BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034G07

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343433.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    174   4e-77   Solanum tuberosum [potatoes]
ref|XP_009606233.1|  PREDICTED: pre-mRNA-processing protein 40A i...    167   3e-75   Nicotiana tomentosiformis
ref|XP_009765767.1|  PREDICTED: pre-mRNA-processing protein 40A i...    166   4e-75   Nicotiana sylvestris
ref|XP_010323429.1|  PREDICTED: pre-mRNA-processing protein 40A         168   6e-75   Solanum lycopersicum
emb|CDP01015.1|  unnamed protein product                                156   7e-68   Coffea canephora [robusta coffee]
ref|XP_011074334.1|  PREDICTED: pre-mRNA-processing protein 40A         157   1e-66   Sesamum indicum [beniseed]
gb|EYU36395.1|  hypothetical protein MIMGU_mgv1a000784mg                151   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_010273523.1|  PREDICTED: pre-mRNA-processing protein 40A         154   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_007018443.1|  Pre-mRNA-processing protein 40A isoform 8          156   3e-60   
ref|XP_007018442.1|  Pre-mRNA-processing protein 40A isoform 7          156   3e-60   
ref|XP_011458881.1|  PREDICTED: pre-mRNA-processing protein 40A         160   1e-59   Fragaria vesca subsp. vesca
ref|XP_008220401.1|  PREDICTED: pre-mRNA-processing protein 40A i...    157   1e-59   Prunus mume [ume]
ref|XP_008808872.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    146   2e-59   
ref|XP_008220399.1|  PREDICTED: pre-mRNA-processing protein 40A i...    157   2e-59   Prunus mume [ume]
ref|XP_008808873.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    145   3e-59   
ref|XP_007018436.1|  Pre-mRNA-processing protein 40A isoform 1          156   7e-59   
ref|XP_010918636.1|  PREDICTED: pre-mRNA-processing protein 40A i...    146   7e-59   
gb|KJB63970.1|  hypothetical protein B456_010G027200                    152   8e-59   Gossypium raimondii
ref|XP_010248342.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    149   9e-59   
ref|XP_010248344.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    149   9e-59   
ref|XP_007227030.1|  hypothetical protein PRUPE_ppa000697mg             155   1e-58   Prunus persica
ref|XP_009361094.1|  PREDICTED: pre-mRNA-processing protein 40A         151   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_007018441.1|  Pre-mRNA-processing protein 40A isoform 6          157   3e-58   
gb|KJB63965.1|  hypothetical protein B456_010G027200                    151   3e-58   Gossypium raimondii
ref|XP_007018439.1|  Pre-mRNA-processing protein 40A isoform 4          156   3e-58   
ref|XP_010664484.1|  PREDICTED: pre-mRNA-processing protein 40A         148   3e-58   Vitis vinifera
ref|XP_010105833.1|  Pre-mRNA-processing factor 40-A-like protein       150   5e-58   Morus notabilis
ref|XP_008808868.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    146   5e-58   Phoenix dactylifera
ref|XP_007018440.1|  Pre-mRNA-processing protein 40A isoform 5          156   7e-58   
ref|XP_009350341.1|  PREDICTED: pre-mRNA-processing protein 40A-like    151   8e-58   Pyrus x bretschneideri [bai li]
ref|XP_010918635.1|  PREDICTED: pre-mRNA-processing protein 40A i...    147   8e-58   Elaeis guineensis
gb|KJB63964.1|  hypothetical protein B456_010G027200                    150   1e-57   Gossypium raimondii
ref|XP_008808871.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    146   2e-57   Phoenix dactylifera
ref|XP_008452677.1|  PREDICTED: pre-mRNA-processing protein 40A         148   2e-57   Cucumis melo [Oriental melon]
gb|KJB63963.1|  hypothetical protein B456_010G027200                    150   2e-57   Gossypium raimondii
gb|KJB63969.1|  hypothetical protein B456_010G027200                    151   2e-57   Gossypium raimondii
ref|XP_008365587.1|  PREDICTED: pre-mRNA-processing protein 40A-like    150   2e-57   
gb|KJB63966.1|  hypothetical protein B456_010G027200                    151   3e-57   Gossypium raimondii
gb|KJB63968.1|  hypothetical protein B456_010G027200                    151   4e-57   Gossypium raimondii
ref|XP_002510055.1|  protein binding protein, putative                  144   5e-57   
ref|XP_007018438.1|  Pre-mRNA-processing protein 40A isoform 3          156   7e-57   
ref|XP_009418171.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    147   8e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010110128.1|  hypothetical protein L484_003757                   145   1e-56   Morus notabilis
ref|XP_009418172.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    147   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP41586.1|  hypothetical protein JCGZ_15993                         149   2e-56   Jatropha curcas
ref|XP_004141297.1|  PREDICTED: pre-mRNA-processing protein 40A-like    148   5e-56   
ref|XP_004956604.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    144   6e-56   Setaria italica
ref|XP_006644254.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    140   3e-55   
ref|XP_006644253.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    140   3e-55   
ref|XP_006644255.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    140   4e-55   
gb|KHN17176.1|  Pre-mRNA-processing factor 40 like A                    142   7e-55   Glycine soja [wild soybean]
ref|XP_008337025.1|  PREDICTED: pre-mRNA-processing protein 40A-like    145   1e-54   
ref|XP_010999910.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    137   2e-54   Populus euphratica
ref|XP_004169188.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    139   2e-54   
gb|EPS62863.1|  hypothetical protein M569_11923                         138   2e-54   Genlisea aurea
ref|XP_006827042.1|  hypothetical protein AMTR_s00010p00227470          143   3e-54   
ref|XP_006595998.1|  PREDICTED: pre-mRNA-processing protein 40A-like    142   3e-54   
ref|XP_007160939.1|  hypothetical protein PHAVU_001G029800g             141   7e-54   Phaseolus vulgaris [French bean]
ref|XP_002320019.2|  FF domain-containing family protein                137   1e-53   
gb|KJB77626.1|  hypothetical protein B456_012G147100                    139   2e-53   Gossypium raimondii
ref|XP_010999909.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    137   2e-53   Populus euphratica
gb|KJB77624.1|  hypothetical protein B456_012G147100                    139   2e-53   Gossypium raimondii
gb|KJB77621.1|  hypothetical protein B456_012G147100                    139   2e-53   Gossypium raimondii
gb|EEE54732.1|  hypothetical protein OsJ_02081                          140   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007042685.1|  Pre-mRNA-processing protein 40B, putative          135   3e-53   
gb|KCW68618.1|  hypothetical protein EUGRSUZ_F02226                     139   3e-53   Eucalyptus grandis [rose gum]
ref|XP_010061630.1|  PREDICTED: pre-mRNA-processing protein 40A i...    140   4e-53   
gb|KCW68619.1|  hypothetical protein EUGRSUZ_F02226                     139   4e-53   Eucalyptus grandis [rose gum]
ref|XP_007160940.1|  hypothetical protein PHAVU_001G029800g             142   4e-53   Phaseolus vulgaris [French bean]
ref|XP_010061631.1|  PREDICTED: pre-mRNA-processing protein 40A i...    139   4e-53   Eucalyptus grandis [rose gum]
ref|XP_003549369.2|  PREDICTED: pre-mRNA-processing protein 40A-like    138   1e-52   Glycine max [soybeans]
ref|XP_002522113.1|  protein binding protein, putative                  133   2e-52   
gb|KEH40000.1|  pre-mRNA-processing 40A-like protein                    135   3e-52   Medicago truncatula
gb|KDP44546.1|  hypothetical protein JCGZ_16379                         137   3e-52   Jatropha curcas
ref|XP_008675544.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    146   5e-52   Zea mays [maize]
ref|XP_008805730.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    130   9e-52   Phoenix dactylifera
ref|XP_006422757.1|  hypothetical protein CICLE_v10027732mg             130   1e-51   Citrus clementina [clementine]
gb|KDO49544.1|  hypothetical protein CISIN_1g001687mg                   130   1e-51   Citrus sinensis [apfelsine]
ref|XP_006422756.1|  hypothetical protein CICLE_v10027732mg             130   1e-51   
gb|KDO49545.1|  hypothetical protein CISIN_1g001687mg                   130   1e-51   Citrus sinensis [apfelsine]
ref|XP_008805733.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    130   1e-51   
ref|XP_008805735.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    130   2e-51   Phoenix dactylifera
ref|XP_008805734.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    130   2e-51   
ref|XP_004498955.1|  PREDICTED: pre-mRNA-processing protein 40A-like    135   2e-51   Cicer arietinum [garbanzo]
ref|XP_011002294.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    132   2e-51   Populus euphratica
ref|XP_011002339.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    131   2e-51   Populus euphratica
ref|XP_011002323.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    131   2e-51   Populus euphratica
ref|XP_011002329.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    131   2e-51   Populus euphratica
ref|XP_009604101.1|  PREDICTED: pre-mRNA-processing protein 40A-like    132   3e-51   Nicotiana tomentosiformis
ref|XP_009397407.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    132   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397415.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    132   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008675546.1|  PREDICTED: pre-mRNA-processing protein 40A-like    149   3e-51   Zea mays [maize]
ref|XP_006486884.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    130   3e-51   Citrus sinensis [apfelsine]
ref|XP_008364430.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    132   3e-51   
ref|XP_008364431.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    132   3e-51   
ref|XP_003563698.1|  PREDICTED: pre-mRNA-processing protein 40A         141   4e-51   
ref|XP_010500168.1|  PREDICTED: pre-mRNA-processing protein 40A i...    125   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010500169.1|  PREDICTED: pre-mRNA-processing protein 40A i...    125   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004496865.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    129   5e-51   Cicer arietinum [garbanzo]
ref|XP_009796951.1|  PREDICTED: pre-mRNA-processing protein 40A-like    130   6e-51   Nicotiana sylvestris
ref|XP_010461464.1|  PREDICTED: pre-mRNA-processing protein 40A-like    124   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010479065.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    124   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006486888.1|  PREDICTED: pre-mRNA-processing protein 40A-like    131   7e-51   Citrus sinensis [apfelsine]
ref|XP_010479064.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    124   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010479063.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    124   7e-51   Camelina sativa [gold-of-pleasure]
gb|KGN52740.1|  hypothetical protein Csa_4G000610                       132   1e-50   Cucumis sativus [cucumbers]
ref|XP_008675538.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    147   1e-50   Zea mays [maize]
gb|KDO49541.1|  hypothetical protein CISIN_1g0018782mg                  131   1e-50   Citrus sinensis [apfelsine]
ref|XP_003535678.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    131   1e-50   Glycine max [soybeans]
ref|XP_006589614.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    131   1e-50   Glycine max [soybeans]
ref|XP_006422754.1|  hypothetical protein CICLE_v100277412mg            131   1e-50   
ref|XP_010479066.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    124   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008454417.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    132   2e-50   Cucumis melo [Oriental melon]
ref|XP_004150264.1|  PREDICTED: pre-mRNA-processing protein 40A-like    132   2e-50   
gb|KHN01575.1|  Pre-mRNA-processing factor 40 like A                    129   2e-50   Glycine soja [wild soybean]
ref|XP_006606005.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    129   3e-50   
ref|XP_006589615.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    130   4e-50   
ref|XP_011030297.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    129   5e-50   Populus euphratica
ref|XP_006393692.1|  hypothetical protein EUTSA_v10011212mg             125   9e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006393693.1|  hypothetical protein EUTSA_v10011212mg             125   9e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006352104.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    128   1e-49   Solanum tuberosum [potatoes]
ref|XP_006352103.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    128   1e-49   Solanum tuberosum [potatoes]
ref|XP_010530462.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    125   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_010530434.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    125   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_002891304.1|  hypothetical protein ARALYDRAFT_891421             125   4e-49   
ref|XP_006306359.1|  hypothetical protein CARUB_v10012256mg             124   5e-49   Capsella rubella
dbj|BAJ88075.1|  predicted protein                                      136   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAF78276.1|AC020576_20  Contains similarity to formin binding ...    125   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175113.2|  pre-mRNA-processing protein 40A                       124   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117438.1|  pre-mRNA-processing protein 40A                    124   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010313079.1|  PREDICTED: pre-mRNA-processing protein 40A i...    122   3e-48   Solanum lycopersicum
ref|XP_004250825.1|  PREDICTED: pre-mRNA-processing protein 40A i...    122   3e-48   Solanum lycopersicum
ref|XP_010313077.1|  PREDICTED: pre-mRNA-processing protein 40A i...    122   3e-48   Solanum lycopersicum
ref|XP_010095738.1|  Pre-mRNA-processing factor 40-A-like protein       125   3e-48   
dbj|BAH19565.1|  AT1G44910                                              124   4e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124532.1|  PREDICTED: pre-mRNA-processing protein 40A i...    122   8e-48   Brassica rapa
ref|XP_009124533.1|  PREDICTED: pre-mRNA-processing protein 40A i...    122   8e-48   Brassica rapa
ref|XP_009124535.1|  PREDICTED: pre-mRNA-processing protein 40A i...    122   8e-48   Brassica rapa
ref|XP_010520792.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    117   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_011092479.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    127   2e-47   Sesamum indicum [beniseed]
ref|XP_007143139.1|  hypothetical protein PHAVU_007G047100g             125   2e-47   Phaseolus vulgaris [French bean]
gb|KCW63560.1|  hypothetical protein EUGRSUZ_G01189                     124   2e-47   Eucalyptus grandis [rose gum]
gb|KCW63559.1|  hypothetical protein EUGRSUZ_G01189                     124   2e-47   Eucalyptus grandis [rose gum]
ref|XP_010065860.1|  PREDICTED: pre-mRNA-processing protein 40A-like    124   3e-47   Eucalyptus grandis [rose gum]
ref|XP_007143137.1|  hypothetical protein PHAVU_007G047100g             126   3e-47   Phaseolus vulgaris [French bean]
ref|XP_007143140.1|  hypothetical protein PHAVU_007G047100g             126   3e-47   Phaseolus vulgaris [French bean]
emb|CDY12575.1|  BnaC06g01010D                                          122   4e-47   Brassica napus [oilseed rape]
emb|CDY47957.1|  BnaA10g28290D                                          122   5e-47   Brassica napus [oilseed rape]
ref|XP_011457824.1|  PREDICTED: pre-mRNA-processing protein 40A-like    129   9e-47   Fragaria vesca subsp. vesca
ref|XP_008236261.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...    117   1e-46   
ref|XP_008380122.1|  PREDICTED: pre-mRNA-processing protein 40A-like    150   4e-46   
ref|XP_006343435.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    173   4e-46   
ref|XP_006343434.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    173   4e-46   Solanum tuberosum [potatoes]
gb|KEH44000.1|  pre-mRNA-processing 40A-like protein                    124   5e-46   Medicago truncatula
emb|CDO97301.1|  unnamed protein product                                125   1e-45   Coffea canephora [robusta coffee]
ref|XP_002885323.1|  FF domain-containing protein                       113   2e-45   
emb|CDY51697.1|  BnaA05g36840D                                          110   2e-44   Brassica napus [oilseed rape]
ref|XP_010692587.1|  PREDICTED: pre-mRNA-processing protein 40A i...    133   3e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692586.1|  PREDICTED: pre-mRNA-processing protein 40A i...    133   5e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009145760.1|  PREDICTED: pre-mRNA-processing protein 40B i...    110   9e-44   Brassica rapa
ref|XP_009145759.1|  PREDICTED: pre-mRNA-processing protein 40B i...    110   9e-44   Brassica rapa
ref|XP_009606231.1|  PREDICTED: pre-mRNA-processing protein 40A i...    167   1e-43   Nicotiana tomentosiformis
ref|XP_009606230.1|  PREDICTED: pre-mRNA-processing protein 40A i...    167   1e-43   Nicotiana tomentosiformis
ref|XP_009606232.1|  PREDICTED: pre-mRNA-processing protein 40A i...    167   1e-43   Nicotiana tomentosiformis
gb|KJB63967.1|  hypothetical protein B456_010G027200                    152   2e-43   Gossypium raimondii
ref|XP_009765765.1|  PREDICTED: pre-mRNA-processing protein 40A i...    166   2e-43   Nicotiana sylvestris
ref|XP_009765764.1|  PREDICTED: pre-mRNA-processing protein 40A i...    166   2e-43   Nicotiana sylvestris
emb|CDY24627.1|  BnaC05g33110D                                          107   2e-43   Brassica napus [oilseed rape]
ref|XP_001774266.1|  predicted protein                                  112   2e-43   
ref|XP_010507899.1|  PREDICTED: pre-mRNA-processing protein 40B-like    104   3e-43   Camelina sativa [gold-of-pleasure]
gb|KHN23176.1|  Pre-mRNA-processing factor 40 like A                    107   3e-43   Glycine soja [wild soybean]
ref|NP_188601.4|  pre-mRNA-processing protein 40B                       110   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406474.1|  hypothetical protein EUTSA_v10019995mg             108   3e-43   
ref|XP_002966973.1|  hypothetical protein SELMODRAFT_439841             134   4e-43   
ref|XP_010691544.1|  PREDICTED: pre-mRNA-processing protein 40A-like    125   7e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010557530.1|  PREDICTED: pre-mRNA-processing protein 40B i...    112   3e-42   Tarenaya hassleriana [spider flower]
ref|XP_010557525.1|  PREDICTED: pre-mRNA-processing protein 40B i...    112   3e-42   Tarenaya hassleriana [spider flower]
ref|XP_010557531.1|  PREDICTED: pre-mRNA-processing protein 40B i...    112   4e-42   Tarenaya hassleriana [spider flower]
ref|XP_010557533.1|  PREDICTED: pre-mRNA-processing protein 40B i...    112   4e-42   Tarenaya hassleriana [spider flower]
ref|XP_010466124.1|  PREDICTED: pre-mRNA-processing protein 40B-l...    102   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010489948.1|  PREDICTED: pre-mRNA-processing protein 40B-like    102   5e-42   
gb|EYU39080.1|  hypothetical protein MIMGU_mgv1a000980mg                119   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_010466123.1|  PREDICTED: pre-mRNA-processing protein 40B-l...    102   8e-42   Camelina sativa [gold-of-pleasure]
gb|EPS71108.1|  hypothetical protein M569_03648                         107   1e-41   Genlisea aurea
ref|XP_006299213.1|  hypothetical protein CARUB_v10015361mg             101   2e-41   Capsella rubella
gb|EEC70813.1|  hypothetical protein OsI_02277                          138   2e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_004156902.1|  PREDICTED: pre-mRNA-processing protein 40A-like    124   7e-38   
ref|XP_002313923.2|  hypothetical protein POPTR_0009s08880g             132   4e-37   
ref|XP_002961039.1|  hypothetical protein SELMODRAFT_402621             103   7e-34   
gb|KHG26690.1|  Pre-mRNA-processing factor 40 A                         132   1e-31   Gossypium arboreum [tree cotton]
gb|KDO49546.1|  hypothetical protein CISIN_1g001687mg                   130   1e-30   Citrus sinensis [apfelsine]
gb|EMT05751.1|  Pre-mRNA-processing factor 40-A-like protein          84.7    2e-30   
gb|EMS61804.1|  Pre-mRNA-processing factor 40-like protein A          85.1    2e-30   Triticum urartu
ref|XP_011092488.1|  PREDICTED: pre-mRNA-processing protein 40A-l...    127   1e-29   
dbj|BAB02553.1|  formin binding protein-like                            110   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39294.1|  hypothetical protein AALP_AA3G226000                  94.4    9e-29   Arabis alpina [alpine rockcress]
gb|KFK39295.1|  hypothetical protein AALP_AA3G226000                  94.4    9e-29   Arabis alpina [alpine rockcress]
gb|AAF69150.1|AC007915_2  F27F5.2                                       123   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007201807.1|  hypothetical protein PRUPE_ppa000966mg             115   9e-27   
ref|XP_002300284.2|  hypothetical protein POPTR_0001s29710g             114   4e-25   
ref|XP_005647286.1|  hypothetical protein COCSUDRAFT_47676            89.0    8e-25   Coccomyxa subellipsoidea C-169
ref|XP_011017521.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  99.0    4e-20   Populus euphratica
ref|XP_005845731.1|  hypothetical protein CHLNCDRAFT_136322           75.1    3e-19   Chlorella variabilis
ref|XP_001768158.1|  predicted protein                                91.3    1e-17   
ref|XP_002950379.1|  hypothetical protein VOLCADRAFT_104642           82.0    7e-17   Volvox carteri f. nagariensis
ref|XP_001768159.1|  predicted protein                                88.6    9e-17   
gb|EFA77355.1|  WW domain-containing protein                          60.5    4e-16   Heterostelium album PN500
dbj|GAM22720.1|  hypothetical protein SAMD00019534_058950             60.5    2e-14   Acytostelium subglobosum LB1
ref|XP_004361782.1|  WW domain-containing protein                     60.5    1e-13   Cavenderia fasciculata
ref|XP_001692603.1|  WW domain protein                                78.6    3e-13   Chlamydomonas reinhardtii
gb|KFH71285.1|  hypothetical protein MVEG_01585                       65.9    3e-13   Mortierella verticillata NRRL 6337
ref|XP_006834601.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.1    4e-13   Chrysochloris asiatica
ref|XP_006834600.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  70.1    4e-13   Chrysochloris asiatica
ref|NP_001243869.1|  uncharacterized protein LOC100170464 isoform 1   68.2    4e-13   Xenopus tropicalis [western clawed frog]
ref|NP_001243870.1|  uncharacterized protein LOC100170464 isoform 2   68.2    4e-13   Xenopus tropicalis [western clawed frog]
ref|XP_004636725.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  69.7    5e-13   
gb|AAI30104.1|  LOC100037011 protein                                  67.8    6e-13   Xenopus laevis [clawed frog]
ref|XP_004636724.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  69.7    6e-13   
ref|XP_004474339.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    6e-13   
ref|XP_004474338.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    7e-13   Dasypus novemcinctus
ref|XP_008115918.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    7e-13   Anolis carolinensis [Carolina anole]
ref|XP_004474341.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    7e-13   
ref|XP_004474340.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    8e-13   
ref|XP_004474342.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    8e-13   Dasypus novemcinctus
gb|EAX11480.1|  hCG1811743, isoform CRA_b                             67.0    8e-13   Homo sapiens [man]
ref|XP_010639709.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    8e-13   Fukomys damarensis [Damara mole rat]
ref|XP_010639710.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    8e-13   Fukomys damarensis [Damara mole rat]
ref|XP_004474343.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    9e-13   Dasypus novemcinctus
ref|XP_010639711.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    9e-13   Fukomys damarensis [Damara mole rat]
ref|XP_004474348.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    9e-13   
ref|XP_004474346.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_008169668.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    1e-12   Chrysemys picta bellii
ref|XP_007078563.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Panthera tigris altaica
ref|XP_007078562.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    1e-12   
ref|XP_006055883.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_011283562.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Felis catus [cat]
ref|XP_011283564.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    1e-12   Felis catus [cat]
ref|XP_007078564.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_010804566.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_010804583.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
dbj|BAG60744.1|  unnamed protein product                              67.4    1e-12   Homo sapiens [man]
ref|XP_005296523.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    1e-12   Chrysemys picta bellii
ref|XP_004474344.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   Dasypus novemcinctus
ref|XP_007494236.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    1e-12   Monodelphis domestica
ref|XP_001365479.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    1e-12   Monodelphis domestica
gb|ELK35058.1|  Pre-mRNA-processing factor 40 like protein A          67.0    1e-12   Myotis davidii
gb|KFP06598.1|  Pre-mRNA-processing factor 40 A                       70.1    1e-12   Calypte anna
gb|EPQ03406.1|  Pre-mRNA-processing factor 40 like protein A          67.0    1e-12   Myotis brandtii
ref|XP_009235989.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Pongo abelii [orang utan]
ref|XP_005676183.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_007078565.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Panthera tigris altaica
ref|XP_003584966.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_002685399.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   Bos taurus [bovine]
ref|XP_004004741.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   Ovis aries [domestic sheep]
ref|XP_010804581.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_008997128.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Callithrix jacchus [common marmoset]
ref|XP_006055884.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_006055885.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_005671898.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_007963171.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Chlorocebus sabaeus
ref|XP_002749482.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Callithrix jacchus [common marmoset]
ref|XP_007494238.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    1e-12   
ref|XP_006055882.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_005671897.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_009235988.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Pongo abelii [orang utan]
ref|XP_005894843.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_005671896.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_007464227.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Lipotes vexillifer [baiji]
ref|XP_007963169.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Chlorocebus sabaeus
ref|XP_001916024.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   Equus caballus [domestic horse]
ref|XP_004743928.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_005671899.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_005573255.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_007198759.1|  PREDICTED: LOW QUALITY PROTEIN: PRP40 pre-mR...  67.4    1e-12   
ref|XP_010639713.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   Fukomys damarensis [Damara mole rat]
ref|XP_004004742.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_010804570.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_006125713.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.4    1e-12   
ref|XP_010804563.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_010804578.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_004474345.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_009235990.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_008997129.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_004674708.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_005985161.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  68.2    1e-12   
ref|XP_007494235.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    1e-12   
gb|EFB16636.1|  hypothetical protein PANDA_018426                     67.4    1e-12   
ref|XP_004674709.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_004474347.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    1e-12   
ref|XP_007963172.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_003363304.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_005676181.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    1e-12   
ref|XP_005859374.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_007117712.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
gb|EHH21390.1|  hypothetical protein EGK_04442                        67.4    1e-12   
ref|XP_009180513.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_005859375.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_005671900.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_007117710.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
gb|EAX11483.1|  hCG1811743, isoform CRA_e                             67.4    1e-12   
ref|XP_007117713.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
ref|XP_008685205.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.4    1e-12   
ref|XP_009180516.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    1e-12   
gb|KFO25937.1|  Pre-mRNA-processing factor 40 like protein A          68.6    2e-12   
ref|XP_008326969.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.8    2e-12   
ref|XP_005601544.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007117711.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006921137.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006091332.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005676182.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    2e-12   
ref|XP_010639712.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    2e-12   
ref|XP_007963170.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006757449.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006091334.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_004743929.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_010804575.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    2e-12   
ref|XP_003275014.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006055886.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    2e-12   
ref|XP_010584617.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006757451.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_005859376.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_004870064.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    2e-12   
ref|XP_006091333.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_004743930.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_006888191.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  61.6    2e-12   
ref|XP_005859377.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_010804584.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    2e-12   
ref|XP_008831098.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_010775704.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  66.6    2e-12   
ref|XP_008759933.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_006091336.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006757450.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007888126.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008759931.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_007078567.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_006091335.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_011283567.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_006234226.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008831097.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_010729219.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.6    2e-12   
ref|XP_004620568.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_006757452.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_011283565.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007669507.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_006091338.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008169666.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_007056741.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.8    2e-12   
ref|XP_006757454.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008831094.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_002798952.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008759932.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008169667.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_006880839.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_009235985.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008831095.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_005296524.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_007078566.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|NP_060362.3|  pre-mRNA-processing factor 40 homolog A             67.4    2e-12   
ref|XP_006157680.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.4    2e-12   
ref|XP_008831096.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_010371198.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008997133.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007494237.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008759934.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_010371191.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005246733.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_011488013.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_008997130.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_009235986.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_003763917.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.0    2e-12   
ref|XP_010371193.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_011488012.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    2e-12   
ref|XP_008169670.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005246734.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_003832770.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.4    2e-12   
ref|XP_515837.3|  PREDICTED: pre-mRNA-processing factor 40 homolo...  67.4    2e-12   
gb|ERE70285.1|  putative pre-mRNA-processing factor 40                67.0    2e-12   
ref|XP_010371197.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008574438.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007117714.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005296522.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008574439.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005671903.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007464228.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_007464229.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008997131.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005573254.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008527814.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005069025.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008574434.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_011283566.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005800742.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  68.2    2e-12   
ref|XP_005246735.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_005573257.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_011234582.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005573253.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_010371192.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_009235987.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
sp|O75400.2|PR40A_HUMAN  RecName: Full=Pre-mRNA-processing factor...  67.4    2e-12   
ref|XP_005315854.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_010371194.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005069024.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008527818.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005632053.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_009441785.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_004375443.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_005573256.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    2e-12   
ref|XP_008527815.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
ref|XP_008574437.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    2e-12   
gb|ERE70286.1|  putative pre-mRNA-processing factor 40                67.0    3e-12   
ref|XP_004276853.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_011234581.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_005315853.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_004375444.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_006196228.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_004743932.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_009441782.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
gb|ERE70292.1|  putative pre-mRNA-processing factor 40                67.0    3e-12   
ref|XP_007570339.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    3e-12   
ref|XP_004276852.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_008574436.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_007933116.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_002928470.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_010371196.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_533359.3|  PREDICTED: pre-mRNA-processing factor 40 homolo...  67.0    3e-12   
ref|NP_001231502.1|  pre-mRNA-processing factor 40 homolog A          67.4    3e-12   
ref|XP_004394855.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_003405891.2|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_008997132.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_008527817.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_004577220.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_006179107.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_006179106.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_005573260.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_004394854.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_004423883.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_010983924.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.4    3e-12   
ref|XP_004423882.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_006196229.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_008136907.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_005632055.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_004651902.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_003795987.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|NP_938170.1|  pre-mRNA-processing factor 40 homolog A             68.6    3e-12   
ref|XP_008069263.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.0    3e-12   
ref|XP_005632054.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_007629195.1|  PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-pro...  67.0    3e-12   
gb|ERE70284.1|  putative pre-mRNA-processing factor 40                67.0    3e-12   
ref|XP_007651531.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_004703876.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_007527406.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_005671901.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_006498255.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_007527407.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|NP_001099950.1|  pre-mRNA-processing factor 40 homolog A          67.0    3e-12   
ref|XP_006974296.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_005859378.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_007651530.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_005632056.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_006974293.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
gb|ERE70293.1|  putative pre-mRNA-processing factor 40                67.0    3e-12   
ref|XP_006498257.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_004743931.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_007253590.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_010584618.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
dbj|BAB68206.1|  formin binding protein 11-related protein            67.4    3e-12   
ref|XP_004651901.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_003478740.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    3e-12   
ref|XP_004703875.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
gb|ERE70290.1|  putative pre-mRNA-processing factor 40                67.0    3e-12   
emb|CAG09312.1|  unnamed protein product                              67.4    3e-12   
ref|XP_005346469.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_003405890.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_007651532.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
gb|ERE70291.1|  putative pre-mRNA-processing factor 40                67.4    3e-12   
ref|XP_005007748.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_006974295.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
gb|EAX11484.1|  hCG1811743, isoform CRA_f                             66.6    3e-12   
ref|XP_003513010.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_006974294.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_008402192.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.8    3e-12   
ref|XP_003478739.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_005007749.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|XP_006091337.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    3e-12   
ref|NP_061255.1|  pre-mRNA-processing factor 40 homolog A             67.0    3e-12   
ref|XP_005346470.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_006498258.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_010561366.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    4e-12   
ref|XP_006757453.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
gb|KFO60112.1|  Pre-mRNA-processing factor 40 A                       68.2    4e-12   
ref|XP_005390873.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_010966173.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_010966174.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_006498256.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
gb|KFP25477.1|  Pre-mRNA-processing factor 40 A                       67.0    4e-12   
ref|XP_005390875.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_008169669.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    4e-12   
gb|ERE70294.1|  putative pre-mRNA-processing factor 40                67.0    4e-12   
ref|XP_006974297.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.0    4e-12   
ref|XP_006747416.1|  PREDICTED: pre-mRNA-processing factor 40 hom...  67.4    4e-12   



