SWLLGP 
Sbjct  1    MQGGNHWGGPLEVIDNNGGGGEDHDRRTAAEDWDRAALQSQTFNQNELDETQRSWLLGPP  60

Query  287  E-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  463
            + +KKK+YVDLGC++VSRK  KW++ S+L A  ++GL +++ KT PRHH P  PPD Y+ 
Sbjct  61   DGKKKKKYVDLGCVMVSRKALKWSLISILIAFCVIGLPIIVAKTWPRHHPPPLPPDRYSE  120

Query  464  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            AL KAL+FFNAQ+SG+L K NN++WRGNS + DG    A     LVGGYYD+
Sbjct  121  ALRKALLFFNAQKSGRLGKSNNITWRGNSGLNDGNETLAK--GGLVGGYYDS  170



>gb|KHN09941.1| Endoglucanase 7 [Glycine soja]
Length=630

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 117/173 (68%), Gaps = 11/173 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNL--QDLDRAAL-------SRSLDETQQSWLLGP  283
            M+ R+ WGG  E+ ++        + N   ++ DRAAL       S+ LDET QSW+LG 
Sbjct  1    MHSRNNWGGSFEMSSSGEEVSGYEANNNHNKEWDRAALLERYHPQSQDLDETLQSWVLGR  60

Query  284  TEQKKK-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYT  460
             E+ KK +YVD GCI++S K  KW  GS+  A +++GL ++IVK++P+HH P  PPDNYT
Sbjct  61   GEKSKKTKYVDFGCIMISHKALKWLFGSIFLAFIVIGLPIIIVKSLPKHHSPPTPPDNYT  120

Query  461  LALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LALHKAL+FFNAQ+SG+LPK N + WRGNS + DG +D   +   LVGGYYDA
Sbjct  121  LALHKALLFFNAQKSGRLPKSNGIPWRGNSGLNDG-NDTTDVKGGLVGGYYDA  172



>ref|XP_003556773.1| PREDICTED: endoglucanase 12-like [Glycine max]
Length=630

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 117/173 (68%), Gaps = 11/173 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNL--QDLDRAAL-------SRSLDETQQSWLLGP  283
            M+ R+ WGG  E+ ++        + N   ++ DRAAL       S+ LDET QSW+LG 
Sbjct  1    MHSRNNWGGSFEMSSSGEEVSGYEANNNHNKEWDRAALLERYHPQSQDLDETLQSWVLGR  60

Query  284  TEQKKK-RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYT  460
             E+ KK +YVD GCI++S K  KW  GS+  A +++GL ++IVK++P+HH P  PPDNYT
Sbjct  61   GEKSKKTKYVDFGCIMISHKALKWLFGSIFLAFIVIGLPIIIVKSLPKHHSPPTPPDNYT  120

Query  461  LALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LALHKAL+FFNAQ+SG+LPK N + WRGNS + DG +D   +   LVGGYYDA
Sbjct  121  LALHKALLFFNAQKSGRLPKSNGIPWRGNSGLNDG-NDTTDVKGGLVGGYYDA  172



>ref|XP_008441913.1| PREDICTED: endoglucanase 7 [Cucumis melo]
Length=628

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 117/173 (68%), Gaps = 12/173 (7%)
 Frame = +2

Query  131  MYGRDPWGGPLEI---HANDSATDDDRSRNLQDLDRAAL------SRSLDETQQSWLLGP  283
            M G + WGGPLE+   +      D D+ R  +D DRAAL         LDETQ+SWLLGP
Sbjct  1    MQGGNHWGGPLEVIDDNNGGGGKDHDQRRAAEDWDRAALRSQSFNQNELDETQRSWLLGP  60

Query  284  TE-QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYT  460
             + +KKK+YVDLGC++VSRK  KW++ S+L A  ++GL +++ KT PRHH P  PPD Y+
Sbjct  61   PDGKKKKKYVDLGCVMVSRKALKWSLISILIAFCVIGLPIIVAKTWPRHHPPPLPPDRYS  120

Query  461  LALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
             AL KAL+FFNAQ+SG+L K NN+ WRGNS + DG  +D      LVGGYYD+
Sbjct  121  EALRKALLFFNAQKSGRLGKSNNIRWRGNSGVNDG--NDTLAKGGLVGGYYDS  171



>ref|XP_002888427.1| hypothetical protein ARALYDRAFT_894138 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64686.1| hypothetical protein ARALYDRAFT_894138 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 11/171 (6%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHAND--SATDDDRSRNLQDLDRAALSR---SLDETQQSWLLGPTE--  289
            M+  + WGG L+   +D  +A +++R R   + DR A+      LDETQQ WLL P +  
Sbjct  1    MHPGNVWGGSLDAVDSDRIAAEEEERLRKTTEWDRGAIHSQRSELDETQQGWLLAPQDSW  60