>ref|XP_006343433.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Solanum 
tuberosum]
Length=1031

 Score =   174 bits (440),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +S QDIE  K   + A  I+V  +EEK+ADEEP +YATKQEAKNAFK
Sbjct  387  ENLSPQVASSLSGASSQDIEEAKKGMAVAGKINVVPAEEKSADEEPFLYATKQEAKNAFK  446

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERRLRQR
Sbjct  447  ALLESANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRLRQR  506

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKELTSSTRWS
Sbjct  507  KAKEEFTKMLEESKELTSSTRWS  529


 Score =   142 bits (357),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKAVEREADREDLFRNYLVDLQKKE++KAQE+YRRNR+EY+ FLETCGFI
Sbjct  531  AVTMFEDDERFKAVEREADREDLFRNYLVDLQKKERSKAQEEYRRNRLEYKQFLETCGFI  590

Query  598  KVDTQWRKVQDLL  636
            KVDTQWRKVQDLL
Sbjct  591  KVDTQWRKVQDLL  603



>ref|XP_009606233.1| PREDICTED: pre-mRNA-processing protein 40A isoform X4 [Nicotiana 
tomentosiformis]
Length=1032

 Score =   167 bits (423),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  387  ENLSPQVASSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  446

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  447  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  506

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  507  KAKEEFTKMLEESKELISSTRWS  529


 Score =   142 bits (357),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKAVEREADREDLFRNYLVDLQKKE+AKAQE+YR NR+EYR FLETCGFI
Sbjct  531  AVTMFEDDERFKAVEREADREDLFRNYLVDLQKKERAKAQEEYRHNRLEYRQFLETCGFI  590

Query  598  KVDTQWRKVQDLL  636
            KVDTQWRKVQDLL
Sbjct  591  KVDTQWRKVQDLL  603



>ref|XP_009765767.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Nicotiana 
sylvestris]
Length=1034

 Score =   166 bits (421),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  388  ENLSPQVSSSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  447

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  448  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  507

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  508  KAKEEFTKMLEESKELISSTRWS  530


 Score =   142 bits (358),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 66/73 (90%), Positives = 71/73 (97%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKAVEREADREDLFRNYLVDLQKKE+AKAQE+YR+NR+EYR FLETCGFI
Sbjct  532  AVTMFEDDERFKAVEREADREDLFRNYLVDLQKKERAKAQEEYRQNRLEYRHFLETCGFI  591

Query  598  KVDTQWRKVQDLL  636
            KVDTQWRKVQDLL
Sbjct  592  KVDTQWRKVQDLL  604



>ref|XP_010323429.1| PREDICTED: pre-mRNA-processing protein 40A [Solanum lycopersicum]
Length=1027

 Score =   168 bits (425),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +S QDIE  K   + A  I+V  +EEK+ADEEP +YATKQEAK+AFK
Sbjct  387  ENLSPQVASSLSGASSQDIEEAKKGMAVAGKINVVPAEEKSADEEPFLYATKQEAKHAFK  446

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            +LLESA V SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERRLRQR
Sbjct  447  SLLESATVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRLRQR  506

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKELTSSTRWS
Sbjct  507  KAKEEFTKMLEESKELTSSTRWS  529


 Score =   140 bits (353),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFK VEREADREDLFRNYLVDLQKKE++KAQE+YRRNR+EY+ FLETCGFI
Sbjct  531  AVTMFEDDERFKGVEREADREDLFRNYLVDLQKKERSKAQEEYRRNRLEYKQFLETCGFI  590

Query  598  KVDTQWRKVQDLL  636
            KVDTQWRKVQDLL
Sbjct  591  KVDTQWRKVQDLL  603



>emb|CDP01015.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   156 bits (394),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 114/142 (80%), Gaps = 3/142 (2%)
 Frame = +3

Query  6    NSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKA  176
            NSS     S+G +S QDIE  K   + A  ++VT SEEK  D+EPLV+  KQEAKNAFKA
Sbjct  179  NSSHIAEGSTGEASSQDIEEAKKGMAVAGKVNVTTSEEKPMDDEPLVFTNKQEAKNAFKA  238

Query  177  LLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrk  356
            LLESANV +DWTW+Q +R I NDKRYGALK  GERKQAFNEYLMQRKK+EAEERRLRQRK
Sbjct  239  LLESANVEADWTWEQAMRVIINDKRYGALKTLGERKQAFNEYLMQRKKIEAEERRLRQRK  298

Query  357  akeeFTKMLEESKELTSSTRWS  422
            AKEEFTKMLEE +ELTS TRWS
Sbjct  299  AKEEFTKMLEECRELTSLTRWS  320


 Score =   128 bits (322),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+ EDDERFKAVE+E+DREDLFR+YLVDLQKKE+ KAQE++RRNR EYR FLETCGFI
Sbjct  322  AVTMLEDDERFKAVEKESDREDLFRSYLVDLQKKERVKAQEEHRRNRSEYRQFLETCGFI  381

Query  598  KVDTQWRKVQDLL  636
            KVD+QWRKVQDLL
Sbjct  382  KVDSQWRKVQDLL  394



>ref|XP_011074334.1| PREDICTED: pre-mRNA-processing protein 40A [Sesamum indicum]
 ref|XP_011074335.1| PREDICTED: pre-mRNA-processing protein 40A [Sesamum indicum]
 ref|XP_011074336.1| PREDICTED: pre-mRNA-processing protein 40A [Sesamum indicum]
Length=1028

 Score =   157 bits (397),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  3    ENSSPQVVASS-GVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            EN    V AS    +SIQDIE  K   + A  I+VT  EEK  D+EP++YATKQEAKNAF
Sbjct  408  ENPPLHVGASPLAGASIQDIEEAKRGMAVAGKINVTPVEEKTTDDEPIIYATKQEAKNAF  467

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            KALL SANV +DWTWDQ +R I NDKRYGALK  GERKQAFNEYLMQRKK+EAEERR+RQ
Sbjct  468  KALLGSANVEADWTWDQAMRVIINDKRYGALKTLGERKQAFNEYLMQRKKVEAEERRIRQ  527

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            RKAKEEF KMLEES+ELTSSTRWS
Sbjct  528  RKAKEEFMKMLEESEELTSSTRWS  551


 Score =   123 bits (309),  Expect(2) = 1e-66, Method: Composition-based stats.
 Identities = 60/73 (82%), Positives = 69/73 (95%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDD+RFKAVE E DREDLFRNYLVDLQKKE+AKAQE++RRNR+E+R FLE+CGFI
Sbjct  553  AVTMFEDDKRFKAVELETDREDLFRNYLVDLQKKERAKAQEEHRRNRLEFREFLESCGFI  612

Query  598  KVDTQWRKVQDLL  636
            KVD+QWRKVQDLL
Sbjct  613  KVDSQWRKVQDLL  625



>gb|EYU36395.1| hypothetical protein MIMGU_mgv1a000784mg [Erythranthe guttata]
Length=987

 Score =   151 bits (381),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 108/132 (82%), Gaps = 3/132 (2%)
 Frame = +3

Query  36   GVSSIQDIEMKKSTAT---NIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSD  206
            G +S QD E +K   T    ++VT  EEK  D+EP+VYATKQEAKNAFKALLESANV +D
Sbjct  383  GGASFQDTEEEKKGTTVDGKLNVTPVEEKPMDDEPMVYATKQEAKNAFKALLESANVEAD  442

Query  207  WTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLE  386
            W+WDQ +R I NDKRYGALK  GERKQAFNEYLMQRKK+EAEERRLRQRKAKEEF  MLE
Sbjct  443  WSWDQAMRVIINDKRYGALKTLGERKQAFNEYLMQRKKVEAEERRLRQRKAKEEFMTMLE  502

Query  387  ESKELTSSTRWS  422
            ES+ELTSS RWS
Sbjct  503  ESEELTSSMRWS  514


 Score =   115 bits (289),  Expect(2) = 1e-62, Method: Composition-based stats.
 Identities = 58/73 (79%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +FEDD+RFKAVE E+DREDLFRNYLVDL KKEKAKAQE+ RRN+ E+R FLE+CGFI
Sbjct  516  AVIMFEDDKRFKAVELESDREDLFRNYLVDLHKKEKAKAQEEQRRNKQEFRQFLESCGFI  575

Query  598  KVDTQWRKVQDLL  636
            KVD+QWRKVQDLL
Sbjct  576  KVDSQWRKVQDLL  588


 Score = 35.0 bits (79),  Expect(2) = 8e-04, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQ-------KKEKAKAQEDYRRNRVEYRXFLE-  582
            + EDDER   +++  DR D+F++Y+ DL+       K++K + +   R+NR  +R  +E 
Sbjct  587  LLEDDERCTRLDK-LDRLDVFQDYIRDLEKEDDEQKKRQKEQLRRTERKNRDAFREMMEE  645

Query  583  --TCGFIKVDTQWR  618
                G +   T WR
Sbjct  646  HIATGTLTAKTYWR  659


 Score = 34.7 bits (78),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +3

Query  147  KQEAKNAFKALLE-SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            +++AK  F  +LE S  + S   W + V    +DKR+ A+++  +R+  F  YL+   K 
Sbjct  490  QRKAKEEFMTMLEESEELTSSMRWSKAVIMFEDDKRFKAVELESDREDLFRNYLVDLHKK  549

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E  + +  QR+ K+EF + LE    +   ++W
Sbjct  550  EKAKAQEEQRRNKQEFRQFLESCGFIKVDSQW  581



>ref|XP_010273523.1| PREDICTED: pre-mRNA-processing protein 40A [Nelumbo nucifera]
 ref|XP_010273530.1| PREDICTED: pre-mRNA-processing protein 40A [Nelumbo nucifera]
Length=1046

 Score =   154 bits (390),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 115/144 (80%), Gaps = 4/144 (3%)
 Frame = +3

Query  3    ENSSPQ-VVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            EN S Q V AS   +S QD+E  K   + A  I++T  EEK  D+EPLVYA K EAKNAF
Sbjct  424  ENVSTQDVAASVDGASAQDLEEAKKGMAVAGKINITPVEEKTIDDEPLVYANKLEAKNAF  483

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            KALLESANV SDWTW+Q +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR++Q
Sbjct  484  KALLESANVESDWTWEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMKQ  543

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            ++A+EEFTKMLEESKELTSSTRWS
Sbjct  544  KRAREEFTKMLEESKELTSSTRWS  567


 Score =   108 bits (270),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FEDDERFKAVER  DREDLF NYLV+LQKKE+AKAQE+++RN +EYR FLE+C FI
Sbjct  569  AISMFEDDERFKAVERPRDREDLFENYLVELQKKERAKAQEEHKRNIMEYRQFLESCDFI  628

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  629  KANSQWRKVQDRL  641



>ref|XP_007018443.1| Pre-mRNA-processing protein 40A isoform 8 [Theobroma cacao]
 gb|EOY15668.1| Pre-mRNA-processing protein 40A isoform 8 [Theobroma cacao]
Length=789

 Score =   156 bits (395),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score =   103 bits (256),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKA  626

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  627  NSQWRKVQDRL  637



>ref|XP_007018442.1| Pre-mRNA-processing protein 40A isoform 7 [Theobroma cacao]
 gb|EOY15667.1| Pre-mRNA-processing protein 40A isoform 7 [Theobroma cacao]
Length=787

 Score =   156 bits (395),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score =   103 bits (256),  Expect(2) = 3e-60, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKA  626

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  627  NSQWRKVQDRL  637



>ref|XP_011458881.1| PREDICTED: pre-mRNA-processing protein 40A [Fragaria vesca subsp. 
vesca]
Length=994

 Score =   160 bits (404),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 119/145 (82%), Gaps = 6/145 (4%)
 Frame = +3

Query  3    ENSSPQVVASS--GVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNA  167
            EN +PQ  ASS  G SS QDIE  K   + A  ++VT SEEKA D+EPLVYA+KQEAKNA
Sbjct  382  ENQAPQDSASSIDGASS-QDIEEAKKGMAVAGKVNVTPSEEKAIDDEPLVYASKQEAKNA  440

Query  168  FKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlr  347
            FK+LLESANV SDWTW+Q +R I NDKRYGAL+  GERKQAFNEYL QRKKLE EERR+R
Sbjct  441  FKSLLESANVHSDWTWEQAMREIINDKRYGALRTLGERKQAFNEYLGQRKKLENEERRIR  500

Query  348  qrkakeeFTKMLEESKELTSSTRWS  422
            Q++A+EEFTKMLEESKELTS+ RWS
Sbjct  501  QKRAREEFTKMLEESKELTSTIRWS  525


 Score = 97.4 bits (241),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKAVER  DREDL+ +Y+V+L++KEK  A E++RRN  EY+ FLE+C FI
Sbjct  527  AVTMFENDERFKAVERARDREDLYESYIVELERKEKEIAAEEHRRNISEYKEFLESCDFI  586

Query  598  KVDTQWRKVQDLL  636
            KV+TQWRKVQD L
Sbjct  587  KVNTQWRKVQDRL  599



>ref|XP_008220401.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Prunus 
mume]
Length=988

 Score =   157 bits (397),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSI-QDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            EN + Q + S+   +  QDIE  K   + A  ++VT SEEK  DEEPLVYA KQEAKNAF
Sbjct  422  ENVTSQDIGSADDGAFTQDIEEAKRGMAVAGKVNVTPSEEKTVDEEPLVYANKQEAKNAF  481

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            KALLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLE EERR+RQ
Sbjct  482  KALLESANVHSDWTWEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLENEERRMRQ  541

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            +KA+EEF+KMLEESKELTS+TRWS
Sbjct  542  KKAREEFSKMLEESKELTSATRWS  565


 Score =   100 bits (248),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA E++++N  EYR FLE+C FI
Sbjct  567  AVSMFENDERFKAVERARDREDLYESYIVELERKEKEKAAEEHKQNIAEYRKFLESCDFI  626

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  627  KVNSQWRKVQDRL  639



>ref|XP_008808872.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Phoenix 
dactylifera]
Length=942

 Score =   146 bits (369),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QD+E  K        ++VT  EEK  DEEPLVY+ KQEAK AFKALLESANV SDWT
Sbjct  445  ASAQDLEEAKKAMPVTGRVNVTPLEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWT  504

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE 
Sbjct  505  WEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEEC  564

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  565  KELTSSTRWS  574


 Score =   110 bits (275),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YLVDLQKKE+AKA E+++RN +EYR FLE+C FI
Sbjct  576  AVTMFENDERFHAVERARDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRTFLESCDFI  635

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  636  KANTQWRKVQDRL  648



>ref|XP_008220399.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Prunus 
mume]
Length=1031

 Score =   157 bits (397),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSI-QDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            EN + Q + S+   +  QDIE  K   + A  ++VT SEEK  DEEPLVYA KQEAKNAF
Sbjct  422  ENVTSQDIGSADDGAFTQDIEEAKRGMAVAGKVNVTPSEEKTVDEEPLVYANKQEAKNAF  481

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            KALLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLE EERR+RQ
Sbjct  482  KALLESANVHSDWTWEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLENEERRMRQ  541

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            +KA+EEF+KMLEESKELTS+TRWS
Sbjct  542  KKAREEFSKMLEESKELTSATRWS  565


 Score = 99.4 bits (246),  Expect(2) = 2e-59, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA E++++N  EYR FLE+C FI
Sbjct  567  AVSMFENDERFKAVERARDREDLYESYIVELERKEKEKAAEEHKQNIAEYRKFLESCDFI  626

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  627  KVNSQWRKVQDRL  639



>ref|XP_008808873.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X5 [Phoenix 
dactylifera]
Length=685

 Score =   145 bits (367),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKS---TATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QD+E  K        ++VT  EEK  DEEPLVY+ KQEAK AFKALLESANV SDWT
Sbjct  79   ASAQDLEEAKKAMPVTGRVNVTPLEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWT  138

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE 
Sbjct  139  WEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEEC  198

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  199  KELTSSTRWS  208


 Score =   110 bits (274),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YLVDLQKKE+AKA E+++RN +EYR FLE+C FI
Sbjct  210  AVTMFENDERFHAVERARDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRTFLESCDFI  269

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  270  KANTQWRKVQDRL  282



>ref|XP_007018436.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
 ref|XP_007018437.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
 gb|EOY15661.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
 gb|EOY15662.1| Pre-mRNA-processing protein 40A isoform 1 [Theobroma cacao]
Length=1032

 Score =   156 bits (395),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score = 98.2 bits (243),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 46/71 (65%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKA  626

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  627  NSQWRKVQDRL  637



>ref|XP_010918636.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Elaeis 
guineensis]
Length=791

 Score =   146 bits (368),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QD+E  K        ++VT  EEK  DEEPLVY+ KQEAK AFKALLESANV SDWT
Sbjct  189  ASAQDLEEAKKAMPVTGKVNVTPMEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWT  248

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE 
Sbjct  249  WEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEEC  308

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  309  KELTSSTRWS  318


 Score =   108 bits (270),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            T+FE+DERF AVER  DREDLF +YLVDLQKKE+AKA E+++RN +EYR FLE+C FIK 
Sbjct  322  TMFENDERFHAVERPRDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRAFLESCDFIKA  381

Query  604  DTQWRKVQDLL  636
            +TQWRKVQD L
Sbjct  382  NTQWRKVQDRL  392



>gb|KJB63970.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=775

 Score =   152 bits (383),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  386  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  445

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  446  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  505

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  506  KELTSSMRWS  515


 Score =   102 bits (255),  Expect(2) = 8e-59, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  519  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  578

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  579  NSQWRKVQDRL  589



>ref|XP_010248342.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Nelumbo 
nucifera]
Length=1034

 Score =   149 bits (376),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 4/132 (3%)
 Frame = +3

Query  36   GVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSD  206
            GVS+ QD+E  K   + A  I++  +EEK  D+EPLVYA K EAK+AFKALLESANV SD
Sbjct  428  GVSA-QDLEEAKKGMAVAGQINIATAEEKTIDDEPLVYANKLEAKSAFKALLESANVESD  486

Query  207  WTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLE  386
            WTW+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR+RQ+KA++EFTKMLE
Sbjct  487  WTWEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRMRQKKARKEFTKMLE  546

Query  387  ESKELTSSTRWS  422
            ESKELTSSTRWS
Sbjct  547  ESKELTSSTRWS  558


 Score =   105 bits (261),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FEDDERFKAVER  DREDLF NYLV+LQKKE+AKAQE++++N +EY+ FLE+C FI
Sbjct  560  AISMFEDDERFKAVERPRDREDLFENYLVELQKKERAKAQEEHKQNIMEYKQFLESCDFI  619

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  620  KANSQWRKVQDRL  632



>ref|XP_010248344.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Nelumbo 
nucifera]
Length=1033

 Score =   149 bits (376),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 109/132 (83%), Gaps = 4/132 (3%)
 Frame = +3

Query  36   GVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSD  206
            GVS+ QD+E  K   + A  I++  +EEK  D+EPLVYA K EAK+AFKALLESANV SD
Sbjct  428  GVSA-QDLEEAKKGMAVAGQINIATAEEKTIDDEPLVYANKLEAKSAFKALLESANVESD  486

Query  207  WTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLE  386
            WTW+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR+RQ+KA++EFTKMLE
Sbjct  487  WTWEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRMRQKKARKEFTKMLE  546

Query  387  ESKELTSSTRWS  422
            ESKELTSSTRWS
Sbjct  547  ESKELTSSTRWS  558


 Score =   105 bits (261),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 64/73 (88%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FEDDERFKAVER  DREDLF NYLV+LQKKE+AKAQE++++N +EY+ FLE+C FI
Sbjct  560  AISMFEDDERFKAVERPRDREDLFENYLVELQKKERAKAQEEHKQNIMEYKQFLESCDFI  619

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  620  KANSQWRKVQDRL  632



>ref|XP_007227030.1| hypothetical protein PRUPE_ppa000697mg [Prunus persica]
 gb|EMJ28229.1| hypothetical protein PRUPE_ppa000697mg [Prunus persica]
Length=1031

 Score =   155 bits (393),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 116/144 (81%), Gaps = 4/144 (3%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSI-QDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            EN + Q + S+   +  QDIE  K   + A  ++VT SEEK  DEEPLVYA+KQEAKNAF
Sbjct  422  ENVTSQDIGSADDGAFTQDIEEAKRGMAVAGKVNVTPSEEKTVDEEPLVYASKQEAKNAF  481

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            KALLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLE EERR+RQ
Sbjct  482  KALLESANVHSDWTWEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLENEERRMRQ  541

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            +KA+EEF+KMLEESKEL S+TRWS
Sbjct  542  KKAREEFSKMLEESKELMSATRWS  565


 Score = 98.6 bits (244),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA ED+++N  EYR FLE+C FI
Sbjct  567  AVSMFENDERFKAVERARDREDLYESYIVELERKEKEKAAEDHKQNIAEYRKFLESCDFI  626

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  627  KVNSQWRKVQDRL  639



>ref|XP_009361094.1| PREDICTED: pre-mRNA-processing protein 40A [Pyrus x bretschneideri]
Length=1023

 Score =   151 bits (381),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 113/144 (78%), Gaps = 9/144 (6%)
 Frame = +3

Query  18   QVVASSGVSS------IQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            + VAS  +SS       QDIE  K   + A  ++VT SEEK  D+EPLVYA KQEAK AF
Sbjct  414  ETVASQDISSSADGTLTQDIEEAKRGMAVAGKVNVTPSEEKTFDDEPLVYANKQEAKTAF  473

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            K+LLESANV SDWTW+QT+R I  DKRYGAL+  GERKQAFNEYL QRKKLE EERR+RQ
Sbjct  474  KSLLESANVQSDWTWEQTMREIITDKRYGALRTLGERKQAFNEYLGQRKKLENEERRMRQ  533

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            +KA+EEFTKMLEESKELTS+TRWS
Sbjct  534  KKAREEFTKMLEESKELTSATRWS  557


 Score =   102 bits (254),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA ED+++N VEYR FLE+C FI
Sbjct  559  AVSMFENDERFKAVERGRDREDLYESYIVELERKEKEKAAEDHKQNIVEYRKFLESCDFI  618

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  619  KVNSQWRKVQDRL  631



>ref|XP_007018441.1| Pre-mRNA-processing protein 40A isoform 6 [Theobroma cacao]
 gb|EOY15666.1| Pre-mRNA-processing protein 40A isoform 6 [Theobroma cacao]
Length=774

 Score =   157 bits (396),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score = 95.9 bits (237),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIKV
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKV  626

Query  604  ---------DTQWRKVQDLL  636
                     ++QWRKVQD L
Sbjct  627  QHFQKRIQANSQWRKVQDRL  646



>gb|KJB63965.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=919

 Score =   151 bits (382),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  386  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  445

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  446  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  505

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  506  KELTSSMRWS  515


 Score =   101 bits (251),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  519  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  578

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  579  NSQWRKVQDRL  589



>ref|XP_007018439.1| Pre-mRNA-processing protein 40A isoform 4 [Theobroma cacao]
 gb|EOY15664.1| Pre-mRNA-processing protein 40A isoform 4 [Theobroma cacao]
Length=844

 Score =   156 bits (395),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score = 96.3 bits (238),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIKV
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKV  626

Query  604  ---------DTQWRKVQDLL  636
                     ++QWRKVQD L
Sbjct  627  QHFQKRIQANSQWRKVQDRL  646



>ref|XP_010664484.1| PREDICTED: pre-mRNA-processing protein 40A [Vitis vinifera]
 emb|CBI19367.3| unnamed protein product [Vitis vinifera]
Length=1030

 Score =   148 bits (374),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 108/130 (83%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S+QDIE  K   + A  I+VT  EEK  D+EPLVY+TK EAKNAFKALLESANV SDWT
Sbjct  432  ASMQDIEEAKKGVAVAGKINVTPLEEKTLDDEPLVYSTKLEAKNAFKALLESANVESDWT  491

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ ++AI NDKRYGALK  GERKQAFNEYL QRKK+EAEERR+RQ+KA+EEFT MLEE 
Sbjct  492  WDQAMKAIINDKRYGALKTLGERKQAFNEYLGQRKKIEAEERRMRQKKAREEFTTMLEEC  551

Query  393  KELTSSTRWS  422
            KELTSS +WS
Sbjct  552  KELTSSIKWS  561


 Score =   103 bits (258),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +F+DDERFKAVER  DREDLF N++++LQKKE+ KA E+ +RNR+EYR FLE+C FI
Sbjct  563  AVDMFQDDERFKAVERSRDREDLFENFIMELQKKERTKALEEQKRNRMEYRQFLESCDFI  622

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  623  KVNSQWRKVQDRL  635



>ref|XP_010105833.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
 gb|EXC51391.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
Length=994

 Score =   150 bits (379),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +3

Query  21   VVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            + +S   +SI DIE  K   + A  I+VT  EEK  D+EPLV+A KQEAKNAFK+LLESA
Sbjct  390  IASSVDGASILDIEEAKKGMAVAGKINVTPVEEKPVDDEPLVFANKQEAKNAFKSLLESA  449

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            NV SDWTW+Q +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEF
Sbjct  450  NVQSDWTWEQAMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEF  509

Query  372  TKMLEESKELTSSTRWS  422
            T MLEESKELTSSTRWS
Sbjct  510  TIMLEESKELTSSTRWS  526


 Score =   101 bits (252),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 47/70 (67%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDLF +Y+V+L++KEK KA E++RRN  EYR FLE+C FI
Sbjct  528  AVSMFENDERFKAVERARDREDLFESYIVELERKEKEKAAEEHRRNAAEYRKFLESCDFI  587

Query  598  KVDTQWRKVQ  627
            KV++QWRKVQ
Sbjct  588  KVNSQWRKVQ  597



>ref|XP_008808868.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008808869.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008808870.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Phoenix 
dactylifera]
Length=1051

 Score =   146 bits (369),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QD+E  K        ++VT  EEK  DEEPLVY+ KQEAK AFKALLESANV SDWT
Sbjct  445  ASAQDLEEAKKAMPVTGRVNVTPLEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWT  504

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE 
Sbjct  505  WEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEEC  564

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  565  KELTSSTRWS  574


 Score =   105 bits (262),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YLVDLQKKE+AKA E+++RN +EYR FLE+C FI
Sbjct  576  AVTMFENDERFHAVERARDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRTFLESCDFI  635

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  636  KANTQWRKVQDRL  648



>ref|XP_007018440.1| Pre-mRNA-processing protein 40A isoform 5 [Theobroma cacao]
 gb|EOY15665.1| Pre-mRNA-processing protein 40A isoform 5 [Theobroma cacao]
Length=904

 Score =   156 bits (394),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score = 95.1 bits (235),  Expect(2) = 7e-58, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIKV
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKV  626

Query  604  ---------DTQWRKVQDLL  636
                     ++QWRKVQD L
Sbjct  627  QHFQKRIQANSQWRKVQDRL  646



>ref|XP_009350341.1| PREDICTED: pre-mRNA-processing protein 40A-like [Pyrus x bretschneideri]
Length=1014

 Score =   151 bits (381),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 113/144 (78%), Gaps = 9/144 (6%)
 Frame = +3

Query  18   QVVASSGVSS------IQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            + VAS  ++S       QDIE  K   + A  ++VT SEEK  D+EPLVYA KQEAK AF
Sbjct  412  ETVASQDIASSADGILTQDIEEAKRGMAVAGKVNVTPSEEKTFDDEPLVYANKQEAKTAF  471

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            K+LLESANV SDWTW+QT+R I NDKRYG LK  GERKQAFNEYL QRKKLE EERR+RQ
Sbjct  472  KSLLESANVQSDWTWEQTMREIINDKRYGGLKTLGERKQAFNEYLGQRKKLENEERRMRQ  531

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            +KA+EEFTKMLEES+ELTS+TRWS
Sbjct  532  KKAREEFTKMLEESRELTSATRWS  555


 Score = 99.8 bits (247),  Expect(2) = 8e-58, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA E++++N VEYR FLE+C FI
Sbjct  557  AVSVFENDERFKAVERARDREDLYESYIVELERKEKQKAAEEHKQNIVEYRKFLESCDFI  616

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  617  KVNSQWRKVQDRL  629



>ref|XP_010918635.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Elaeis 
guineensis]
Length=1048

 Score =   147 bits (370),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QD+E  K        ++VT  EEK  DEEPLVY+ KQEAK AFKALLESANV SDWT
Sbjct  446  ASAQDLEEAKKAMPVTGKVNVTPMEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWT  505

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE 
Sbjct  506  WEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEEC  565

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  566  KELTSSTRWS  575


 Score =   104 bits (259),  Expect(2) = 8e-58, Method: Composition-based stats.
 Identities = 51/71 (72%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            T+FE+DERF AVER  DREDLF +YLVDLQKKE+AKA E+++RN +EYR FLE+C FIK 
Sbjct  579  TMFENDERFHAVERPRDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRAFLESCDFIKA  638

Query  604  DTQWRKVQDLL  636
            +TQWRKVQD L
Sbjct  639  NTQWRKVQDRL  649



>gb|KJB63964.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=802

 Score =   150 bits (380),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  204  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  263

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  264  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  323

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  324  KELTSSMRWS  333


 Score = 99.8 bits (247),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  337  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  396

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  397  NSQWRKVQDRL  407



>ref|XP_008808871.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Phoenix 
dactylifera]
Length=1021

 Score =   146 bits (368),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QD+E  K        ++VT  EEK  DEEPLVY+ KQEAK AFKALLESANV SDWT
Sbjct  415  ASAQDLEEAKKAMPVTGRVNVTPLEEKTIDEEPLVYSNKQEAKAAFKALLESANVESDWT  474

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE 
Sbjct  475  WEQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEEC  534

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  535  KELTSSTRWS  544


 Score =   103 bits (258),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 52/73 (71%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YLVDLQKKE+AKA E+++RN +EYR FLE+C FI
Sbjct  546  AVTMFENDERFHAVERARDREDLFESYLVDLQKKERAKAAEEHKRNIMEYRTFLESCDFI  605

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  606  KANTQWRKVQDRL  618



>ref|XP_008452677.1| PREDICTED: pre-mRNA-processing protein 40A [Cucumis melo]
Length=985

 Score =   148 bits (374),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +DIE  +   + A  ++ TV EEK+AD+EPLV+A KQEAKNAFKALLES NV SDWT
Sbjct  392  TSTEDIEEARKGMAVAGKVNETVLEEKSADDEPLVFANKQEAKNAFKALLESVNVQSDWT  451

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAF+EYL  RKKL+AEERR+RQ+KA+EEFTKMLEES
Sbjct  452  WEQAMREIINDKRYGALKTLGERKQAFHEYLGHRKKLDAEERRIRQKKAREEFTKMLEES  511

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  512  KELTSSTRWS  521


 Score =   101 bits (251),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDLF +Y+V+L++KEK +A E++++N  EYR FLE+C +I
Sbjct  523  AVSMFENDERFKAVERSRDREDLFESYIVELERKEKERAAEEHKKNIAEYRKFLESCDYI  582

Query  598  KVDTQWRKVQDLL  636
            KV +QWRKVQD L
Sbjct  583  KVSSQWRKVQDRL  595



>gb|KJB63963.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=654

 Score =   150 bits (380),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  56   ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  115

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  116  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  175

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  176  KELTSSMRWS  185


 Score = 99.4 bits (246),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  189  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  248

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  249  NSQWRKVQDRL  259



>gb|KJB63969.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=1026

 Score =   151 bits (382),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  428  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  487

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  488  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  547

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  548  KELTSSMRWS  557


 Score = 98.2 bits (243),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  561  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  620

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  621  NSQWRKVQDRL  631



>ref|XP_008365587.1| PREDICTED: pre-mRNA-processing protein 40A-like [Malus domestica]
Length=1019

 Score =   150 bits (379),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 111/140 (79%), Gaps = 5/140 (4%)
 Frame = +3

Query  18   QVVASSGVSSI--QDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALL  182
            Q +ASS       QDIE  K   + A  ++VT SEEK  D+EPLVYA KQEAK AFK+LL
Sbjct  417  QDIASSAADGTLTQDIEEAKRGMAVAGKVNVTPSEEKTFDDEPLVYANKQEAKTAFKSLL  476

Query  183  ESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkak  362
            ESANV SDWTW+QT+R I  DKRYGALK  GERKQAFNEYL QRKKLE EERR+RQ+KA+
Sbjct  477  ESANVQSDWTWEQTMREIITDKRYGALKTLGERKQAFNEYLGQRKKLENEERRMRQKKAR  536

Query  363  eeFTKMLEESKELTSSTRWS  422
            EEFTKMLEES+ELTS+TRWS
Sbjct  537  EEFTKMLEESRELTSATRWS  556


 Score = 99.4 bits (246),  Expect(2) = 2e-57, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA E++++N VEYR FLE+C FI
Sbjct  558  AVSMFENDERFKAVERARDREDLYESYIVELERKEKQKAAEEHKQNIVEYRKFLESCDFI  617

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  618  KVNSQWRKVQDRL  630



>gb|KJB63966.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=983

 Score =   151 bits (382),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  385  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  444

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  445  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  504

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  505  KELTSSMRWS  514


 Score = 97.8 bits (242),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  518  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  577

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  578  NSQWRKVQDRL  588



>gb|KJB63968.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=984

 Score =   151 bits (382),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  386  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  445

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  446  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  505

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  506  KELTSSMRWS  515


 Score = 97.4 bits (241),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+VDL++KE+  A E+ RRN  EYR FLE+C FIK 
Sbjct  519  SLFENDERFKAVERARDREDLFENYIVDLERKEREYAAEEKRRNIAEYRKFLESCDFIKA  578

Query  604  DTQWRKVQDLL  636
            ++QWRKVQD L
Sbjct  579  NSQWRKVQDRL  589



>ref|XP_002510055.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52242.1| protein binding protein, putative [Ricinus communis]
Length=970

 Score =   144 bits (364),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 9/142 (6%)
 Frame = +3

Query  24   VASSGVS------SIQDIE-MKKSTATNIH--VTVSEEKAADEEPLVYATKQEAKNAFKA  176
            VAS G +      SIQ+ E +KK +  +I     ++EEK  D+EPL +A+KQEAKNAFKA
Sbjct  360  VASKGAAPSVDGASIQNSEEVKKGSGVSIKSDANLTEEKNLDDEPLTFASKQEAKNAFKA  419

Query  177  LLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrk  356
            LLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYL QRKK+EAEERR+RQ++
Sbjct  420  LLESANVQSDWTWEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKIEAEERRMRQKR  479

Query  357  akeeFTKMLEESKELTSSTRWS  422
            A+EEFTKMLEESKELTSS +WS
Sbjct  480  AREEFTKMLEESKELTSSMKWS  501


 Score =   103 bits (258),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVE+  DREDLF NY+V+L++KE+ KA ED+RRN  E++ FLE+C FI
Sbjct  503  AVSLFENDERFKAVEKARDREDLFDNYIVELERKEREKAAEDHRRNVTEFKKFLESCDFI  562

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  563  KVNSQWRKVQDRL  575



>ref|XP_007018438.1| Pre-mRNA-processing protein 40A isoform 3 [Theobroma cacao]
 gb|EOY15663.1| Pre-mRNA-processing protein 40A isoform 3 [Theobroma cacao]
Length=1041

 Score =   156 bits (395),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 110/130 (85%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  ++VT  EEK  D+EPLVYA KQEAKNAFK+LLESANV SDWT
Sbjct  434  ASAQDIEEAKKGMATAGKVNVTPVEEKVPDDEPLVYANKQEAKNAFKSLLESANVQSDWT  493

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  494  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  553

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  554  KELTSSMRWS  563


 Score = 91.7 bits (226),  Expect(2) = 7e-57, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 9/80 (11%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER  DREDLF NY+V+L++KE+  A E+ RRN  EYR FLE+C FIKV
Sbjct  567  SLFENDERFKAVERARDREDLFENYIVELERKERENAAEEKRRNIAEYRKFLESCDFIKV  626

Query  604  ---------DTQWRKVQDLL  636
                     ++QWRKVQD L
Sbjct  627  QHFQKRIQANSQWRKVQDRL  646



>ref|XP_009418171.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1037

 Score =   147 bits (370),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   IQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTV  227
            +++++     A  I VT  EEK  DEEPLVYA K EAKNAFK+LLES+NV SDWTW+QT+
Sbjct  446  LEEVKKAMPVAGKISVTAVEEKTVDEEPLVYANKLEAKNAFKSLLESSNVESDWTWEQTM  505

Query  228  RAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTS  407
            R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE KELTS
Sbjct  506  RVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEECKELTS  565

Query  408  STRWS  422
            +TRWS
Sbjct  566  TTRWS  570


 Score =   100 bits (250),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF +YLV+LQKKE+AKA ED+++  +EYR FLE+C FI
Sbjct  572  AITMFEDDERFSAVERPREREDLFESYLVELQKKERAKAAEDHKKYILEYRAFLESCDFI  631

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  632  KANSQWRKVQDRL  644



>ref|XP_010110128.1| hypothetical protein L484_003757 [Morus notabilis]
 gb|EXC25269.1| hypothetical protein L484_003757 [Morus notabilis]
Length=586

 Score =   145 bits (367),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKR  251
            + A  I+VT  EEK  D+EPLV+A KQEAKNAFK+LLESANV SDWTW+Q +R I NDKR
Sbjct  2    AVAGKINVTPVEEKPVDDEPLVFANKQEAKNAFKSLLESANVQSDWTWEQAMREIINDKR  61