Query  290  -QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLA  466
             +KKK+YV+LGC+ VS+    WT+G++    ++V L ++IVK++PRH    PPPDNYTLA
Sbjct  61   RKKKKKYVNLGCVSVSQTACMWTIGTIAVLFLVVALPIIIVKSLPRHKSTPPPPDNYTLA  120

Query  467  LHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LHKAL FF+AQ+SGKLPK N VSWRG+S + DGK D   +   LVGGYYD 
Sbjct  121  LHKALQFFDAQKSGKLPKKNKVSWRGDSGLGDGKPD---VVGGLVGGYYDG  168



>ref|XP_009403795.1| PREDICTED: endoglucanase 12-like [Musa acuminata subsp. malaccensis]
Length=618

 Score =   120 bits (300),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRS-LDETQQSWLLGPTEQKKKRY  307
            M+  + WGG  +I  +DS  DD +S N+  +D+AAL R  LDETQQ WLLGP + KK +Y
Sbjct  1    MHYSNRWGGSFDIQ-HDSHADDVQSSNMA-IDKAALLREQLDETQQGWLLGPRDVKKDKY  58

Query  308  VDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMF  487
            +DL  ++  +++ KW V S+L A V++G+ +++ K +P H  P   PD YT+AL  AL F
Sbjct  59   IDLWIVVCKKEMVKWVVYSLLIAFVVIGVPIVVAKMIPTHKEPVLLPDEYTVALRLALEF  118

Query  488  FNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            FNAQ+SG+LPK+N V WRGNS ++DG S+ + +   LVGGYYD+
Sbjct  119  FNAQKSGRLPKNNGVPWRGNSGLQDG-SELSDVIGGLVGGYYDS  161



>ref|XP_006300882.1| hypothetical protein CARUB_v10019972mg [Capsella rubella]
 gb|EOA33780.1| hypothetical protein CARUB_v10019972mg [Capsella rubella]
Length=624

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 115/172 (67%), Gaps = 12/172 (7%)
 Frame = +2

Query  131  MYGRDPWGGPLE---IHANDSATDDDRSRNLQDLDRA---ALSRSLDETQQSWLLGPTE-  289
            M+  + WGG L+   I   ++  ++ R RN+ D DR    +    LDETQQ WLL P + 
Sbjct  1    MHPGNVWGGSLDAVDIDRAEAEEEEQRRRNMTDWDRGVNHSQRHELDETQQGWLLAPQDS  60

Query  290  --QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  463
              +KKKRYV+LGC+ VSR VF WTVGS+    ++V L ++IVK++P+H    PP DNYTL
Sbjct  61   WKKKKKRYVNLGCVSVSRTVFMWTVGSIAVLFIVVALPIIIVKSLPKHESTLPPSDNYTL  120

Query  464  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            A+HKA+ FF+AQ+SGKLPK N VSWRG+S ++DG  D   +   LVGGYYD 
Sbjct  121  AIHKAIKFFDAQKSGKLPKKNKVSWRGDSGLKDGFPD---VVGGLVGGYYDG  169



>ref|XP_009127411.1| PREDICTED: endoglucanase 7 [Brassica rapa]
Length=630

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 118/178 (66%), Gaps = 18/178 (10%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSR--NLQDLDRAALS----------RSLDETQQSWL  274
            M+  + WGG L+   +D A  ++  R  N+ + DR AL             LDETQQ WL
Sbjct  1    MHPGNLWGGRLDAIDSDRAEAEEEERRRNMTEWDRGALHSQQLSAEHQRNQLDETQQGWL  60

Query  275  LGPTE---QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpp  445
            L P +   +K+K+YV+LGCI VSR VF WTVGS++   ++V L ++IVK++PRH    PP
Sbjct  61   LAPQDSWKKKRKKYVNLGCISVSRTVFTWTVGSIVVLFLVVALPIIIVKSLPRHKSTPPP  120

Query  446  pdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            PDNYTLA+HKA+ FF+AQ+SGKLPK+N VSWRGNS ++DG  D   +   LVGGYYD 
Sbjct  121  PDNYTLAIHKAIQFFDAQKSGKLPKNNRVSWRGNSGLKDGLPD---VVGGLVGGYYDG  175



>ref|XP_004502103.1| PREDICTED: endoglucanase 12-like [Cicer arietinum]
Length=620