Query  252  YGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            YGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFT MLEESKELTSSTRWS
Sbjct  62   YGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTIMLEESKELTSSTRWS  118


 Score =   101 bits (252),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDLF +Y+V+L++KEK KA E++RRN  EYR FLE+C FI
Sbjct  120  AVSMFENDERFKAVERARDREDLFESYIVELERKEKEKAAEEHRRNAAEYRKFLESCDFI  179

Query  598  KVDTQWRKVQ  627
            KV++QWRKVQ
Sbjct  180  KVNSQWRKVQ  189



>ref|XP_009418172.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1013

 Score =   147 bits (370),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  48   IQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTV  227
            +++++     A  I VT  EEK  DEEPLVYA K EAKNAFK+LLES+NV SDWTW+QT+
Sbjct  418  LEEVKKAMPVAGKISVTAVEEKTVDEEPLVYANKLEAKNAFKSLLESSNVESDWTWEQTM  477

Query  228  RAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTS  407
            R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KA+E+FT+MLEE KELTS
Sbjct  478  RVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAREDFTRMLEECKELTS  537

Query  408  STRWS  422
            +TRWS
Sbjct  538  TTRWS  542


 Score = 99.8 bits (247),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF +YLV+LQKKE+AKA ED+++  +EYR FLE+C FI
Sbjct  544  AITMFEDDERFSAVERPREREDLFESYLVELQKKERAKAAEDHKKYILEYRAFLESCDFI  603

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  604  KANSQWRKVQDRL  616



>gb|KDP41586.1| hypothetical protein JCGZ_15993 [Jatropha curcas]
Length=1008

 Score =   149 bits (376),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 115/145 (79%), Gaps = 5/145 (3%)
 Frame = +3

Query  3    ENSSPQVVASS--GVSSI---QDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNA  167
            +N +PQV A+S  G S +   Q+++ +   A      V EEKAAD+EPLV+ATK EAKNA
Sbjct  393  DNLAPQVAANSVDGASMLESEQEMKQRMEVAGKSDADVLEEKAADDEPLVFATKLEAKNA  452

Query  168  FKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlr  347
            FKALLESANV SDWTW+Q +R I NDKRYGALK  GERKQAFNEYL QRKK+EAEERR+R
Sbjct  453  FKALLESANVQSDWTWEQAMREIVNDKRYGALKTLGERKQAFNEYLGQRKKIEAEERRMR  512

Query  348  qrkakeeFTKMLEESKELTSSTRWS  422
            Q++A+EEFTKMLEES ELTSS +WS
Sbjct  513  QKRAREEFTKMLEESNELTSSMKWS  537


 Score = 97.4 bits (241),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE DERFKAVE+  DR+DLF NY+ +L +KEK KA+ED+RRN+ EY+ FLE+C FI
Sbjct  539  AVSLFESDERFKAVEKARDRQDLFNNYMEELARKEKEKAEEDHRRNKAEYKKFLESCDFI  598

Query  598  KVDTQWRKVQDLL  636
            KV+++W+KVQD L
Sbjct  599  KVNSRWQKVQDRL  611



>ref|XP_004141297.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cucumis sativus]
 gb|KGN55293.1| hypothetical protein Csa_4G644700 [Cucumis sativus]
Length=985

 Score =   148 bits (374),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +DIE  +   + A  ++ TV EEK+AD+EPLV+A KQEAKNAFKALLES NV SDWT
Sbjct  392  TSTEDIEEARKGMAVAGKVNETVLEEKSADDEPLVFANKQEAKNAFKALLESVNVQSDWT  451

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRYGALK  GERKQAF+EYL  RKKL+AEERR+RQ+KA+EEFTKMLEES
Sbjct  452  WEQAMREIINDKRYGALKTLGERKQAFHEYLGHRKKLDAEERRIRQKKAREEFTKMLEES  511

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  512  KELTSSTRWS  521


 Score = 96.7 bits (239),  Expect(2) = 5e-56, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDLF +Y+V+L++KEK +A E++++N  EYR FLE+C +I
Sbjct  523  AVSMFENDERFKAVERSRDREDLFESYIVELERKEKERAAEEHKKNIAEYRKFLESCDYI  582

Query  598  KVDTQWRKVQDLL  636
            KV +QWRKVQD L
Sbjct  583  KVSSQWRKVQDRL  595



>ref|XP_004956604.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Setaria 
italica]
 ref|XP_004956605.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Setaria 
italica]
 ref|XP_004956606.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Setaria 
italica]
 ref|XP_004956607.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Setaria 
italica]
Length=983

 Score =   144 bits (364),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +D+E  K T   A  I+VT  EEK ++EEP+VYATK EAKNAFK+LLES NV SDWT
Sbjct  385  TSAEDLEEAKKTMPVAGKINVTPLEEKTSEEEPVVYATKTEAKNAFKSLLESVNVESDWT  444

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKK EAEE+R++QRKA+++F  MLEE 
Sbjct  445  WEQTMRVIINDKRYGALKTLGERKQAFNEYLNQRKKFEAEEKRIKQRKARDDFLAMLEEC  504

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  505  KELTSSTRWS  514


 Score =   100 bits (249),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             + +F+DDERFKAVER  +REDLF  YLV+L KKEKAKA E++RR+  EY+ FLE+C FI
Sbjct  516  AILMFDDDERFKAVERPREREDLFEGYLVELHKKEKAKAIEEHRRHVAEYKAFLESCDFI  575

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQ+ L
Sbjct  576  KATTQWRKVQERL  588



>ref|XP_006644254.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Oryza 
brachyantha]
Length=865

 Score =   140 bits (352),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S  D+E  K T      I+VT  E+K ++EEP++YA K EAKNAFKALLES+NV SDWT
Sbjct  267  ASADDLEEAKKTMPLPGKINVTPVEDKTSEEEPVIYANKLEAKNAFKALLESSNVESDWT  326

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR++QRKA+++F  MLEE 
Sbjct  327  WDQAMRVIINDKRYGALKTLGERKQAFNEYLNQRKKLEAEERRVKQRKARDDFLAMLEEC  386

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  387  KELTSSTRWS  396


 Score =   102 bits (255),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDD+RF AVER  +REDLF NYL++LQKKE+A+A E+++++  EYR FLE+C FI
Sbjct  398  AITMFEDDKRFSAVERPREREDLFENYLMELQKKERARAAEEHKKHIAEYRAFLESCEFI  457

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  458  KANTQWRKVQDRL  470


 Score = 37.7 bits (86),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             EDDER   +E+  DR ++F+ Y+ DL+K+E       K K +   R+NR E+R  LE  
Sbjct  470  LEDDERCSRLEK-IDRLEIFQEYIRDLEKEEEEHKRIHKEKIRRQERKNRDEFRKMLEEH  528

Query  583  -TCGFIKVDTQWR  618
               G +   T+WR
Sbjct  529  AAEGMLNAKTRWR  541


 Score = 36.2 bits (82),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +3

Query  147  KQEAKNAFKALLESAN-VGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            +++A++ F A+LE    + S   W + +    +DKR+ A++   ER+  F  YLM+ +K 
Sbjct  372  QRKARDDFLAMLEECKELTSSTRWSKAITMFEDDKRFSAVERPREREDLFENYLMELQKK  431

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E        +K   E+   LE  + + ++T+W
Sbjct  432  ERARAAEEHKKHIAEYRAFLESCEFIKANTQW  463



>ref|XP_006644253.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Oryza 
brachyantha]
Length=866

 Score =   140 bits (352),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S  D+E  K T      I+VT  E+K ++EEP++YA K EAKNAFKALLES+NV SDWT
Sbjct  268  ASADDLEEAKKTMPLPGKINVTPVEDKTSEEEPVIYANKLEAKNAFKALLESSNVESDWT  327

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR++QRKA+++F  MLEE 
Sbjct  328  WDQAMRVIINDKRYGALKTLGERKQAFNEYLNQRKKLEAEERRVKQRKARDDFLAMLEEC  387

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  388  KELTSSTRWS  397


 Score =   102 bits (255),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDD+RF AVER  +REDLF NYL++LQKKE+A+A E+++++  EYR FLE+C FI
Sbjct  399  AITMFEDDKRFSAVERPREREDLFENYLMELQKKERARAAEEHKKHIAEYRAFLESCEFI  458

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  459  KANTQWRKVQDRL  471


 Score = 37.7 bits (86),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             EDDER   +E+  DR ++F+ Y+ DL+K+E       K K +   R+NR E+R  LE  
Sbjct  471  LEDDERCSRLEK-IDRLEIFQEYIRDLEKEEEEHKRIHKEKIRRQERKNRDEFRKMLEEH  529

Query  583  -TCGFIKVDTQWR  618
               G +   T+WR
Sbjct  530  AAEGMLNAKTRWR  542


 Score = 36.2 bits (82),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +3

Query  147  KQEAKNAFKALLESAN-VGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            +++A++ F A+LE    + S   W + +    +DKR+ A++   ER+  F  YLM+ +K 
Sbjct  373  QRKARDDFLAMLEECKELTSSTRWSKAITMFEDDKRFSAVERPREREDLFENYLMELQKK  432

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E        +K   E+   LE  + + ++T+W
Sbjct  433  ERARAAEEHKKHIAEYRAFLESCEFIKANTQW  464



>ref|XP_006644255.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Oryza 
brachyantha]
Length=840

 Score =   140 bits (352),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S  D+E  K T      I+VT  E+K ++EEP++YA K EAKNAFKALLES+NV SDWT
Sbjct  242  ASADDLEEAKKTMPLPGKINVTPVEDKTSEEEPVIYANKLEAKNAFKALLESSNVESDWT  301

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR++QRKA+++F  MLEE 
Sbjct  302  WDQAMRVIINDKRYGALKTLGERKQAFNEYLNQRKKLEAEERRVKQRKARDDFLAMLEEC  361

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  362  KELTSSTRWS  371


 Score =   102 bits (254),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDD+RF AVER  +REDLF NYL++LQKKE+A+A E+++++  EYR FLE+C FI
Sbjct  373  AITMFEDDKRFSAVERPREREDLFENYLMELQKKERARAAEEHKKHIAEYRAFLESCEFI  432

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  433  KANTQWRKVQDRL  445


 Score = 37.4 bits (85),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             EDDER   +E+  DR ++F+ Y+ DL+K+E       K K +   R+NR E+R  LE  
Sbjct  445  LEDDERCSRLEK-IDRLEIFQEYIRDLEKEEEEHKRIHKEKIRRQERKNRDEFRKMLEEH  503

Query  583  -TCGFIKVDTQWR  618
               G +   T+WR
Sbjct  504  AAEGMLNAKTRWR  516


 Score = 36.2 bits (82),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +3

Query  147  KQEAKNAFKALLESAN-VGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            +++A++ F A+LE    + S   W + +    +DKR+ A++   ER+  F  YLM+ +K 
Sbjct  347  QRKARDDFLAMLEECKELTSSTRWSKAITMFEDDKRFSAVERPREREDLFENYLMELQKK  406

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E        +K   E+   LE  + + ++T+W
Sbjct  407  ERARAAEEHKKHIAEYRAFLESCEFIKANTQW  438



>gb|KHN17176.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1002

 Score =   142 bits (359),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 109/143 (76%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN + Q  AS+  SS+QDIE  K     +   +VT  EEK  D+E LVYA K EAKNAFK
Sbjct  394  ENQASQDFASANGSSLQDIEEAKRPLPVVGKNNVTPPEEKTNDDETLVYANKLEAKNAFK  453

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLES +V SDWTW+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+
Sbjct  454  ALLESVSVQSDWTWEQAMREIINDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRMKQK  513

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            +A+EEFTKMLEE KELTSS RWS
Sbjct  514  RAREEFTKMLEECKELTSSMRWS  536


 Score = 98.6 bits (244),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERF AVER  DREDLF +Y+V+L++KEK  A E++RRN  EYR FLE+C ++
Sbjct  538  AISMFENDERFNAVERPRDREDLFESYMVELERKEKENAAEEHRRNIAEYRKFLESCDYV  597

Query  598  KVDTQWRKVQDLL  636
            KV++ WRK+QD L
Sbjct  598  KVNSPWRKIQDRL  610



>ref|XP_008337025.1| PREDICTED: pre-mRNA-processing protein 40A-like [Malus domestica]
Length=1085

 Score =   145 bits (367),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 110/144 (76%), Gaps = 9/144 (6%)
 Frame = +3

Query  18   QVVASSGVSS------IQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAF  170
            + VAS  +S        QDIE  K   + A  ++VT SEEK  D+EPLVYA KQEAK AF
Sbjct  449  ETVASQDISXSADGTLTQDIEEAKRGMAVAGKVNVTPSEEKTFDDEPLVYAXKQEAKTAF  508

Query  171  KALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrq  350
            K+LLESANV SDWTW+QT+R I  DKRYGAL+  GERKQAFNEYL QRKKLE EERR RQ
Sbjct  509  KSLLESANVQSDWTWEQTMREIITDKRYGALRTLGERKQAFNEYLGQRKKLENEERRXRQ  568

Query  351  rkakeeFTKMLEESKELTSSTRWS  422
            +KA+EEFTKMLEESKELTS+T WS
Sbjct  569  KKAREEFTKMLEESKELTSATXWS  592


 Score = 94.7 bits (234),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+D RFKAVER  D EDL+ +Y+V+L++KEK KA ED+++N VEYR  LE+C FI
Sbjct  594  AVSMFENDXRFKAVERGRDXEDLYESYIVELERKEKEKAAEDHKQNIVEYRKXLESCDFI  653

Query  598  KVDTQWRKVQDLL  636
            KV++QWRKVQD L
Sbjct  654  KVNSQWRKVQDRL  666



>ref|XP_010999910.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Populus 
euphratica]
Length=861

 Score =   137 bits (346),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 101/122 (83%), Gaps = 5/122 (4%)
 Frame = +3

Query  57   IEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAI  236
            ++M K+ A+ +     EEK  DEEPLV+A K EAKNAFKALLESANV SDWTW+QT+R I
Sbjct  420  MDMGKTNASPL-----EEKTPDEEPLVFANKLEAKNAFKALLESANVQSDWTWEQTMREI  474

Query  237  ANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTR  416
             NDKRY ALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEF KMLEESKELTSS +
Sbjct  475  INDKRYAALKTLGERKQAFNEYLGQRKKLEAEERRVRQKKAREEFAKMLEESKELTSSMK  534

Query  417  WS  422
            WS
Sbjct  535  WS  536


 Score =   102 bits (254),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DER+KA+ER  DREDLF +Y+V+L++KEK KA ED RRN  EYR FLE+C FI
Sbjct  538  AISLFENDERYKALERARDREDLFDSYIVELERKEKEKAAEDRRRNVAEYRKFLESCDFI  597

Query  598  KVDTQWRKVQDLL  636
            K ++QWRK+QD L
Sbjct  598  KANSQWRKIQDRL  610



>ref|XP_004169188.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like, 
partial [Cucumis sativus]
Length=803

 Score =   139 bits (351),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +K+AD+EPLV+A KQEAKNAFKALLES NV SDWTW+Q +R I NDKRYGALK  GERKQ
Sbjct  235  QKSADDEPLVFANKQEAKNAFKALLESVNVQSDWTWEQAMREIINDKRYGALKTLGERKQ  294

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AF+EYL  RKKL+AEERR+RQ+KA+EEFTKMLEESKELTSSTRWS
Sbjct  295  AFHEYLGHRKKLDAEERRIRQKKAREEFTKMLEESKELTSSTRWS  339


 Score =   100 bits (249),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDLF +Y+V+L++KEK +A E++++N  EYR FLE+C +I
Sbjct  341  AVSMFENDERFKAVERSRDREDLFESYIVELERKEKERAAEEHKKNIAEYRKFLESCDYI  400

Query  598  KVDTQWRKVQDLL  636
            KV +QWRKVQD L
Sbjct  401  KVSSQWRKVQDRL  413



>gb|EPS62863.1| hypothetical protein M569_11923, partial [Genlisea aurea]
Length=580

 Score =   138 bits (347),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 2/131 (2%)
 Frame = +3

Query  36   GVSSIQDIEMKKST--ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDW  209
            G  ++ D   KK T  A    +   EE+  D+EP++Y+TKQEAKN FK+LLES NVG+DW
Sbjct  339  GDVTLDDENPKKGTPEAGRTDIAPQEERDVDDEPILYSTKQEAKNVFKSLLESTNVGADW  398

Query  210  TWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEE  389
            +WDQ +R I  DKRYGALK  GERKQ FNEY+MQRKK+EAEE+RL+QR AK++F KMLEE
Sbjct  399  SWDQAMRVIIGDKRYGALKTLGERKQTFNEYIMQRKKVEAEEKRLKQRIAKKDFVKMLEE  458

Query  390  SKELTSSTRWS  422
            S+ELTSSTRWS
Sbjct  459  SEELTSSTRWS  469


 Score =   101 bits (252),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FEDDERFKAV+ EADR+DLFRNYLVDLQKKEK KA+E+Y+ N++++R +LE+C  I
Sbjct  471  AVSMFEDDERFKAVDHEADRQDLFRNYLVDLQKKEKVKAEEEYQHNKLKFRKYLESCDII  530

Query  598  KVDTQWRKVQDLL  636
            KVD+QWRKVQDL+
Sbjct  531  KVDSQWRKVQDLM  543



>ref|XP_006827042.1| hypothetical protein AMTR_s00010p00227470 [Amborella trichopoda]
 gb|ERM94279.1| hypothetical protein AMTR_s00010p00227470 [Amborella trichopoda]
Length=985

 Score =   143 bits (360),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 114/145 (79%), Gaps = 5/145 (3%)
 Frame = +3

Query  3    ENSSPQVVAS-SGVSSIQDIEMKK---STATNIHVT-VSEEKAADEEPLVYATKQEAKNA  167
            +N SP+ +A  +  +S QD+E  +     A  +++T  S+EK  DEEPLV+A+KQEAKNA
Sbjct  375  DNVSPESIAQVADETSAQDLEEARKAMPVAGKVNITPTSDEKTVDEEPLVFASKQEAKNA  434

Query  168  FKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlr  347
            FK LL SA+V SDWTWDQ +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEE+R R
Sbjct  435  FKELLVSAHVESDWTWDQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEEKRTR  494

Query  348  qrkakeeFTKMLEESKELTSSTRWS  422
            Q+KA+E+F KMLEESKELTS+T+WS
Sbjct  495  QKKAREDFVKMLEESKELTSATKWS  519


 Score = 96.3 bits (238),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF+AVER  DRE+LF  +L +L +KE+AKAQE++RRN  EYR FLE+C FI
Sbjct  521  AITMFEDDERFRAVERGRDREELFEMHLEELHRKERAKAQEEHRRNVQEYRAFLESCDFI  580

Query  598  KVDTQWRKVQDLL  636
            K  +QWRKVQD L
Sbjct  581  KASSQWRKVQDRL  593



>ref|XP_006595998.1| PREDICTED: pre-mRNA-processing protein 40A-like [Glycine max]
Length=997

 Score =   142 bits (359),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 109/143 (76%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN + Q  AS+  SS+QDIE  K     +   +VT  EEK  D+E LVYA K EAKNAFK
Sbjct  389  ENQASQDFASANGSSLQDIEEAKRPLPVVGKNNVTPPEEKTNDDETLVYANKLEAKNAFK  448

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLES +V SDWTW+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+
Sbjct  449  ALLESVSVQSDWTWEQAMREIINDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRMKQK  508

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            +A+EEFTKMLEE KELTSS RWS
Sbjct  509  RAREEFTKMLEECKELTSSMRWS  531


 Score = 96.7 bits (239),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERF AVER  DREDLF +Y+V+L++KEK  A E++R+N  EYR FLE+C ++
Sbjct  533  AISMFENDERFNAVERPRDREDLFESYMVELERKEKENAAEEHRQNIAEYRKFLESCDYV  592

Query  598  KVDTQWRKVQDLL  636
            KV++ WRK+QD L
Sbjct  593  KVNSPWRKIQDRL  605



>ref|XP_007160939.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
 gb|ESW32933.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
Length=887

 Score =   141 bits (356),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN + Q  AS+  SS QDIE  K     +   +V   EEK  D+E LVYA K EAKNAFK
Sbjct  392  ENQASQDFASANGSSPQDIEEAKKALAEVGKNNVIPPEEKTNDDETLVYANKLEAKNAFK  451

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLES NV SDWTW+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+
Sbjct  452  ALLESVNVQSDWTWEQAMREIINDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRMKQK  511

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            +A+EEFTKMLEE KELTSS RWS
Sbjct  512  RAREEFTKMLEECKELTSSMRWS  534


 Score = 96.7 bits (239),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERF AVER  DREDLF +Y+V+L++KEK  A E++RRN  EYR FLE+C ++
Sbjct  536  AISMFENDERFNAVERPRDREDLFESYMVELERKEKENAAEEHRRNIAEYRKFLESCDYV  595

Query  598  KVDTQWRKVQDLL  636
            KV++ WRK+QD L
Sbjct  596  KVNSHWRKIQDRL  608



>ref|XP_002320019.2| FF domain-containing family protein [Populus trichocarpa]
 gb|EEE98334.2| FF domain-containing family protein [Populus trichocarpa]
Length=1019

 Score =   137 bits (346),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 101/122 (83%), Gaps = 5/122 (4%)
 Frame = +3

Query  57   IEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAI  236
            ++M K+ A+ +     EEK  DEEPLV+A K EAKNAFKALLESANV SDWTW+QT+R I
Sbjct  420  MDMGKTNASPL-----EEKTPDEEPLVFANKLEAKNAFKALLESANVQSDWTWEQTMREI  474

Query  237  ANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTR  416
             NDKRY ALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEF KMLEESKELTSS +
Sbjct  475  INDKRYAALKTLGERKQAFNEYLGQRKKLEAEERRVRQKKAREEFAKMLEESKELTSSMK  534

Query  417  WS  422
            WS
Sbjct  535  WS  536


 Score = 99.4 bits (246),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DER+KA+ER  DREDLF +Y+VDL++KEK KA ED RRN  EYR FLE+C FI
Sbjct  538  AISLFENDERYKALERARDREDLFDSYIVDLERKEKEKAAEDRRRNVAEYRKFLESCDFI  597

Query  598  KVDTQWRKVQDLL  636
            K  +QWRK+QD L
Sbjct  598  KASSQWRKIQDRL  610



>gb|KJB77626.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
Length=764

 Score =   139 bits (351),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVS-EEKAADEEPLVYATKQEAKNAFKALLE  185
            SS  +V+S GVS+    E  K    +  +  + EEKA D+E L YA+KQEAK+AFKALLE
Sbjct  163  SSLDMVSSEGVSTQNADETVKDVVVSEKINNALEEKAIDQESLTYASKQEAKDAFKALLE  222

Query  186  SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkake  365
            SANVGSDWTWDQ +R I NDKRYGAL+  GERKQAFNE+L Q+KK +AEERR++Q+KA+E
Sbjct  223  SANVGSDWTWDQAMRVIINDKRYGALRTLGERKQAFNEFLGQKKKQDAEERRIKQKKARE  282

Query  366  eFTKMLEESKELTSSTRWS  422
            E+ KMLEE  ELTSSTRWS
Sbjct  283  EYKKMLEECLELTSSTRWS  301


 Score = 97.1 bits (240),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DER+KAVERE DR+D F NY+ +L++KE+ KAQE  ++N +EYR FLE+C FI
Sbjct  303  AVTMFENDERYKAVEREKDRKDFFENYIDELRQKERVKAQEQRKQNVMEYRRFLESCDFI  362

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  363  KANSQWRKVQDRL  375



>ref|XP_010999909.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
Length=1019

 Score =   137 bits (346),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 101/122 (83%), Gaps = 5/122 (4%)
 Frame = +3

Query  57   IEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAI  236
            ++M K+ A+ +     EEK  DEEPLV+A K EAKNAFKALLESANV SDWTW+QT+R I
Sbjct  420  MDMGKTNASPL-----EEKTPDEEPLVFANKLEAKNAFKALLESANVQSDWTWEQTMREI  474

Query  237  ANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTR  416
             NDKRY ALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEF KMLEESKELTSS +
Sbjct  475  INDKRYAALKTLGERKQAFNEYLGQRKKLEAEERRVRQKKAREEFAKMLEESKELTSSMK  534

Query  417  WS  422
            WS
Sbjct  535  WS  536


 Score = 99.0 bits (245),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DER+KA+ER  DREDLF +Y+V+L++KEK KA ED RRN  EYR FLE+C FI
Sbjct  538  AISLFENDERYKALERARDREDLFDSYIVELERKEKEKAAEDRRRNVAEYRKFLESCDFI  597

Query  598  KVDTQWRKVQDLL  636
            K ++QWRK+QD L
Sbjct  598  KANSQWRKIQDRL  610



>gb|KJB77624.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
Length=1003

 Score =   139 bits (349),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVS-EEKAADEEPLVYATKQEAKNAFKALLE  185
            SS  +V+S GVS+    E  K    +  +  + EEKA D+E L YA+KQEAK+AFKALLE
Sbjct  393  SSLDMVSSEGVSTQNADETVKDVVVSEKINNALEEKAIDQESLTYASKQEAKDAFKALLE  452

Query  186  SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkake  365
            SANVGSDWTWDQ +R I NDKRYGAL+  GERKQAFNE+L Q+KK +AEERR++Q+KA+E
Sbjct  453  SANVGSDWTWDQAMRVIINDKRYGALRTLGERKQAFNEFLGQKKKQDAEERRIKQKKARE  512

Query  366  eFTKMLEESKELTSSTRWS  422
            E+ KMLEE  ELTSSTRWS
Sbjct  513  EYKKMLEECLELTSSTRWS  531


 Score = 97.8 bits (242),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DER+KAVERE DR+D F NY+ +L++KE+ KAQE  ++N +EYR FLE+C FI
Sbjct  533  AVTMFENDERYKAVEREKDRKDFFENYIDELRQKERVKAQEQRKQNVMEYRRFLESCDFI  592

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  593  KANSQWRKVQDRL  605



>gb|KJB77621.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
 gb|KJB77622.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
 gb|KJB77623.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
 gb|KJB77625.1| hypothetical protein B456_012G147100 [Gossypium raimondii]
Length=994

 Score =   139 bits (349),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVS-EEKAADEEPLVYATKQEAKNAFKALLE  185
            SS  +V+S GVS+    E  K    +  +  + EEKA D+E L YA+KQEAK+AFKALLE
Sbjct  393  SSLDMVSSEGVSTQNADETVKDVVVSEKINNALEEKAIDQESLTYASKQEAKDAFKALLE  452

Query  186  SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkake  365
            SANVGSDWTWDQ +R I NDKRYGAL+  GERKQAFNE+L Q+KK +AEERR++Q+KA+E
Sbjct  453  SANVGSDWTWDQAMRVIINDKRYGALRTLGERKQAFNEFLGQKKKQDAEERRIKQKKARE  512

Query  366  eFTKMLEESKELTSSTRWS  422
            E+ KMLEE  ELTSSTRWS
Sbjct  513  EYKKMLEECLELTSSTRWS  531


 Score = 97.8 bits (242),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DER+KAVERE DR+D F NY+ +L++KE+ KAQE  ++N +EYR FLE+C FI
Sbjct  533  AVTMFENDERYKAVEREKDRKDFFENYIDELRQKERVKAQEQRKQNVMEYRRFLESCDFI  592

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  593  KANSQWRKVQDRL  605



>gb|EEE54732.1| hypothetical protein OsJ_02081 [Oryza sativa Japonica Group]
Length=1002

 Score =   140 bits (353),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTAT--NIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSD  206
            +G S+ +  E KK+ A    I+VT  E+K ++EEP+ YA K EAKNAFKALLES+NV SD
Sbjct  396  NGASAEELEEAKKTMAVPGKINVTPVEDKTSEEEPVTYANKLEAKNAFKALLESSNVESD  455

Query  207  WTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLE  386
            WTWDQ +R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR++QRKA+++F  MLE
Sbjct  456  WTWDQAMRVIINDKRYGALKTLGERKQAFNEYLNQRKKLEAEERRIKQRKARDDFLAMLE  515

Query  387  ESKELTSSTRWS  422
            ESKELTSSTRWS
Sbjct  516  ESKELTSSTRWS  527


 Score = 95.9 bits (237),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF +YL++LQKKE+A+A E+++R+  EYR FLE+C FI
Sbjct  529  AITMFEDDERFSAVERPREREDLFESYLMELQKKERARAAEEHKRHIAEYRAFLESCEFI  588

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQ+ L
Sbjct  589  KTSTQWRKVQERL  601



>ref|XP_007042685.1| Pre-mRNA-processing protein 40B, putative [Theobroma cacao]
 gb|EOX98516.1| Pre-mRNA-processing protein 40B, putative [Theobroma cacao]
Length=1025

 Score =   135 bits (340),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEKA D++PL YA+KQEAKNAFK LLE ANVGSDW+WDQ +R I NDKRYGAL+  GERK
Sbjct  453  EEKAIDQDPLTYASKQEAKNAFKVLLECANVGSDWSWDQAMRVIINDKRYGALRTLGERK  512

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q+KK EAE+RR++Q+KA+EE+  MLEE  ELTSSTRWS
Sbjct  513  QAFNEFLGQKKKQEAEDRRIKQKKAREEYKTMLEECSELTSSTRWS  558


 Score =   100 bits (249),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +FEDDER+KAVERE DR+D+F NY+ +L++KE+ KAQE  +RN VEYR FLE+C FI
Sbjct  560  AVAMFEDDERYKAVEREKDRKDIFENYIDELRQKERVKAQEQRKRNIVEYRQFLESCDFI  619

Query  598  KVDTQWRKVQDLL  636
            K ++QWRK+QD L
Sbjct  620  KANSQWRKLQDRL  632



>gb|KCW68618.1| hypothetical protein EUGRSUZ_F02226 [Eucalyptus grandis]
Length=1010

 Score =   139 bits (351),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S+QDIE  K   + A  ++ T  EEKA ++EP+VY +KQEAKNAFKALLES NV SDWT
Sbjct  412  ASLQDIEEAKRGMAVAGKVNETPVEEKAPEDEPVVYPSKQEAKNAFKALLESVNVQSDWT  471

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I ND+RY ALK  GERKQAFNEYL QR+K+EAEERR+RQ+KAKEEFTKMLEE 
Sbjct  472  WEQTMREIINDRRYSALKTLGERKQAFNEYLGQRRKVEAEERRVRQKKAKEEFTKMLEEC  531

Query  393  KELTSSTRWS  422
             ELTSS +WS
Sbjct  532  TELTSSVKWS  541


 Score = 95.9 bits (237),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKAVER  DREDLF NY+V+L +KEK KA E+++ +  EYR +LE+C FI
Sbjct  543  AVTMFENDERFKAVERNRDREDLFENYMVELGRKEKEKAVEEHKHHVAEYRKYLESCDFI  602

Query  598  KVDTQWRKVQDLL  636
            KV++QWRK+ D L
Sbjct  603  KVNSQWRKIVDRL  615



>ref|XP_010061630.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Eucalyptus 
grandis]
Length=1013

 Score =   140 bits (352),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S+QDIE  K   + A  ++ T  EEKA ++EP+VY +KQEAKNAFKALLES NV SDWT
Sbjct  405  ASLQDIEEAKRGMAVAGKVNETPVEEKAPEDEPVVYPSKQEAKNAFKALLESVNVQSDWT  464

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I ND+RY ALK  GERKQAFNEYL QR+K+EAEERR+RQ+KAKEEFTKMLEE 
Sbjct  465  WEQTMREIINDRRYSALKTLGERKQAFNEYLGQRRKVEAEERRVRQKKAKEEFTKMLEEC  524

Query  393  KELTSSTRWS  422
             ELTSS +WS
Sbjct  525  TELTSSVKWS  534


 Score = 95.9 bits (237),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKAVER  DREDLF NY+V+L +KEK KA E+++ +  EYR +LE+C FI
Sbjct  536  AVTMFENDERFKAVERNRDREDLFENYMVELGRKEKEKAVEEHKHHVAEYRKYLESCDFI  595

Query  598  KVDTQWRKVQDLL  636
            KV++QWRK+ D L
Sbjct  596  KVNSQWRKIVDRL  608



>gb|KCW68619.1| hypothetical protein EUGRSUZ_F02226 [Eucalyptus grandis]
Length=1008

 Score =   139 bits (351),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S+QDIE  K   + A  ++ T  EEKA ++EP+VY +KQEAKNAFKALLES NV SDWT
Sbjct  412  ASLQDIEEAKRGMAVAGKVNETPVEEKAPEDEPVVYPSKQEAKNAFKALLESVNVQSDWT  471

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I ND+RY ALK  GERKQAFNEYL QR+K+EAEERR+RQ+KAKEEFTKMLEE 
Sbjct  472  WEQTMREIINDRRYSALKTLGERKQAFNEYLGQRRKVEAEERRVRQKKAKEEFTKMLEEC  531

Query  393  KELTSSTRWS  422
             ELTSS +WS
Sbjct  532  TELTSSVKWS  541


 Score = 95.9 bits (237),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKAVER  DREDLF NY+V+L +KEK KA E+++ +  EYR +LE+C FI
Sbjct  543  AVTMFENDERFKAVERNRDREDLFENYMVELGRKEKEKAVEEHKHHVAEYRKYLESCDFI  602

Query  598  KVDTQWRKVQDLL  636
            KV++QWRK+ D L
Sbjct  603  KVNSQWRKIVDRL  615



>ref|XP_007160940.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
 gb|ESW32934.1| hypothetical protein PHAVU_001G029800g [Phaseolus vulgaris]
Length=1000

 Score =   142 bits (357),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN + Q  AS+  SS QDIE  K     +   +V   EEK  D+E LVYA K EAKNAFK
Sbjct  392  ENQASQDFASANGSSPQDIEEAKKALAEVGKNNVIPPEEKTNDDETLVYANKLEAKNAFK  451

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLES NV SDWTW+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+
Sbjct  452  ALLESVNVQSDWTWEQAMREIINDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRMKQK  511

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            +A+EEFTKMLEE KELTSS RWS
Sbjct  512  RAREEFTKMLEECKELTSSMRWS  534


 Score = 93.6 bits (231),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERF AVER  DREDLF +Y+V+L++KEK  A E++RRN  EYR FLE+C ++
Sbjct  536  AISMFENDERFNAVERPRDREDLFESYMVELERKEKENAAEEHRRNIAEYRKFLESCDYV  595

Query  598  KVDTQWRKVQDLL  636
            KV++ WRK+QD L
Sbjct  596  KVNSHWRKIQDRL  608



>ref|XP_010061631.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Eucalyptus 
grandis]
Length=1001

 Score =   139 bits (351),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S+QDIE  K   + A  ++ T  EEKA ++EP+VY +KQEAKNAFKALLES NV SDWT
Sbjct  405  ASLQDIEEAKRGMAVAGKVNETPVEEKAPEDEPVVYPSKQEAKNAFKALLESVNVQSDWT  464

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I ND+RY ALK  GERKQAFNEYL QR+K+EAEERR+RQ+KAKEEFTKMLEE 
Sbjct  465  WEQTMREIINDRRYSALKTLGERKQAFNEYLGQRRKVEAEERRVRQKKAKEEFTKMLEEC  524

Query  393  KELTSSTRWS  422
             ELTSS +WS
Sbjct  525  TELTSSVKWS  534


 Score = 95.9 bits (237),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKAVER  DREDLF NY+V+L +KEK KA E+++ +  EYR +LE+C FI
Sbjct  536  AVTMFENDERFKAVERNRDREDLFENYMVELGRKEKEKAVEEHKHHVAEYRKYLESCDFI  595

Query  598  KVDTQWRKVQDLL  636
            KV++QWRK+ D L
Sbjct  596  KVNSQWRKIVDRL  608



>ref|XP_003549369.2| PREDICTED: pre-mRNA-processing protein 40A-like [Glycine max]
 gb|KHN36985.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1008

 Score =   138 bits (348),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN + Q  AS   SS+QDIE  K +   +   +V   EEK  D+E LVYA K EAK AFK
Sbjct  398  ENQASQDFASVNGSSLQDIEEAKRSLPVVGKNNVVPPEEKTNDDETLVYANKLEAKLAFK  457

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLES NV SDWTW+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+
Sbjct  458  ALLESVNVQSDWTWEQAMREIINDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRMKQK  517

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            +A+EEFTKMLEE KELTSS RWS
Sbjct  518  RAREEFTKMLEECKELTSSMRWS  540


 Score = 95.5 bits (236),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERF AVER  DREDLF +Y+V+L++KEK  A E++RRN  EYR FLE+C ++
Sbjct  542  AISMFENDERFNAVERLRDREDLFESYMVELERKEKENAAEEHRRNIAEYRKFLESCDYV  601

Query  598  KVDTQWRKVQDLL  636
            K ++ WRK+QD L
Sbjct  602  KANSHWRKIQDRL  614



>ref|XP_002522113.1| protein binding protein, putative [Ricinus communis]
 gb|EEF40313.1| protein binding protein, putative [Ricinus communis]
Length=956

 Score =   133 bits (334),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 104/145 (72%), Gaps = 15/145 (10%)
 Frame = +3

Query  21   VVASSGVSSIQDIEMKKSTATNIHVTVS-----------EEKAADEEPLVYATKQEAKNA  167
            V+ASS  S+  +++    T  NI  TVS           EEK   +EPL Y  K EAKNA
Sbjct  351  VMASSLTSNSDEVQ----TTENIVSTVSGRSEKVNSIGIEEKIVSQEPLTYTDKLEAKNA  406

Query  168  FKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlr  347
            FKALLESA+VGSDWTWDQ +R I ND+RYGAL+  GERKQAFNEYL Q+KK +AEERR +
Sbjct  407  FKALLESASVGSDWTWDQAMRVIINDRRYGALRTLGERKQAFNEYLSQKKKQDAEERRSK  466

Query  348  qrkakeeFTKMLEESKELTSSTRWS  422
            Q+KA+EEF  MLEESKELTS+ RWS
Sbjct  467  QKKAREEFKNMLEESKELTSTMRWS  491


 Score =   100 bits (249),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKAVERE DR D+F ++L +L  KE+AKAQE+ +RN +EYR FLE+C FI
Sbjct  493  AVTLFENDERFKAVERERDRRDIFDSFLQELGDKERAKAQEERKRNIMEYRQFLESCDFI  552

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  553  KASTQWRKVQDRL  565


 Score = 38.1 bits (87),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 15/82 (18%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +E+  DR ++F++YL DL+K+E       K + ++  R+NR E+R  LE  
Sbjct  565  LEADERCSRLEK-IDRLEIFQDYLRDLEKEEEEQRKIQKEEQRKAERKNRDEFRKLLEEH  623

Query  583  -TCGFIKVDTQWR----KVQDL  633
               G +   T WR    KV+DL
Sbjct  624  VAAGTMTAKTHWRDYYLKVKDL  645


 Score = 35.4 bits (80),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = +3

Query  147  KQEAKNAFKALLE-SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            +++A+  FK +LE S  + S   W + V    ND+R+ A++   +R+  F+ +L +    
Sbjct  467  QKKAREEFKNMLEESKELTSTMRWSKAVTLFENDERFKAVERERDRRDIFDSFLQELGDK  526

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E  + +  +++   E+ + LE    + +ST+W
Sbjct  527  ERAKAQEERKRNIMEYRQFLESCDFIKASTQW  558



>gb|KEH40000.1| pre-mRNA-processing 40A-like protein [Medicago truncatula]
Length=1048

 Score =   135 bits (341),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            + +QD+E  K     +   +VT SEEK  D E  VYA K EAKNAFKALLES NV SDWT
Sbjct  449  TPLQDMEEAKKGVPVVGQTNVTPSEEKTNDGETFVYANKLEAKNAFKALLESVNVHSDWT  508

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+EEFTKMLEE 
Sbjct  509  WEQAMREIINDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRIKQKKAREEFTKMLEEC  568

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  569  KELTSSTRWS  578


 Score = 97.1 bits (240),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++ E+DERF AVER  DREDLF +Y+V+L++KEK  A E++RRN  EYR FLE+C F+
Sbjct  580  AISMLENDERFNAVERVRDREDLFESYMVELERKEKENAAEEHRRNLAEYRKFLESCDFV  639

Query  598  KVDTQWRKVQDLL  636
            KV++ WRK+QD L
Sbjct  640  KVNSHWRKIQDRL  652



>gb|KDP44546.1| hypothetical protein JCGZ_16379 [Jatropha curcas]
Length=727

 Score =   137 bits (345),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   +EPL YA K EAKNAFKALLESANVGSDWTWDQ +R I ND+RYGALK  GERK
Sbjct  156  EEKTVSQEPLTYADKLEAKNAFKALLESANVGSDWTWDQAMRVIINDRRYGALKTLGERK  215

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFN+YL Q++K EA+ RR RQ+KA+EEF KMLEES E+TSSTRWS
Sbjct  216  QAFNDYLGQKRKQEADNRRSRQKKAREEFKKMLEESGEMTSSTRWS  261


 Score = 95.1 bits (235),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FE+DERFKAVERE +R +LF NYL +L+ KE+AK  E+ +RN VEYR FLE+C FI
Sbjct  263  AMTMFENDERFKAVEREKERRELFDNYLEELKIKEQAKTNEERKRNLVEYRKFLESCDFI  322

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKV D L
Sbjct  323  KASTQWRKVHDRL  335


 Score = 40.4 bits (93),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 11/119 (9%)
 Frame = +3

Query  96   TVSEEKAADEEPLVYATKQEAKNA----------FKALLE-SANVGSDWTWDQTVRAIAN  242
            T+ E K A  + L    KQEA N           FK +LE S  + S   W + +    N
Sbjct  210  TLGERKQAFNDYLGQKRKQEADNRRSRQKKAREEFKKMLEESGEMTSSTRWSKAMTMFEN  269

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D+R+ A++   ER++ F+ YL + K  E  +    +++   E+ K LE    + +ST+W
Sbjct  270  DERFKAVEREKERRELFDNYLEELKIKEQAKTNEERKRNLVEYRKFLESCDFIKASTQW  328


 Score = 33.9 bits (76),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 42/82 (51%), Gaps = 15/82 (18%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +E   DR + F +Y+ DLQK+E       K + ++  R+NR E+R  LE  
Sbjct  335  LEADERCSRLET-MDRLNYFNDYIHDLQKEEEEQRKIQKEEMRKTERKNRDEFRKLLEEH  393

Query  583  -TCGFIKVDTQWR----KVQDL  633
               G +   T WR    KV+DL
Sbjct  394  VADGTLTSKTHWRDYFLKVKDL  415



>ref|XP_008675544.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Zea 
mays]
Length=977

 Score =   146 bits (369),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +D+E  K T   A  I+VT  EEK ++EEP+VYATK EAKNAFK+LLES NV SDWT
Sbjct  372  TSAEDLEEAKKTMPVAGKINVTPVEEKTSEEEPVVYATKMEAKNAFKSLLESVNVESDWT  431

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQT+R I NDKRYGALK  GERKQAFNEYL QRKK EAEE+R++QRKA+++F  MLEE 
Sbjct  432  WDQTMRVIINDKRYGALKTLGERKQAFNEYLNQRKKFEAEEKRIKQRKARDDFLAMLEER  491

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  492  KELTSSTRWS  501


 Score = 85.1 bits (209),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             + +FEDDERFKAVER  +REDLF NYLV+L KKEKAKA E+++R   EYR FLE+C FI
Sbjct  503  AILMFEDDERFKAVERPREREDLFENYLVELHKKEKAKAAEEHKRYVAEYRAFLESCDFI  562

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQ+ L
Sbjct  563  KASTQWRKVQERL  575



>ref|XP_008805730.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805731.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008805732.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Phoenix 
dactylifera]
Length=1053

 Score =   130 bits (327),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  DEEP VYA KQEAKNAFK LLESANV SD TW+Q +R I +DKRYGALK  GERK
Sbjct  468  EEKTIDEEPFVYANKQEAKNAFKTLLESANVESDMTWEQAMRVIISDKRYGALKTLGERK  527

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAF+EYL QRKK EAEERR++Q+KA+E+FT+MLEE  ELTSSTRWS
Sbjct  528  QAFHEYLGQRKKQEAEERRIKQKKAREDFTRMLEECTELTSSTRWS  573


 Score =   100 bits (249),  Expect(2) = 9e-52, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YL+DL KKE+AKA E++++N ++YR FLE+C FI
Sbjct  575  AVTMFENDERFNAVERARDREDLFESYLLDLLKKERAKAAEEHKQNIMDYRAFLESCDFI  634

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  635  KANSQWRKVQDRL  647



>ref|XP_006422757.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
 gb|ESR35997.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
Length=1029

 Score =   130 bits (326),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  ++E   YA K EAKNAFKALLESANVGSDWTWDQ +RAI ND+RYGAL+  GERK
Sbjct  464  EEKTVEQEHFAYANKLEAKNAFKALLESANVGSDWTWDQALRAIINDRRYGALRTLGERK  523

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNEYL Q+KK +AEERRL+ +KA++++ KMLEES ELTSSTRWS
Sbjct  524  TAFNEYLGQKKKQDAEERRLKLKKARDDYKKMLEESVELTSSTRWS  569


 Score =   100 bits (250),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA+ERE DR+D+F ++L +L++KE+AKAQE+ +RN +EYR FLE+C FI
Sbjct  571  AVTMFENDERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFI  630

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  631  KANTQWRKVQDRL  643


 Score = 37.7 bits (86),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   KSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLE-SANVGSDWTWDQTVRAIAND  245
            + TA N ++   +++ A+E  L     ++A++ +K +LE S  + S   W + V    ND
Sbjct  522  RKTAFNEYLGQKKKQDAEERRLKL---KKARDDYKKMLEESVELTSSTRWSKAVTMFEND  578