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 110/167 (66%), Gaps = 6/167 (4%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSL--DETQQSWLL--GPTEQKK  298
            M+ R+ WGG  E+ + +  +  + S   Q  D+AAL      DET QSW+L    T++KK
Sbjct  1    MHSRNQWGGSFELSSGEVVSGYEISPAEQ-WDKAALLEQPRRDETLQSWILERSETKRKK  59

Query  299  KRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKA  478
             +YVD GCI++S K  KW  GS+  A  ++GL ++I   +P+HH    PPDNYTLALHKA
Sbjct  60   SKYVDFGCIVLSHKALKWIFGSIFVAFCVIGLPIIIAHFLPKHHAKPIPPDNYTLALHKA  119

Query  479  LMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            L FFNAQ+SGKLPK+N + WRGNS ++DGK D   +   LVGGYYDA
Sbjct  120  LRFFNAQKSGKLPKNNGIPWRGNSGLQDGK-DSNDVKGGLVGGYYDA  165



>gb|KFK41003.1| hypothetical protein AALP_AA2G072700 [Arabis alpina]
Length=630

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 18/178 (10%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSR--NLQDLDRAALS----------RSLDETQQSWL  274
            M+  + WGG L+   +D A  ++  R  N+ + DR AL             LDETQQSWL
Sbjct  1    MHPGNLWGGRLDAVDSDRAAAEEEERRRNMTEWDRGALHSQRLTAESERNQLDETQQSWL  60

Query  275  LGPTE---QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpp  445
            L P +   +K+K+YV+LGC+ VSR VF WTVGS++   ++V L ++IVK++P H    P 
Sbjct  61   LAPEDSWRKKRKKYVNLGCVSVSRTVFLWTVGSIVVLFLVVALPIIIVKSLPPHKSAPPT  120

Query  446  pdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
             DNYTLALH AL FF+AQ+SG+LPK+N VSWRG+S ++DG  D   +   LVGGYYD 
Sbjct  121  SDNYTLALHNALQFFDAQKSGRLPKNNKVSWRGDSGLKDGLPD---VPGGLVGGYYDG  175



>ref|XP_001775325.1| predicted protein [Physcomitrella patens]
 gb|EDQ59795.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 107/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  152  GGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCIIV  331
            GGP+ +  +  A DD RSR + D D A+L +SL+ETQQSWLL P   K+K+ +DLGC++ 
Sbjct  7    GGPMRMIMDSEAGDDTRSRKM-DFDMASL-KSLEETQQSWLLEPAAPKEKKEIDLGCVVC  64

Query  332  SRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSGK  511
            SRK+F   +G++ AA  +VGL +LI K  PR     PP DNYT+AL  AL FF+AQ+SG 
Sbjct  65   SRKMFFILIGTLFAAGAIVGLSILIYKFAPRKQHHPPPLDNYTIALKMALKFFDAQKSGH  124

Query  512  LPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            LP  NN+SWR +S + DG+  DA +  +L GGYYDA
Sbjct  125  LPPSNNISWRSHSGLNDGR--DAGV--NLTGGYYDA  156



>ref|XP_006391540.1| hypothetical protein EUTSA_v10018270mg [Eutrema salsugineum]
 gb|ESQ28826.1| hypothetical protein EUTSA_v10018270mg [Eutrema salsugineum]
Length=630

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 115/178 (65%), Gaps = 18/178 (10%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSR--NLQDLDRAALS----------RSLDETQQSWL  274
            M+  + WGG L+   +D A  ++  R  N+ + DR AL             LDETQQSWL
Sbjct  1    MHPGNLWGGNLDAVDSDRAAAEEEERRRNMMEWDRGALHSQQLTAENQRNQLDETQQSWL  60

Query  275  LGPTE---QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpp  445
            L P +   +K+K+YV+LGC+ V R V  WTVGS++   ++V L ++IVKT+PRH    PP
Sbjct  61   LAPQDSWKKKRKKYVNLGCVSVGRTVCMWTVGSIVVLFLVVALPIIIVKTLPRHKSTPPP  120

Query  446  pdnYTLALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
             DNYTLALHKAL FF+AQ+SGKLPK N VSWRG+S ++DG  D   +   LVGGYYD 
Sbjct  121  SDNYTLALHKALQFFDAQKSGKLPKKNRVSWRGDSGLKDGLPD---VPGGLVGGYYDG  175



>gb|AFR40403.1| cellulase, partial [Populus trichocarpa]
Length=54

 Score = 99.4 bits (246),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQ  292
            MYGRDPWGG LEI+A DSATDDDRSRNL DLDRAALSR LDETQQSWLLGP EQ
Sbjct  1    MYGRDPWGGSLEINAADSATDDDRSRNLNDLDRAALSRPLDETQQSWLLGPAEQ  54