Query  246  KRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            +R+ AL+   +RK  F+++L + K+ E  + +  +++   E+ K LE    + ++T+W
Sbjct  579  ERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFIKANTQW  636


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +++  DR ++F+ YL DL+K+E       K +  +  R+NR E+R  +E  
Sbjct  643  LEADERCSRLDK-MDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEAD  701

Query  583  -TCGFIKVDTQWR  618
               G +   T WR
Sbjct  702  VALGTLTAKTNWR  714



>gb|KDO49544.1| hypothetical protein CISIN_1g001687mg [Citrus sinensis]
Length=1029

 Score =   130 bits (326),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  ++E   YA K EAKNAFKALLESANVGSDWTWDQ +RAI ND+RYGAL+  GERK
Sbjct  464  EEKTVEQEHFAYANKLEAKNAFKALLESANVGSDWTWDQALRAIINDRRYGALRTLGERK  523

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNEYL Q+KK +AEERRL+ +KA++++ KMLEES ELTSSTRWS
Sbjct  524  TAFNEYLGQKKKQDAEERRLKLKKARDDYKKMLEESVELTSSTRWS  569


 Score =   100 bits (250),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA+ERE DR+D+F ++L +L++KE+AKAQE+ +RN +EYR FLE+C FI
Sbjct  571  AVTMFENDERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFI  630

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  631  KANTQWRKVQDRL  643


 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   KSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLE-SANVGSDWTWDQTVRAIAND  245
            + TA N ++   +++ A+E  L     ++A++ +K +LE S  + S   W + V    ND
Sbjct  522  RKTAFNEYLGQKKKQDAEERRLKL---KKARDDYKKMLEESVELTSSTRWSKAVTMFEND  578

Query  246  KRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            +R+ AL+   +RK  F+++L + K+ E  + +  +++   E+ K LE    + ++T+W
Sbjct  579  ERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFIKANTQW  636


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +++  DR ++F+ YL DL+K+E       K +  +  R+NR E+R  +E  
Sbjct  643  LEADERCSRLDK-MDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEAD  701

Query  583  -TCGFIKVDTQWR  618
               G +   T WR
Sbjct  702  VALGTLTAKTNWR  714



>ref|XP_006422756.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
 gb|ESR35996.1| hypothetical protein CICLE_v10027732mg [Citrus clementina]
Length=996

 Score =   130 bits (326),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  ++E   YA K EAKNAFKALLESANVGSDWTWDQ +RAI ND+RYGAL+  GERK
Sbjct  431  EEKTVEQEHFAYANKLEAKNAFKALLESANVGSDWTWDQALRAIINDRRYGALRTLGERK  490

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNEYL Q+KK +AEERRL+ +KA++++ KMLEES ELTSSTRWS
Sbjct  491  TAFNEYLGQKKKQDAEERRLKLKKARDDYKKMLEESVELTSSTRWS  536


 Score =   100 bits (249),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA+ERE DR+D+F ++L +L++KE+AKAQE+ +RN +EYR FLE+C FI
Sbjct  538  AVTMFENDERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFI  597

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  598  KANTQWRKVQDRL  610


 Score = 37.7 bits (86),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   KSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLE-SANVGSDWTWDQTVRAIAND  245
            + TA N ++   +++ A+E  L     ++A++ +K +LE S  + S   W + V    ND
Sbjct  489  RKTAFNEYLGQKKKQDAEERRLKL---KKARDDYKKMLEESVELTSSTRWSKAVTMFEND  545

Query  246  KRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            +R+ AL+   +RK  F+++L + K+ E  + +  +++   E+ K LE    + ++T+W
Sbjct  546  ERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFIKANTQW  603


 Score = 33.1 bits (74),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +++  DR ++F+ YL DL+K+E       K +  +  R+NR E+R  +E  
Sbjct  610  LEADERCSRLDK-MDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEAD  668

Query  583  -TCGFIKVDTQWR  618
               G +   T WR
Sbjct  669  VALGTLTAKTNWR  681



>gb|KDO49545.1| hypothetical protein CISIN_1g001687mg [Citrus sinensis]
Length=996

 Score =   130 bits (326),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  ++E   YA K EAKNAFKALLESANVGSDWTWDQ +RAI ND+RYGAL+  GERK
Sbjct  431  EEKTVEQEHFAYANKLEAKNAFKALLESANVGSDWTWDQALRAIINDRRYGALRTLGERK  490

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNEYL Q+KK +AEERRL+ +KA++++ KMLEES ELTSSTRWS
Sbjct  491  TAFNEYLGQKKKQDAEERRLKLKKARDDYKKMLEESVELTSSTRWS  536


 Score =   100 bits (249),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA+ERE DR+D+F ++L +L++KE+AKAQE+ +RN +EYR FLE+C FI
Sbjct  538  AVTMFENDERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFI  597

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  598  KANTQWRKVQDRL  610


 Score = 37.7 bits (86),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   KSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLE-SANVGSDWTWDQTVRAIAND  245
            + TA N ++   +++ A+E  L     ++A++ +K +LE S  + S   W + V    ND
Sbjct  489  RKTAFNEYLGQKKKQDAEERRLKL---KKARDDYKKMLEESVELTSSTRWSKAVTMFEND  545

Query  246  KRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            +R+ AL+   +RK  F+++L + K+ E  + +  +++   E+ K LE    + ++T+W
Sbjct  546  ERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFIKANTQW  603


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +++  DR ++F+ YL DL+K+E       K +  +  R+NR E+R  +E  
Sbjct  610  LEADERCSRLDK-MDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEAD  668

Query  583  -TCGFIKVDTQWR  618
               G +   T WR
Sbjct  669  VALGTLTAKTNWR  681



>ref|XP_008805733.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Phoenix 
dactylifera]
Length=1026

 Score =   130 bits (327),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  DEEP VYA KQEAKNAFK LLESANV SD TW+Q +R I +DKRYGALK  GERK
Sbjct  441  EEKTIDEEPFVYANKQEAKNAFKTLLESANVESDMTWEQAMRVIISDKRYGALKTLGERK  500

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAF+EYL QRKK EAEERR++Q+KA+E+FT+MLEE  ELTSSTRWS
Sbjct  501  QAFHEYLGQRKKQEAEERRIKQKKAREDFTRMLEECTELTSSTRWS  546


 Score = 99.8 bits (247),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YL+DL KKE+AKA E++++N ++YR FLE+C FI
Sbjct  548  AVTMFENDERFNAVERARDREDLFESYLLDLLKKERAKAAEEHKQNIMDYRAFLESCDFI  607

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  608  KANSQWRKVQDRL  620



>ref|XP_008805735.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Phoenix 
dactylifera]
Length=1023

 Score =   130 bits (327),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  DEEP VYA KQEAKNAFK LLESANV SD TW+Q +R I +DKRYGALK  GERK
Sbjct  438  EEKTIDEEPFVYANKQEAKNAFKTLLESANVESDMTWEQAMRVIISDKRYGALKTLGERK  497

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAF+EYL QRKK EAEERR++Q+KA+E+FT+MLEE  ELTSSTRWS
Sbjct  498  QAFHEYLGQRKKQEAEERRIKQKKAREDFTRMLEECTELTSSTRWS  543


 Score = 99.8 bits (247),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YL+DL KKE+AKA E++++N ++YR FLE+C FI
Sbjct  545  AVTMFENDERFNAVERARDREDLFESYLLDLLKKERAKAAEEHKQNIMDYRAFLESCDFI  604

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  605  KANSQWRKVQDRL  617



>ref|XP_008805734.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Phoenix 
dactylifera]
 ref|XP_008805736.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Phoenix 
dactylifera]
Length=1023

 Score =   130 bits (327),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  DEEP VYA KQEAKNAFK LLESANV SD TW+Q +R I +DKRYGALK  GERK
Sbjct  438  EEKTIDEEPFVYANKQEAKNAFKTLLESANVESDMTWEQAMRVIISDKRYGALKTLGERK  497

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAF+EYL QRKK EAEERR++Q+KA+E+FT+MLEE  ELTSSTRWS
Sbjct  498  QAFHEYLGQRKKQEAEERRIKQKKAREDFTRMLEECTELTSSTRWS  543


 Score = 99.8 bits (247),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERF AVER  DREDLF +YL+DL KKE+AKA E++++N ++YR FLE+C FI
Sbjct  545  AVTMFENDERFNAVERARDREDLFESYLLDLLKKERAKAAEEHKQNIMDYRAFLESCDFI  604

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  605  KANSQWRKVQDRL  617



>ref|XP_004498955.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cicer arietinum]
Length=1000

 Score =   135 bits (339),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            + +QD+E  K         +VT SEEK  D E LVYA K EAKNAFKALLES +V SDWT
Sbjct  403  APLQDLEEAKRGLPVVGKTNVTPSEEKTNDGETLVYANKLEAKNAFKALLESVSVQSDWT  462

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+Q +R I NDKRY ALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+EEFTKMLEE 
Sbjct  463  WEQAMREIVNDKRYNALKTLGERKQAFNEYLGQRKKLEAEERRIKQKKAREEFTKMLEEC  522

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  523  KELTSSTRWS  532


 Score = 95.1 bits (235),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++ E DERF AVER  DREDLF +Y+V+L++KEK  A E++RRN  EYR FL++C ++
Sbjct  534  AISMLESDERFSAVERPRDREDLFESYMVELERKEKENAAEEHRRNLAEYRKFLQSCDYV  593

Query  598  KVDTQWRKVQDLL  636
            KV++ WRK+QD L
Sbjct  594  KVNSHWRKIQDRL  606



>ref|XP_011002294.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
 ref|XP_011002303.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
 ref|XP_011002313.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Populus 
euphratica]
Length=1053

 Score =   132 bits (331),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK+ +++PL+YA K E KNAFKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  462  EEKSVNQDPLLYADKLEEKNAFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  521

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q++K EAEERR++Q+KA+EEF KMLE SKELT+S RWS
Sbjct  522  QAFNEFLGQKRKQEAEERRVKQKKAREEFKKMLEGSKELTASMRWS  567


 Score = 98.2 bits (243),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
             T+FE+DERFKAVERE DR DL   YL ++++KE+AKA E+ +RN +EYR FLE+C FIK
Sbjct  570  ATLFENDERFKAVERERDRRDLIETYLQEIEEKERAKAHEERKRNIMEYRQFLESCEFIK  629

Query  601  VDTQWRKVQDLL  636
              TQWRKVQD L
Sbjct  630  ASTQWRKVQDRL  641



>ref|XP_011002339.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Populus 
euphratica]
Length=1034

 Score =   131 bits (330),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK+ +++PL+YA K E KNAFKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  462  EEKSVNQDPLLYADKLEEKNAFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  521

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q++K EAEERR++Q+KA+EEF KMLE SKELT+S RWS
Sbjct  522  QAFNEFLGQKRKQEAEERRVKQKKAREEFKKMLEGSKELTASMRWS  567


 Score = 98.2 bits (243),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
             T+FE+DERFKAVERE DR DL   YL ++++KE+AKA E+ +RN +EYR FLE+C FIK
Sbjct  570  ATLFENDERFKAVERERDRRDLIETYLQEIEEKERAKAHEERKRNIMEYRQFLESCEFIK  629

Query  601  VDTQWRKVQDLL  636
              TQWRKVQD L
Sbjct  630  ASTQWRKVQDRL  641



>ref|XP_011002323.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Populus 
euphratica]
Length=1035

 Score =   131 bits (330),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK+ +++PL+YA K E KNAFKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  462  EEKSVNQDPLLYADKLEEKNAFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  521

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q++K EAEERR++Q+KA+EEF KMLE SKELT+S RWS
Sbjct  522  QAFNEFLGQKRKQEAEERRVKQKKAREEFKKMLEGSKELTASMRWS  567


 Score = 98.2 bits (243),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
             T+FE+DERFKAVERE DR DL   YL ++++KE+AKA E+ +RN +EYR FLE+C FIK
Sbjct  570  ATLFENDERFKAVERERDRRDLIETYLQEIEEKERAKAHEERKRNIMEYRQFLESCEFIK  629

Query  601  VDTQWRKVQDLL  636
              TQWRKVQD L
Sbjct  630  ASTQWRKVQDRL  641



>ref|XP_011002329.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Populus 
euphratica]
Length=1035

 Score =   131 bits (330),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK+ +++PL+YA K E KNAFKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  462  EEKSVNQDPLLYADKLEEKNAFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  521

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q++K EAEERR++Q+KA+EEF KMLE SKELT+S RWS
Sbjct  522  QAFNEFLGQKRKQEAEERRVKQKKAREEFKKMLEGSKELTASMRWS  567


 Score = 97.8 bits (242),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
             T+FE+DERFKAVERE DR DL   YL ++++KE+AKA E+ +RN +EYR FLE+C FIK
Sbjct  570  ATLFENDERFKAVERERDRRDLIETYLQEIEEKERAKAHEERKRNIMEYRQFLESCEFIK  629

Query  601  VDTQWRKVQDLL  636
              TQWRKVQD L
Sbjct  630  ASTQWRKVQDRL  641



>ref|XP_009604101.1| PREDICTED: pre-mRNA-processing protein 40A-like [Nicotiana tomentosiformis]
Length=770

 Score =   132 bits (332),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 103/137 (75%), Gaps = 4/137 (3%)
 Frame = +3

Query  21   VVASSGVSSIQDIEMKKSTAT---NIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            +V   GVS +++ E  K  AT      VT SEEK  +  PLVY +K EAK+AFK LLESA
Sbjct  173  IVYEDGVS-LENTEEVKKDATISETGSVTPSEEKTVEPGPLVYESKAEAKSAFKILLESA  231

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSDWTWDQ +RAI ND+RYGALK  GERKQAFNEYL  +KKLEAEERR++Q+KA+E+F
Sbjct  232  NIGSDWTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSHKKKLEAEERRVKQKKAREDF  291

Query  372  TKMLEESKELTSSTRWS  422
              MLEE KEL  STRWS
Sbjct  292  RIMLEECKELAPSTRWS  308


 Score = 97.1 bits (240),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE DERFKAVER  DREDLF +Y+  L+KKE+A+A E+ +RNRVEY  FL++C FI
Sbjct  310  AISIFEHDERFKAVERAKDREDLFEDYMEKLEKKERARALEEQKRNRVEYLEFLKSCDFI  369

Query  598  KVDTQWRKVQDLL  636
            K  +QWRKVQD L
Sbjct  370  KASSQWRKVQDRL  382



>ref|XP_009397407.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1034

 Score =   132 bits (331),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +3

Query  45   SIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTW  215
            S QD+E  K T   +   + T  E+K  DE   VYA K EAKNAF+ALLESANV SDWTW
Sbjct  439  SAQDLEEAKRTIPVVEKTNFTQLEDKMVDEGQFVYANKLEAKNAFRALLESANVESDWTW  498

Query  216  DQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESK  395
            +Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KAKE+FT+MLEE K
Sbjct  499  EQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAKEDFTRMLEECK  558

Query  396  ELTSSTRWS  422
            EL+S TRWS
Sbjct  559  ELSSMTRWS  567


 Score = 97.8 bits (242),  Expect(2) = 3e-51, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF  Y+ +LQKKE+AKA E ++RN +EYR FLE+C F+
Sbjct  569  AITMFEDDERFTAVERSREREDLFEGYIAELQKKERAKAAEAHKRNIMEYRAFLESCDFV  628

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  629  KANSQWRKVQDRL  641



>ref|XP_009397415.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1033

 Score =   132 bits (331),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 99/129 (77%), Gaps = 3/129 (2%)
 Frame = +3

Query  45   SIQDIEMKKSTATNI---HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTW  215
            S QD+E  K T   +   + T  E+K  DE   VYA K EAKNAF+ALLESANV SDWTW
Sbjct  438  SAQDLEEAKRTIPVVEKTNFTQLEDKMVDEGQFVYANKLEAKNAFRALLESANVESDWTW  497

Query  216  DQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESK  395
            +Q +R I NDKRYGALK  GERKQAFNEYL QRKK EAEERR++Q+KAKE+FT+MLEE K
Sbjct  498  EQAMRVIINDKRYGALKTLGERKQAFNEYLGQRKKQEAEERRIKQKKAKEDFTRMLEECK  557

Query  396  ELTSSTRWS  422
            EL+S TRWS
Sbjct  558  ELSSMTRWS  566


 Score = 97.4 bits (241),  Expect(2) = 3e-51, Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF  Y+ +LQKKE+AKA E ++RN +EYR FLE+C F+
Sbjct  568  AITMFEDDERFTAVERSREREDLFEGYIAELQKKERAKAAEAHKRNIMEYRAFLESCDFV  627

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  628  KANSQWRKVQDRL  640



>ref|XP_008675546.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675547.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675548.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675549.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675550.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675551.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
 ref|XP_008675552.1| PREDICTED: pre-mRNA-processing protein 40A-like [Zea mays]
Length=991

 Score =   149 bits (375),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 108/134 (81%), Gaps = 2/134 (1%)
 Frame = +3

Query  27   ASSGVSSIQDIEMKKS--TATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVG  200
            A  G S+   +E KK+   A  I+VT  EEK ++EEP+VYATK EAKNAFK+LLES NV 
Sbjct  385  AEDGTSAEDLVEAKKTMPVAGKINVTPVEEKTSEEEPVVYATKMEAKNAFKSLLESVNVE  444

Query  201  SDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKM  380
            SDWTWDQT+R I NDKRYGALK  GERKQAFNEYL QRKK EAEE+R++QRKA+++F  M
Sbjct  445  SDWTWDQTMRVIINDKRYGALKTLGERKQAFNEYLNQRKKFEAEEKRIKQRKARDDFLAM  504

Query  381  LEESKELTSSTRWS  422
            LEESKELTSSTRWS
Sbjct  505  LEESKELTSSTRWS  518


 Score = 80.5 bits (197),  Expect(2) = 3e-51, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             + +FEDDERFKAVER  +REDLF NYLV+L KKEKAKA E+++R   EYR FLE+C FI
Sbjct  520  AILMFEDDERFKAVERPREREDLFENYLVELHKKEKAKAAEEHKRYVAEYRAFLESCDFI  579

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQ+ L
Sbjct  580  KASTQWRKVQERL  592



>ref|XP_006486884.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486885.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Citrus 
sinensis]
 ref|XP_006486886.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Citrus 
sinensis]
 ref|XP_006486887.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Citrus 
sinensis]
Length=1029

 Score =   130 bits (326),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  ++E   YA K EAKNAFKALLESANVGSDWTWDQ +RAI ND+RYGAL+  GERK
Sbjct  464  EEKTVEQEHFAYANKLEAKNAFKALLESANVGSDWTWDQALRAIINDRRYGALRTLGERK  523

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNEYL Q+KK +AEERRL+ +KA++++ KMLEES ELTSSTRWS
Sbjct  524  TAFNEYLGQKKKQDAEERRLKLKKARDDYKKMLEESVELTSSTRWS  569


 Score = 99.0 bits (245),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA+ERE DR+D+F ++L +L++KE+AK QE+ +RN +EYR FLE+C FI
Sbjct  571  AVTMFENDERFKALERERDRKDMFDDHLDELKQKERAKVQEERKRNIIEYRKFLESCDFI  630

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  631  KANTQWRKVQDRL  643


 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   KSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLE-SANVGSDWTWDQTVRAIAND  245
            + TA N ++   +++ A+E  L     ++A++ +K +LE S  + S   W + V    ND
Sbjct  522  RKTAFNEYLGQKKKQDAEERRLKL---KKARDDYKKMLEESVELTSSTRWSKAVTMFEND  578

Query  246  KRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            +R+ AL+   +RK  F+++L + K+ E  + +  +++   E+ K LE    + ++T+W
Sbjct  579  ERFKALERERDRKDMFDDHLDELKQKERAKVQEERKRNIIEYRKFLESCDFIKANTQW  636


 Score = 33.5 bits (75),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 38/73 (52%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +++  DR ++F+ YL DL+K+E       K +  +  R+NR E+R  +E  
Sbjct  643  LEADERCSRLDK-MDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEAD  701

Query  583  -TCGFIKVDTQWR  618
               G +   T WR
Sbjct  702  VALGTLTAKTNWR  714



>ref|XP_008364430.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Malus 
domestica]
Length=794

 Score =   132 bits (331),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +3

Query  27   ASSGVSSIQDIEMKK-STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGS  203
            ++ GV + ++ E K  +T   I+   +EEK+ D EP+ Y  K EAKNAFKALLES N+GS
Sbjct  197  SADGVPAQENEEAKDDATGKKINDIAAEEKSVDREPIPYENKLEAKNAFKALLESTNIGS  256

Query  204  DWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKML  383
            DWTWD+ +R I NDKRYGALK  GERKQAFNE+L+QRKK EAEERR++Q+KA++EF  ML
Sbjct  257  DWTWDRAMRVIINDKRYGALKTLGERKQAFNEFLVQRKKQEAEERRIKQKKARDEFKTML  316

Query  384  EESKELTSSTRW  419
            EE  ELTSS RW
Sbjct  317  EECSELTSSARW  328


 Score = 97.1 bits (240),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE+DERFKAVER+ DR ++F +Y+ +LQKKE+AKAQE+ +RN +EYR FLE+C FIK 
Sbjct  333  SIFENDERFKAVERDRDRREMFEDYIEELQKKERAKAQEERKRNVLEYRRFLESCDFIKA  392

Query  604  DTQWRKVQDLL  636
            + QWRKVQD L
Sbjct  393  NIQWRKVQDRL  403



>ref|XP_008364431.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Malus 
domestica]
Length=793

 Score =   132 bits (331),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 1/132 (1%)
 Frame = +3

Query  27   ASSGVSSIQDIEMKK-STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGS  203
            ++ GV + ++ E K  +T   I+   +EEK+ D EP+ Y  K EAKNAFKALLES N+GS
Sbjct  197  SADGVPAQENEEAKDDATGKKINDIAAEEKSVDREPIPYENKLEAKNAFKALLESTNIGS  256

Query  204  DWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKML  383
            DWTWD+ +R I NDKRYGALK  GERKQAFNE+L+QRKK EAEERR++Q+KA++EF  ML
Sbjct  257  DWTWDRAMRVIINDKRYGALKTLGERKQAFNEFLVQRKKQEAEERRIKQKKARDEFKTML  316

Query  384  EESKELTSSTRW  419
            EE  ELTSS RW
Sbjct  317  EECSELTSSARW  328


 Score = 97.1 bits (240),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE+DERFKAVER+ DR ++F +Y+ +LQKKE+AKAQE+ +RN +EYR FLE+C FIK 
Sbjct  333  SIFENDERFKAVERDRDRREMFEDYIEELQKKERAKAQEERKRNVLEYRRFLESCDFIKA  392

Query  604  DTQWRKVQDLL  636
            + QWRKVQD L
Sbjct  393  NIQWRKVQDRL  403



>ref|XP_003563698.1| PREDICTED: pre-mRNA-processing protein 40A [Brachypodium distachyon]
 ref|XP_010227563.1| PREDICTED: pre-mRNA-processing protein 40A [Brachypodium distachyon]
Length=998