>gb|EMS51342.1| Endoglucanase 9 [Triticum urartu]
Length=694

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +2

Query  290  QKKKRYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLAL  469
            +KKKRYVDLGC++VSRK+F WT+G +LAAA L G+ V I K VPRH  P  PPD +TLAL
Sbjct  129  RKKKRYVDLGCLLVSRKLFLWTLGLLLAAAALAGIAVGIAKAVPRHQAPPTPPDQFTLAL  188

Query  470  HKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
             KALMFFNAQ+SGKLPKHNNV WRG+SC++DG+SD  T  +DL GGYYD 
Sbjct  189  RKALMFFNAQKSGKLPKHNNVPWRGDSCLKDGRSDQ-TSRRDLSGGYYDG  237



>gb|EPS58029.1| endo-1,4-beta-glucanase, partial [Genlisea aurea]
Length=629

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 110/172 (64%), Gaps = 16/172 (9%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSR---NLQDLDRAALSR----SLDETQQSWLL-GPTEQKKKR  304
            WGG LEI ++  +   +  +   N Q+ DRA++      SLD+TQQ WLL  P+E+KK +
Sbjct  3    WGGSLEITSSGGSPFSEEEKSIGNHQEWDRASIGHIKHHSLDDTQQGWLLLDPSEKKKTK  62

Query  305  -------YVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTL  463
                   +VDLGC++ SR   KW+V  +  A +++ L V+++K+VP    P PPPDNYT 
Sbjct  63   KKKKNDGFVDLGCVVCSRTALKWSVSLLAIAFLVIFLPVVVLKSVPEDRPPPPPPDNYTA  122

Query  464  ALHKALMFFNAQRSGKLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            ALHKAL+FFNAQ+SGKLP  N + WRG+S + DG  +   +   LVGGYYD+
Sbjct  123  ALHKALLFFNAQKSGKLPADNGIPWRGDSGLTDGL-NATDVEGGLVGGYYDS  173



>ref|XP_001759056.1| predicted protein [Physcomitrella patens]
 gb|EDQ76125.1| predicted protein [Physcomitrella patens]
Length=610

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 2/157 (1%)
 Frame = +2

Query  149  WGGPLEIHANDSATDDDRSRNLQDLDRAALSRSLDETQQSWLLGPTEQKKKRYVDLGCII  328
            WGG +++     A DD  S+N  D+DRA++ +SL+ET QSWLL P  +KKK+ +DLGC++
Sbjct  5    WGGSVDMATGSGAEDDTHSKN-PDVDRASV-KSLEETHQSWLLEPKAEKKKKEIDLGCMV  62

Query  329  VSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKALMFFNAQRSG  508
             SRK+F     + +AA+ +VGL VL  K  PR H   PP DNYT+AL  AL FF+AQ+SG
Sbjct  63   CSRKLFLILFVTTIAASSIVGLSVLFWKMTPRKHHHPPPLDNYTIALKMALKFFDAQKSG  122

Query  509  KLPKHNNVSWRGNSCMRDGKSDDATIFKDLVGGYYDA  619
            +LPK NN+SWR +S + DG+        DL GGYYDA
Sbjct  123  RLPKSNNISWRESSALLDGQVAINGNPTDLSGGYYDA  159



>ref|XP_010646848.1| PREDICTED: endoglucanase 12 [Vitis vinifera]
Length=529

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 5/153 (3%)
 Frame = +2

Query  131  MYGRDPWGGPLEIHANDSATDDDRSRNLQDLDRAALS--RSLDETQQSWLLGPTE-QKKK  301
            M+  + WGG LEI+  DS TDD+RSRN++   +  L   R LDETQQSWLLGP +   KK
Sbjct  1    MHSANHWGGSLEING-DSGTDDERSRNMEWERQQHLHQHRHLDETQQSWLLGPHQGNGKK  59

Query  302  RYVDLGCIIVSRKVFKWTvgsvlaaavlvglivlivKTVprhhrpnpppdnYTLALHKAL  481
            +YVDLGCI+ S K  K+T+ S++ +  ++ L ++IVK++P+H     PPDNYTLALHKAL
Sbjct  60   KYVDLGCIMCSHKALKYTIWSLVISFFVIALPIIIVKSLPQHKSHPSPPDNYTLALHKAL  119

Query  482  MFFNAQRSGKLP-KHNNVSWRGNSCMRDGKSDD  577
            +FFNAQ+   LP    +  + G S     K DD
Sbjct  120  LFFNAQKCKSLPIPLFSAQFVGASVANSSKPDD  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 883751467950