 Score =   141 bits (356),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +D+E  K    TA  I+VT  EEK ++EEP VYA K EAKNAFKALLESANV SDW+
Sbjct  392  ASAEDLEEAKKTMPTAGKINVTPLEEKTSEEEPPVYANKLEAKNAFKALLESANVESDWS  451

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ +R I NDKRYGAL+ HGERKQ +NEYL QRKK+EAEERR++QRK++++F  MLEE 
Sbjct  452  WDQAMRVIINDKRYGALRSHGERKQVYNEYLNQRKKIEAEERRVKQRKSRDDFLTMLEEC  511

Query  393  KELTSSTRWS  422
            K+LTSSTRWS
Sbjct  512  KDLTSSTRWS  521


 Score = 87.4 bits (215),  Expect(2) = 4e-51, Method: Composition-based stats.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF NYLV+LQKKEKAKA E+++R+  EYR FLE+C FI
Sbjct  523  AITMFEDDERFNAVERPREREDLFENYLVELQKKEKAKAAEEHKRHVAEYRAFLESCDFI  582

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  583  KASTQWRKVQDRL  595


 Score = 38.9 bits (89),  Expect(2) = 0.001, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 38/73 (52%), Gaps = 11/73 (15%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             EDDER   +E+  DR D+F+ Y+ DL+K+E       K   +   R+NR E+R  LE  
Sbjct  595  LEDDERCSRLEK-IDRLDVFQEYIRDLEKEEEEQKRIQKEHTRRQERKNRDEFRKMLEEH  653

Query  583  -TCGFIKVDTQWR  618
               G +   T WR
Sbjct  654  VADGTLTAKTHWR  666


 Score = 30.8 bits (68),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 21/92 (23%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +3

Query  147  KQEAKNAFKALLESA-NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            ++++++ F  +LE   ++ S   W + +    +D+R+ A++   ER+  F  YL++ +K 
Sbjct  497  QRKSRDDFLTMLEECKDLTSSTRWSKAITMFEDDERFNAVERPREREDLFENYLVELQKK  556

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E  +     ++   E+   LE    + +ST+W
Sbjct  557  EKAKAAEEHKRHVAEYRAFLESCDFIKASTQW  588



>ref|XP_010500168.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Camelina 
sativa]
Length=968

 Score =   125 bits (314),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +3

Query  69   KSTATNIHVTVSE--EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K  + N+   +S   +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +
Sbjct  379  KELSVNVKANLSPAGDKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVH  438

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            DKRYGAL+  GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  439  DKRYGALRTLGERKQAFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  498


 Score =   103 bits (257),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  500  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  559

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  560  KAGTQWRKVQDRL  572



>ref|XP_010500169.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Camelina 
sativa]
Length=967

 Score =   125 bits (314),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = +3

Query  69   KSTATNIHVTVSE--EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K  + N+   +S   +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +
Sbjct  378  KELSVNVKANLSPAGDKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVH  437

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            DKRYGAL+  GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  438  DKRYGALRTLGERKQAFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  497


 Score =   103 bits (256),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  499  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  558

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  559  KAGTQWRKVQDRL  571



>ref|XP_004496865.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Cicer 
arietinum]
Length=1013

 Score =   129 bits (324),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKR  251
            ST  N++   SE K  + E LVYA K EAK+AFK+LLES NVG DW+WD+ +R I NDKR
Sbjct  438  STGENVNEVASETKTVEPESLVYANKMEAKDAFKSLLESVNVGPDWSWDRAMRLIINDKR  497

Query  252  YGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            YGALK  GERKQAFNEYL QRKK EAEE+R++ +KA+E+F KMLEES ELTSSTR+S
Sbjct  498  YGALKSLGERKQAFNEYLSQRKKQEAEEKRMKHKKAREDFRKMLEESTELTSSTRFS  554


 Score = 99.4 bits (246),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V IFE+DERFKAVER+ DR+D+F ++L +L  KE+AKA E+ +RN VEYR FLE+C FI
Sbjct  556  AVAIFENDERFKAVERDRDRKDMFDSFLEELMNKERAKALEERKRNTVEYRKFLESCDFI  615

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  616  KANTQWRKVQDRL  628



>ref|XP_009796951.1| PREDICTED: pre-mRNA-processing protein 40A-like [Nicotiana sylvestris]
Length=837

 Score =   130 bits (327),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 101/136 (74%), Gaps = 2/136 (1%)
 Frame = +3

Query  21   VVASSGVSSIQDIEMKK--STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESAN  194
            VV   GVS     E+KK  + +     T SEEK  +  PLVY +K EAK+AFK LLESAN
Sbjct  240  VVYEDGVSLENTEEVKKDATVSETGSATPSEEKTVEPGPLVYESKAEAKSAFKILLESAN  299

Query  195  VGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFT  374
            +GSDWTWDQ +RAI ND+RYGALK  GERKQAFNEYL  +KKLEAEERR++Q+KA+E+F 
Sbjct  300  IGSDWTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSHKKKLEAEERRIKQKKAREDFR  359

Query  375  KMLEESKELTSSTRWS  422
             MLEE KEL  STRWS
Sbjct  360  IMLEECKELAPSTRWS  375


 Score = 97.8 bits (242),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE DERFKAVER  DREDLF +Y+ +L+KKE+A+A E+ +RNRVEY  FL++C FI
Sbjct  377  AISIFEHDERFKAVERAKDREDLFEDYMEELEKKERARALEEQKRNRVEYLEFLKSCDFI  436

Query  598  KVDTQWRKVQDLL  636
            K  +QWRKVQD L
Sbjct  437  KASSQWRKVQDRL  449



>ref|XP_010461464.1| PREDICTED: pre-mRNA-processing protein 40A-like [Camelina sativa]
Length=964

 Score =   124 bits (312),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +3

Query  111  KAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQA  290
            KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQA
Sbjct  391  KANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQA  450

Query  291  FNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            FNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  451  FNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  494


 Score =   103 bits (257),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  496  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  555

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  556  KAGTQWRKVQDRL  568



>ref|XP_010479065.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Camelina 
sativa]
Length=919

 Score =   124 bits (312),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  394  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  453

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  454  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  498


 Score =   103 bits (256),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  500  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  559

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  560  KAGTQWRKVQDRL  572



>ref|XP_006486888.1| PREDICTED: pre-mRNA-processing protein 40A-like [Citrus sinensis]
Length=1001

 Score =   131 bits (330),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +3

Query  60   EMKKSTATNIHVTVS-EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAI  236
            EM+K   T   +    EEK   +E L YA K EAKNAFKALLESANVGSDW+WDQ ++AI
Sbjct  421  EMRKDAVTGEKIGDELEEKTVGQEHLAYANKLEAKNAFKALLESANVGSDWSWDQAMQAI  480

Query  237  ANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTR  416
             ND+RYGALK  GERKQAFNEYL QRKK EAEERR + +KA+E++ KMLEES ELTSSTR
Sbjct  481  INDRRYGALKTLGERKQAFNEYLGQRKKQEAEERRFKLKKAREDYKKMLEESVELTSSTR  540

Query  417  WS  422
            WS
Sbjct  541  WS  542


 Score = 96.3 bits (238),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA++RE DR DLF ++L +L++KE+AKAQE+ R++ +EYR FLE+C FI
Sbjct  544  AVTMFENDERFKALDRERDRRDLFDDHLEELRQKERAKAQEERRQHLIEYRQFLESCDFI  603

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  604  KASTQWRKVQDRL  616


 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 15/82 (18%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKEKA--KAQEDY-----RRNRVEYRXFLE--  582
             E DER   +E+  DR ++F+ Y++DL+K+E+   K Q++      R+NR E+R  LE  
Sbjct  616  LEADERCSRLEK-IDRLEIFKEYIIDLEKEEEEQRKIQKEVLRRAERKNRDEFRKLLEGD  674

Query  583  -TCGFIKVDTQWR----KVQDL  633
               G +   T WR    KV+DL
Sbjct  675  VASGTLTAKTHWRDYCMKVKDL  696


 Score = 36.2 bits (82),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 58/119 (49%), Gaps = 11/119 (9%)
 Frame = +3

Query  96   TVSEEKAADEEPLVYATKQEA----------KNAFKALLE-SANVGSDWTWDQTVRAIAN  242
            T+ E K A  E L    KQEA          +  +K +LE S  + S   W + V    N
Sbjct  491  TLGERKQAFNEYLGQRKKQEAEERRFKLKKAREDYKKMLEESVELTSSTRWSKAVTMFEN  550

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D+R+ AL    +R+  F+++L + ++ E  + +  +R+   E+ + LE    + +ST+W
Sbjct  551  DERFKALDRERDRRDLFDDHLEELRQKERAKAQEERRQHLIEYRQFLESCDFIKASTQW  609



>ref|XP_010479064.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Camelina 
sativa]
Length=967

 Score =   124 bits (312),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  393  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  452

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  453  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  497


 Score =   103 bits (257),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  499  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  558

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  559  KAGTQWRKVQDRL  571



>ref|XP_010479063.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Camelina 
sativa]
Length=968

 Score =   124 bits (312),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  394  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  453

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  454  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  498


 Score =   103 bits (257),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  500  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  559

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  560  KAGTQWRKVQDRL  572



>gb|KGN52740.1| hypothetical protein Csa_4G000610 [Cucumis sativus]
Length=1004

 Score =   132 bits (333),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDW  209
            + GVS+ +  E KK T+        EE+A D++   Y  KQEAKNAFKALLESANVGSDW
Sbjct  412  TDGVSAQELEETKKDTSDEKVEFTLEERAIDQDTSAYPNKQEAKNAFKALLESANVGSDW  471

Query  210  TWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEE  389
            TWD+ +R I NDKRYGALK  GERKQAFNE+L QRKK E EERR +Q+KA+EEF KMLEE
Sbjct  472  TWDRAMRIIINDKRYGALKTLGERKQAFNEFLGQRKKQEVEERRTKQKKAREEFRKMLEE  531

Query  390  SKELTSSTRW  419
            S ELTSS RW
Sbjct  532  STELTSSMRW  541


 Score = 95.1 bits (235),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE+DERF+AVER+ DR DLF ++L +L+ KE+AKAQE+  RN +EYR FLE+C FIK 
Sbjct  546  SIFENDERFQAVERDRDRRDLFESFLEELKNKERAKAQEERSRNILEYRKFLESCDFIKA  605

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  606  SSQWRKVQDRL  616



>ref|XP_008675538.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675539.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675540.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675541.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675542.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
 ref|XP_008675543.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Zea 
mays]
Length=994

 Score =   147 bits (370),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +D+E  K T   A  I+VT  EEK ++EEP+VYATK EAKNAFK+LLES NV SDWT
Sbjct  389  TSAEDLEEAKKTMPVAGKINVTPVEEKTSEEEPVVYATKMEAKNAFKSLLESVNVESDWT  448

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQT+R I NDKRYGALK  GERKQAFNEYL QRKK EAEE+R++QRKA+++F  MLEE 
Sbjct  449  WDQTMRVIINDKRYGALKTLGERKQAFNEYLNQRKKFEAEEKRIKQRKARDDFLAMLEER  508

Query  393  KELTSSTRWS  422
            KELTSSTRWS
Sbjct  509  KELTSSTRWS  518


 Score = 80.5 bits (197),  Expect(2) = 1e-50, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             + +FEDDERFKAVER  +REDLF NYLV+L KKEKAKA E+++R   EYR FLE+C FI
Sbjct  520  AILMFEDDERFKAVERPREREDLFENYLVELHKKEKAKAAEEHKRYVAEYRAFLESCDFI  579

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQ+ L
Sbjct  580  KASTQWRKVQERL  592



>gb|KDO49541.1| hypothetical protein CISIN_1g0018782mg, partial [Citrus sinensis]
Length=863

 Score =   131 bits (329),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +3

Query  60   EMKKSTATNIHVTVS-EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAI  236
            EM+K   T   +    EEK   +E L YA K EAKNAFKALLESANVGSDW+WDQ ++AI
Sbjct  421  EMRKDAVTGEKIGDELEEKTVGQEHLAYANKLEAKNAFKALLESANVGSDWSWDQAMQAI  480

Query  237  ANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTR  416
             ND+RYGALK  GERKQAFNEYL QRKK EAEERR + +KA+E++ KMLEES ELTSSTR
Sbjct  481  INDRRYGALKTLGERKQAFNEYLGQRKKQEAEERRFKLKKAREDYKKMLEESVELTSSTR  540

Query  417  WS  422
            WS
Sbjct  541  WS  542


 Score = 95.9 bits (237),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA++RE DR DLF ++L +L++KE+AKAQE+ R++ +EYR FLE+C FI
Sbjct  544  AVTMFENDERFKALDRERDRRDLFDDHLEELRQKERAKAQEERRQHLIEYRQFLESCDFI  603

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  604  KASTQWRKVQDRL  616


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 15/82 (18%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKEKA--KAQEDY-----RRNRVEYRXFLE--  582
             E DER   +E+  DR ++F+ Y++DL+K+E+   K Q++      R+NR E+R  LE  
Sbjct  616  LEADERCSRLEK-IDRLEIFKEYIIDLEKEEEEQRKIQKEVLRRAERKNRDEFRKLLEGD  674

Query  583  -TCGFIKVDTQWR----KVQDL  633
               G +   T WR    KV+DL
Sbjct  675  VASGTLTAKTHWRDYCMKVKDL  696


 Score = 35.8 bits (81),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 58/119 (49%), Gaps = 11/119 (9%)
 Frame = +3

Query  96   TVSEEKAADEEPLVYATKQEA----------KNAFKALLE-SANVGSDWTWDQTVRAIAN  242
            T+ E K A  E L    KQEA          +  +K +LE S  + S   W + V    N
Sbjct  491  TLGERKQAFNEYLGQRKKQEAEERRFKLKKAREDYKKMLEESVELTSSTRWSKAVTMFEN  550

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D+R+ AL    +R+  F+++L + ++ E  + +  +R+   E+ + LE    + +ST+W
Sbjct  551  DERFKALDRERDRRDLFDDHLEELRQKERAKAQEERRQHLIEYRQFLESCDFIKASTQW  609



>ref|XP_003535678.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Glycine 
max]
Length=1017

 Score =   131 bits (330),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  99   VSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGE  278
             +E KA + EP VYA K EAK+AFKALLES NVGSDWTWD+++R I NDKRYGALK  GE
Sbjct  455  AAETKAVEPEPPVYANKMEAKDAFKALLESVNVGSDWTWDRSMRLIINDKRYGALKTLGE  514

Query  279  RKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            RKQAFNEYL QRKK EAEE+R++Q+KA+E+F KMLEES +LTSS RWS
Sbjct  515  RKQAFNEYLNQRKKQEAEEKRMKQKKAREDFKKMLEESTDLTSSARWS  562


 Score = 95.9 bits (237),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V+IFE+DERFKAVER+ DR D+F ++L +L  KE+AK QE+ +RN +EY+ FLE+C FI
Sbjct  564  AVSIFENDERFKAVERDRDRRDMFESFLEELLNKERAKVQEERKRNIMEYKKFLESCDFI  623

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  624  KASTQWRKVQDRL  636



>ref|XP_006589614.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Glycine 
max]
Length=1017

 Score =   131 bits (330),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  99   VSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGE  278
             +E KA + EP VYA K EAK+AFKALLES NVGSDWTWD+++R I NDKRYGALK  GE
Sbjct  455  AAETKAVEPEPPVYANKMEAKDAFKALLESVNVGSDWTWDRSMRLIINDKRYGALKTLGE  514

Query  279  RKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            RKQAFNEYL QRKK EAEE+R++Q+KA+E+F KMLEES +LTSS RWS
Sbjct  515  RKQAFNEYLNQRKKQEAEEKRMKQKKAREDFKKMLEESTDLTSSARWS  562


 Score = 95.9 bits (237),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V+IFE+DERFKAVER+ DR D+F ++L +L  KE+AK QE+ +RN +EY+ FLE+C FI
Sbjct  564  AVSIFENDERFKAVERDRDRRDMFESFLEELLNKERAKVQEERKRNIMEYKKFLESCDFI  623

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  624  KASTQWRKVQDRL  636



>ref|XP_006422754.1| hypothetical protein CICLE_v100277412mg, partial [Citrus clementina]
 gb|ESR35994.1| hypothetical protein CICLE_v100277412mg, partial [Citrus clementina]
 gb|KDO49540.1| hypothetical protein CISIN_1g0018782mg, partial [Citrus sinensis]
Length=864

 Score =   131 bits (329),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 1/122 (1%)
 Frame = +3

Query  60   EMKKSTATNIHVTVS-EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAI  236
            EM+K   T   +    EEK   +E L YA K EAKNAFKALLESANVGSDW+WDQ ++AI
Sbjct  421  EMRKDAVTGEKIGDELEEKTVGQEHLAYANKLEAKNAFKALLESANVGSDWSWDQAMQAI  480

Query  237  ANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTR  416
             ND+RYGALK  GERKQAFNEYL QRKK EAEERR + +KA+E++ KMLEES ELTSSTR
Sbjct  481  INDRRYGALKTLGERKQAFNEYLGQRKKQEAEERRFKLKKAREDYKKMLEESVELTSSTR  540

Query  417  WS  422
            WS
Sbjct  541  WS  542


 Score = 95.9 bits (237),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FE+DERFKA++RE DR DLF ++L +L++KE+AKAQE+ R++ +EYR FLE+C FI
Sbjct  544  AVTMFENDERFKALDRERDRRDLFDDHLEELRQKERAKAQEERRQHLIEYRQFLESCDFI  603

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  604  KASTQWRKVQDRL  616


 Score = 38.9 bits (89),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 15/82 (18%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKEKA--KAQEDY-----RRNRVEYRXFLE--  582
             E DER   +E+  DR ++F+ Y++DL+K+E+   K Q++      R+NR E+R  LE  
Sbjct  616  LEADERCSRLEK-IDRLEIFKEYIIDLEKEEEEQRKIQKEVLRRAERKNRDEFRKLLEGD  674

Query  583  -TCGFIKVDTQWR----KVQDL  633
               G +   T WR    KV+DL
Sbjct  675  VASGTLTAKTHWRDYCMKVKDL  696


 Score = 35.8 bits (81),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 58/119 (49%), Gaps = 11/119 (9%)
 Frame = +3

Query  96   TVSEEKAADEEPLVYATKQEA----------KNAFKALLE-SANVGSDWTWDQTVRAIAN  242
            T+ E K A  E L    KQEA          +  +K +LE S  + S   W + V    N
Sbjct  491  TLGERKQAFNEYLGQRKKQEAEERRFKLKKAREDYKKMLEESVELTSSTRWSKAVTMFEN  550

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D+R+ AL    +R+  F+++L + ++ E  + +  +R+   E+ + LE    + +ST+W
Sbjct  551  DERFKALDRERDRRDLFDDHLEELRQKERAKAQEERRQHLIEYRQFLESCDFIKASTQW  609



>ref|XP_010479066.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X4 [Camelina 
sativa]
Length=828

 Score =   124 bits (311),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  254  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  313

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  314  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSIKWS  358


 Score =   102 bits (255),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KAQE++R++  EYR FLETC FI
Sbjct  360  AMSLFENDERFKAVDRSRDREDLFDNYIVELERKERNKAQEEHRQHMAEYRKFLETCDFI  419

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  420  KAGTQWRKVQDRL  432



>ref|XP_008454417.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A 
[Cucumis melo]
Length=1004

 Score =   132 bits (333),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDW  209
            + GVS+ +  E KK T+        EE+A D+E   Y  KQEAKNAFKALLESANVGSDW
Sbjct  412  TDGVSAQELEETKKDTSDEKVEFTLEERAIDQETSAYPNKQEAKNAFKALLESANVGSDW  471

Query  210  TWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEE  389
            TWD+ +R I NDKRYGALK  GERKQAFNE+L QRK  E EERR +Q+KA+EEF KMLEE
Sbjct  472  TWDRAMRIIINDKRYGALKSLGERKQAFNEFLGQRKNXEVEERRTKQKKAREEFRKMLEE  531

Query  390  SKELTSSTRW  419
            S ELTSS RW
Sbjct  532  STELTSSMRW  541


 Score = 94.0 bits (232),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE+DERF+AVER+ DR DLF ++L +L+ KE+AKAQE+  RN +EYR FLE+C FIK 
Sbjct  546  SIFENDERFQAVERDRDRRDLFESFLEELKNKERAKAQEERSRNILEYRKFLESCDFIKA  605

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  606  SSQWRKVQDRL  616



>ref|XP_004150264.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cucumis sativus]
Length=796

 Score =   132 bits (333),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDW  209
            + GVS+ +  E KK T+        EE+A D++   Y  KQEAKNAFKALLESANVGSDW
Sbjct  204  TDGVSAQELEETKKDTSDEKVEFTLEERAIDQDTSAYPNKQEAKNAFKALLESANVGSDW  263

Query  210  TWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEE  389
            TWD+ +R I NDKRYGALK  GERKQAFNE+L QRKK E EERR +Q+KA+EEF KMLEE
Sbjct  264  TWDRAMRIIINDKRYGALKTLGERKQAFNEFLGQRKKQEVEERRTKQKKAREEFRKMLEE  323

Query  390  SKELTSSTRW  419
            S ELTSS RW
Sbjct  324  STELTSSMRW  333


 Score = 93.6 bits (231),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE+DERF+AVER+ DR DLF ++L +L+ KE+AKAQE+  RN +EYR FLE+C FIK 
Sbjct  338  SIFENDERFQAVERDRDRRDLFESFLEELKNKERAKAQEERSRNILEYRKFLESCDFIKA  397

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  398  SSQWRKVQDRL  408



>gb|KHN01575.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1018

 Score =   129 bits (325),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            +E KA + EP VYA K EAK+AFKALLES NVGSDWTWD+++R I NDKRYGALK   ER
Sbjct  457  AETKAVEPEPPVYANKMEAKDAFKALLESVNVGSDWTWDRSMRLIINDKRYGALKTLVER  516

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNEYL QRKK EAEE+R++Q+KA+E+F KMLEES +LTSSTRWS
Sbjct  517  KQAFNEYLNQRKKQEAEEKRMKQKKAREDFKKMLEESTDLTSSTRWS  563


 Score = 96.7 bits (239),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V+IFE+DERFKAVER+ DR D+F ++L +L  KE+AK QE+ +RN +EYR FLE+C FI
Sbjct  565  AVSIFENDERFKAVERDRDRRDMFESFLEELLNKERAKVQEERKRNIMEYRKFLESCDFI  624

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  625  KASTQWRKVQDRL  637



>ref|XP_006606005.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Glycine 
max]
 ref|XP_006606006.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Glycine 
max]
Length=1008

 Score =   129 bits (325),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            +E KA + EP VYA K EAK+AFKALLES NVGSDWTWD+++R I NDKRYGALK   ER
Sbjct  457  AETKAVEPEPPVYANKMEAKDAFKALLESVNVGSDWTWDRSMRLIINDKRYGALKTLVER  516

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNEYL QRKK EAEE+R++Q+KA+E+F KMLEES +LTSSTRWS
Sbjct  517  KQAFNEYLNQRKKQEAEEKRMKQKKAREDFKKMLEESTDLTSSTRWS  563


 Score = 96.7 bits (239),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V+IFE+DERFKAVER+ DR D+F ++L +L  KE+AK QE+ +RN +EYR FLE+C FI
Sbjct  565  AVSIFENDERFKAVERDRDRRDMFESFLEELLNKERAKVQEERKRNIMEYRKFLESCDFI  624

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  625  KASTQWRKVQDRL  637



>ref|XP_006589615.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Glycine 
max]
Length=770

 Score =   130 bits (328),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = +3

Query  99   VSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGE  278
             +E KA + EP VYA K EAK+AFKALLES NVGSDWTWD+++R I NDKRYGALK  GE
Sbjct  208  AAETKAVEPEPPVYANKMEAKDAFKALLESVNVGSDWTWDRSMRLIINDKRYGALKTLGE  267

Query  279  RKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            RKQAFNEYL QRKK EAEE+R++Q+KA+E+F KMLEES +LTSS RWS
Sbjct  268  RKQAFNEYLNQRKKQEAEEKRMKQKKAREDFKKMLEESTDLTSSARWS  315


 Score = 94.7 bits (234),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V+IFE+DERFKAVER+ DR D+F ++L +L  KE+AK QE+ +RN +EY+ FLE+C FI
Sbjct  317  AVSIFENDERFKAVERDRDRRDMFESFLEELLNKERAKVQEERKRNIMEYKKFLESCDFI  376

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  377  KASTQWRKVQDRL  389



>ref|XP_011030297.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like 
[Populus euphratica]
Length=1032

 Score =   129 bits (325),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEKA + EPL+YA K EAKN FKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  457  EEKAVNNEPLLYADKLEAKNLFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  516

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q++K EAEERR +Q+KA+EEF  MLEESKELT+S R S
Sbjct  517  QAFNEFLGQKRKQEAEERRTKQKKAREEFKNMLEESKELTASIRLS  562


 Score = 95.5 bits (236),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 59/80 (74%), Gaps = 7/80 (9%)
 Frame = +1

Query  418  GVTIFEDDER-------FKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXF  576
             VT+FE+DER       FKAVERE DR DL   YL +L++KE+AKAQE+ +RN +EYR F
Sbjct  564  AVTLFENDERXSCXKGKFKAVERERDRRDLIETYLQELEEKERAKAQEERKRNIMEYRQF  623

Query  577  LETCGFIKVDTQWRKVQDLL  636
            LE+C FIK  TQWRKVQD L
Sbjct  624  LESCEFIKASTQWRKVQDRL  643



>ref|XP_006393692.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
 gb|ESQ30978.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
Length=957

 Score =   125 bits (315),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  375  NLTPTGDKANVEEPMVYATKQEAKAAFKSLLESVNVQSDWTWEQTTKEIVHDKRYGALRT  434

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  435  LGERKQAFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSMKWS  485


 Score = 98.6 bits (244),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAVER+ DREDLF NY+V+L++KE+ KA E +R+   EYR FLETC +I
Sbjct  487  AMSLFENDERFKAVERQRDREDLFDNYIVELERKEREKAVEVHRQKMAEYRKFLETCDYI  546

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  547  KASTQWRKIQDRL  559



>ref|XP_006393693.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
 gb|ESQ30979.1| hypothetical protein EUTSA_v10011212mg [Eutrema salsugineum]
Length=958

 Score =   125 bits (315),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  376  NLTPTGDKANVEEPMVYATKQEAKAAFKSLLESVNVQSDWTWEQTTKEIVHDKRYGALRT  435

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  436  LGERKQAFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSMKWS  486


 Score = 98.6 bits (244),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAVER+ DREDLF NY+V+L++KE+ KA E +R+   EYR FLETC +I
Sbjct  488  AMSLFENDERFKAVERQRDREDLFDNYIVELERKEREKAVEVHRQKMAEYRKFLETCDYI  547

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  548  KASTQWRKIQDRL  560



>ref|XP_006352104.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Solanum 
tuberosum]
Length=1003

 Score =   128 bits (322),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  21   VVASSGVSSIQDIEMKKSTA-TNI-HVTVSEEKAADEEPLVYATKQEAKNAFKALLESAN  194
            V   +GVS     E+K+  A T I   T SEEK  +  PLVY +K EAKNAFK LLESAN
Sbjct  382  VACGNGVSPENREEVKQDAAITGIGSATPSEEKTVELGPLVYESKVEAKNAFKTLLESAN  441

Query  195  VGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFT  374
            +GSD TWDQ +RAI ND+RYGALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+E+F 
Sbjct  442  IGSDCTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSQRKKLEAEERRVKQKKAREDFR  501

Query  375  KMLEESKELTSSTRWS  422
             MLE+ KEL+ S+RWS
Sbjct  502  IMLEDCKELSPSSRWS  517


 Score = 95.9 bits (237),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE DERFKAVER  DREDLF +Y  +L+KKE+A+A E+ +RNRVEY  FL++C FI
Sbjct  519  AISIFELDERFKAVERAKDREDLFEDYKEELEKKERARALEEQKRNRVEYLEFLKSCDFI  578

Query  598  KVDTQWRKVQDLL  636
            K  +QWRKVQD L
Sbjct  579  KASSQWRKVQDRL  591



>ref|XP_006352103.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Solanum 
tuberosum]
Length=1003

 Score =   128 bits (322),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +3

Query  21   VVASSGVSSIQDIEMKKSTA-TNI-HVTVSEEKAADEEPLVYATKQEAKNAFKALLESAN  194
            V   +GVS     E+K+  A T I   T SEEK  +  PLVY +K EAKNAFK LLESAN
Sbjct  382  VACGNGVSPENREEVKQDAAITGIGSATPSEEKTVELGPLVYESKVEAKNAFKTLLESAN  441

Query  195  VGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFT  374
            +GSD TWDQ +RAI ND+RYGALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+E+F 
Sbjct  442  IGSDCTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSQRKKLEAEERRVKQKKAREDFR  501

Query  375  KMLEESKELTSSTRWS  422
             MLE+ KEL+ S+RWS
Sbjct  502  IMLEDCKELSPSSRWS  517


 Score = 95.9 bits (237),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE DERFKAVER  DREDLF +Y  +L+KKE+A+A E+ +RNRVEY  FL++C FI
Sbjct  519  AISIFELDERFKAVERAKDREDLFEDYKEELEKKERARALEEQKRNRVEYLEFLKSCDFI  578

Query  598  KVDTQWRKVQDLL  636
            K  +QWRKVQD L
Sbjct  579  KASSQWRKVQDRL  591



>ref|XP_010530462.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Tarenaya 
hassleriana]
Length=969

 Score =   125 bits (315),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  111  KAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQA  290
            K   EEPLVYATKQEAK AFK+LLES NV SDWTW+QT++ I ND+RYGAL+  GERKQA
Sbjct  392  KVNGEEPLVYATKQEAKAAFKSLLESVNVHSDWTWEQTMKEIVNDRRYGALRTVGERKQA  451

Query  291  FNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            FNEYL QRKK+EAEERR+RQ+KA+E F KMLEE +ELTS+ +WS
Sbjct  452  FNEYLGQRKKVEAEERRMRQKKARETFVKMLEECEELTSAMKWS  495


 Score = 97.4 bits (241),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE DERFKAVER  DRE+LF NY+++L+KKE+ KA E++RRN  EYR FLE C FI
Sbjct  497  AVSLFEIDERFKAVERTRDRENLFDNYILELEKKEREKAVEEHRRNMAEYRKFLEACDFI  556

Query  598  KVDTQWRKVQDLL  636
            KV +QWRKVQD L
Sbjct  557  KVTSQWRKVQDQL  569



>ref|XP_010530434.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530440.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530448.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530454.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Tarenaya 
hassleriana]
Length=975

 Score =   125 bits (314),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +3

Query  111  KAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQA  290
            K   EEPLVYATKQEAK AFK+LLES NV SDWTW+QT++ I ND+RYGAL+  GERKQA
Sbjct  392  KVNGEEPLVYATKQEAKAAFKSLLESVNVHSDWTWEQTMKEIVNDRRYGALRTVGERKQA  451

Query  291  FNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            FNEYL QRKK+EAEERR+RQ+KA+E F KMLEE +ELTS+ +WS
Sbjct  452  FNEYLGQRKKVEAEERRMRQKKARETFVKMLEECEELTSAMKWS  495


 Score = 97.4 bits (241),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE DERFKAVER  DRE+LF NY+++L+KKE+ KA E++RRN  EYR FLE C FI
Sbjct  497  AVSLFEIDERFKAVERTRDRENLFDNYILELEKKEREKAVEEHRRNMAEYRKFLEACDFI  556

Query  598  KVDTQWRKVQDLL  636
            KV +QWRKVQD L
Sbjct  557  KVTSQWRKVQDQL  569



>ref|XP_002891304.1| hypothetical protein ARALYDRAFT_891421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67563.1| hypothetical protein ARALYDRAFT_891421 [Arabidopsis lyrata subsp. 
lyrata]
Length=967

 Score =   125 bits (313),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  392  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  451

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  452  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSMKWS  496


 Score = 97.1 bits (240),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA E++R++  EYR FLETC +I
Sbjct  498  AMSLFENDERFKAVDRPRDREDLFDNYVVELERKEREKAAEEHRQHMAEYRKFLETCDYI  557

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+Q+ L
Sbjct  558  KAGTQWRKIQERL  570



>ref|XP_006306359.1| hypothetical protein CARUB_v10012256mg [Capsella rubella]
 gb|EOA39257.1| hypothetical protein CARUB_v10012256mg [Capsella rubella]
Length=966

 Score =   124 bits (312),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  391  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  450

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  451  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSMKWS  495


 Score = 97.1 bits (240),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA E +R+   EYR FLETC +I
Sbjct  497  AMTLFENDERFKAVDRSRDREDLFDNYIVELERKEREKAVEVHRQRMAEYRKFLETCDYI  556

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  557  KAGTQWRKIQDRL  569



>dbj|BAJ88075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=987

 Score =   136 bits (343),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S +D+E  K    TA  I+VT  E+K  +EEP+VYATK EAKNAFK+LLESANV SDW+
Sbjct  385  ASAEDLEEAKKTMPTAGKINVTPLEDKTIEEEPVVYATKLEAKNAFKSLLESANVQSDWS  444

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ +R I +DKRYGALK  GERKQAFNEYL QRKK+E EERR++QRKA+++F  MLEE 
Sbjct  445  WDQAMRVIISDKRYGALKTLGERKQAFNEYLNQRKKIEVEERRVKQRKARDDFLTMLEEC  504

Query  393  KELTSSTRWS  422
            K+LTSS RWS
Sbjct  505  KDLTSSMRWS  514


 Score = 83.6 bits (205),  Expect(2) = 2e-48, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+F  DERF AVER  +REDLF NYLV+LQKKEKAKA E+++R   EYR FLE+C FI
Sbjct  516  AITMFGHDERFNAVERPKEREDLFENYLVELQKKEKAKAAEEHKRRIAEYREFLESCDFI  575

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  576  KANTQWRKVQDRL  588



>gb|AAF78276.1|AC020576_20 Contains similarity to formin binding protein 11 from Mus musculus 
gb|AF135439 and contains multiple FF PF|01846 and WW PF|00397 
domains. EST gb|AI997587 comes from this gene [Arabidopsis 
thaliana]
Length=919

 Score =   125 bits (313),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  407  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  466

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  467  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSLKWS  511


 Score = 94.7 bits (234),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+D+RFKAV+R  DREDLF NY+V+L++KE+ KA E++R+   +YR FLETC +I
Sbjct  513  AMSLFENDQRFKAVDRPRDREDLFDNYIVELERKEREKAAEEHRQYMADYRKFLETCDYI  572

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  573  KAGTQWRKIQDRL  585



>ref|NP_175113.2| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
 sp|B6EUA9.1|PR40A_ARATH RecName: Full=Pre-mRNA-processing protein 40A; AltName: Full=Mediator 
of RNA polymerase II transcription subunit 35a [Arabidopsis 
thaliana]
 gb|AEE32062.1| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
Length=958

 Score =   124 bits (311),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  391  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  450

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  451  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSLKWS  495


 Score = 95.1 bits (235),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+D+RFKAV+R  DREDLF NY+V+L++KE+ KA E++R+   +YR FLETC +I
Sbjct  497  AMSLFENDQRFKAVDRPRDREDLFDNYIVELERKEREKAAEEHRQYMADYRKFLETCDYI  556

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  557  KAGTQWRKIQDRL  569



>ref|NP_001117438.1| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
 gb|AEE32063.1| pre-mRNA-processing protein 40A [Arabidopsis thaliana]
Length=926

 Score =   124 bits (312),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  391  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  450

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  451  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSLKWS  495


 Score = 94.7 bits (234),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+D+RFKAV+R  DREDLF NY+V+L++KE+ KA E++R+   +YR FLETC +I
Sbjct  497  AMSLFENDQRFKAVDRPRDREDLFDNYIVELERKEREKAAEEHRQYMADYRKFLETCDYI  556

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  557  KAGTQWRKIQDRL  569



>ref|XP_010313079.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Solanum 
lycopersicum]
Length=1044

 Score =   122 bits (307),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +3

Query  18   QVVASSGVSSIQDIEMKKSTA-TNI-HVTVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            +V    G S     E+K   A T I     SEEK  +  PLVY +K EAKNAF+ LLESA
Sbjct  380  EVACDDGASPDNREEVKHVAAITGIGSAAPSEEKTVELGPLVYESKVEAKNAFRTLLESA  439

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSD TWDQ +RAI ND+RYGALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+E+F
Sbjct  440  NIGSDCTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSQRKKLEAEERRVKQKKAREDF  499

Query  372  TKMLEESKELTSSTRWS  422
              MLE+ KEL+ S+RWS
Sbjct  500  RIMLEDCKELSPSSRWS  516


 Score = 96.3 bits (238),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            ++IFE DERFKAVER  DREDLF +Y  +L+KKE+A+A E+ +RNRVEY  FL++C FIK
Sbjct  519  ISIFEHDERFKAVERAKDREDLFEDYKEELEKKERARALEEQKRNRVEYLEFLKSCDFIK  578

Query  601  VDTQWRKVQDLL  636
              +QWRKVQD L
Sbjct  579  ASSQWRKVQDRL  590



>ref|XP_004250825.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Solanum 
lycopersicum]
Length=1044

 Score =   122 bits (307),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +3

Query  18   QVVASSGVSSIQDIEMKKSTA-TNI-HVTVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            +V    G S     E+K   A T I     SEEK  +  PLVY +K EAKNAF+ LLESA
Sbjct  380  EVACDDGASPDNREEVKHVAAITGIGSAAPSEEKTVELGPLVYESKVEAKNAFRTLLESA  439

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSD TWDQ +RAI ND+RYGALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+E+F
Sbjct  440  NIGSDCTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSQRKKLEAEERRVKQKKAREDF  499

Query  372  TKMLEESKELTSSTRWS  422
              MLE+ KEL+ S+RWS
Sbjct  500  RIMLEDCKELSPSSRWS  516


 Score = 96.3 bits (238),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            ++IFE DERFKAVER  DREDLF +Y  +L+KKE+A+A E+ +RNRVEY  FL++C FIK
Sbjct  519  ISIFEHDERFKAVERAKDREDLFEDYKEELEKKERARALEEQKRNRVEYLEFLKSCDFIK  578

Query  601  VDTQWRKVQDLL  636
              +QWRKVQD L
Sbjct  579  ASSQWRKVQDRL  590



>ref|XP_010313077.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Solanum 
lycopersicum]
Length=1045

 Score =   122 bits (307),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = +3

Query  18   QVVASSGVSSIQDIEMKKSTA-TNI-HVTVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            +V    G S     E+K   A T I     SEEK  +  PLVY +K EAKNAF+ LLESA
Sbjct  381  EVACDDGASPDNREEVKHVAAITGIGSAAPSEEKTVELGPLVYESKVEAKNAFRTLLESA  440

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSD TWDQ +RAI ND+RYGALK  GERKQAFNEYL QRKKLEAEERR++Q+KA+E+F
Sbjct  441  NIGSDCTWDQAMRAIINDRRYGALKSLGERKQAFNEYLSQRKKLEAEERRVKQKKAREDF  500

Query  372  TKMLEESKELTSSTRWS  422
              MLE+ KEL+ S+RWS
Sbjct  501  RIMLEDCKELSPSSRWS  517


 Score = 96.3 bits (238),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            ++IFE DERFKAVER  DREDLF +Y  +L+KKE+A+A E+ +RNRVEY  FL++C FIK
Sbjct  520  ISIFEHDERFKAVERAKDREDLFEDYKEELEKKERARALEEQKRNRVEYLEFLKSCDFIK  579

Query  601  VDTQWRKVQDLL  636
              +QWRKVQD L
Sbjct  580  ASSQWRKVQDRL  591



>ref|XP_010095738.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
 gb|EXB62121.1| Pre-mRNA-processing factor 40-A-like protein [Morus notabilis]
Length=964

 Score =   125 bits (313),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            E+   D EPLVYA K +AKNAF  L+ESAN+GSDWTWD+ +R I NDKRYGALK  GERK
Sbjct  390  EDIVVDREPLVYANKLDAKNAFMTLMESANIGSDWTWDRAMRVIINDKRYGALKTLGERK  449

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNE+L QRKK EAEERR+RQ+KA+EEF +MLEES ELTSS RWS
Sbjct  450  HAFNEFLGQRKKQEAEERRIRQKKAREEFKRMLEESAELTSSIRWS  495


 Score = 94.0 bits (232),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE DERF+AVER+ DR+DLF NY+ +L+KKE+AK QE+ +R  +EYR FLE+C FIK 
Sbjct  499  SLFEKDERFRAVERDRDRKDLFDNYIEELKKKERAKEQEERKRKIIEYRQFLESCDFIKA  558

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  559  SSQWRKVQDRL  569



>dbj|BAH19565.1| AT1G44910 [Arabidopsis thaliana]
Length=826

 Score =   124 bits (311),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  391  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  450

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  451  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSLKWS  495


 Score = 94.7 bits (234),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+D+RFKAV+R  DREDLF NY+V+L++KE+ KA E++R+   +YR FLETC +I
Sbjct  497  AMSLFENDQRFKAVDRPRDREDLFDNYIVELERKEREKAAEEHRQYMADYRKFLETCDYI  556

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  557  KAGTQWRKIQDRL  569



>ref|XP_009124532.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Brassica 
rapa]
Length=926

 Score =   122 bits (306),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP++YATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  347  NMTPAGDKANVEEPMMYATKQEAKAAFKSLLESVNVQSDWTWEQTTKEIVHDKRYGALRT  406

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  407  LGERKQAFNEYLGQRKKVEAEERRWRQKKAREEFVKMLEECEELSSSMKWS  457


 Score = 95.5 bits (236),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA  ++R+   EYR FLETC +I
Sbjct  459  ALSLFENDERFKAVDRPRDREDLFDNYIVELERKEREKAVAEHRQKMAEYRKFLETCDYI  518

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  519  KASTQWRKIQDRL  531



>ref|XP_009124533.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Brassica 
rapa]
Length=924

 Score =   122 bits (306),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP++YATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  347  NMTPAGDKANVEEPMMYATKQEAKAAFKSLLESVNVQSDWTWEQTTKEIVHDKRYGALRT  406

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  407  LGERKQAFNEYLGQRKKVEAEERRWRQKKAREEFVKMLEECEELSSSMKWS  457


 Score = 95.5 bits (236),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA  ++R+   EYR FLETC +I
Sbjct  459  ALSLFENDERFKAVDRPRDREDLFDNYIVELERKEREKAVAEHRQKMAEYRKFLETCDYI  518

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  519  KASTQWRKIQDRL  531



>ref|XP_009124535.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Brassica 
rapa]
Length=918

 Score =   122 bits (306),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP++YATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  339  NMTPAGDKANVEEPMMYATKQEAKAAFKSLLESVNVQSDWTWEQTTKEIVHDKRYGALRT  398

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  399  LGERKQAFNEYLGQRKKVEAEERRWRQKKAREEFVKMLEECEELSSSMKWS  449


 Score = 95.5 bits (236),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA  ++R+   EYR FLETC +I
Sbjct  451  ALSLFENDERFKAVDRPRDREDLFDNYIVELERKEREKAVAEHRQKMAEYRKFLETCDYI  510

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  511  KASTQWRKIQDRL  523



>ref|XP_010520792.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A 
[Tarenaya hassleriana]
Length=957

 Score =   117 bits (293),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +K   +EPL+YATKQEAK AFK LLES NV SDWTW+Q ++ I ND+RY AL+  GERKQ
Sbjct  394  DKVNGDEPLMYATKQEAKAAFKHLLESVNVQSDWTWEQAMKEIVNDRRYSALRTLGERKQ  453

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK+EAEERR+RQ+KA+E+F KMLEE +EL+SS +WS
Sbjct  454  AFNEYLGQRKKVEAEERRMRQKKAREDFVKMLEECEELSSSMKWS  498


 Score = 99.8 bits (247),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DRE LF NY++DL+KKE+ KA E++R+N  EYR FLETC FI
Sbjct  500  AVSLFENDERFKAVERTRDREALFENYMLDLEKKEREKAVEEHRQNMAEYRKFLETCDFI  559

Query  598  KVDTQWRKVQDLL  636
            KV +QWRKV++LL
Sbjct  560  KVTSQWRKVEELL  572



>ref|XP_011092479.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092480.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092481.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092482.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092483.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092484.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092485.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092486.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
 ref|XP_011092487.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X1 [Sesamum 
indicum]
Length=1065

 Score =   127 bits (320),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 99/143 (69%), Gaps = 4/143 (3%)
 Frame = +3

Query  6    NSSPQVVASSGVSSIQDIEMKKSTATNIHVT----VSEEKAADEEPLVYATKQEAKNAFK  173
            N SPQ  A S V +  +      T+  I  +      E K  +  PLVY +K+ AKNAFK
Sbjct  459  NKSPQDAAPSSVDTFAESVEGADTSAGISGSGGNNAPEVKKVEHGPLVYESKEGAKNAFK  518

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE+ANVG DW WDQ +R I ND+RYGALK  GERKQ FNE++ Q+KK EAEE+R RQ+
Sbjct  519  ALLETANVGPDWNWDQAMRVIINDRRYGALKTLGERKQTFNEFIGQKKKQEAEEKRARQK  578

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KA+E F KML+ESK+LTSSTRWS
Sbjct  579  KARENFKKMLQESKDLTSSTRWS  601


 Score = 89.4 bits (220),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE DERF+AVER  DREDLF ++L +L++KE+AKA E+++R++ EY  FL++C FI
Sbjct  603  AISMFEKDERFQAVERAKDREDLFEDHLEELKRKERAKALEEHKRHKAEYLEFLKSCDFI  662

Query  598  KVDTQWRKVQDLL  636
            K  +QWRKVQ+ L
Sbjct  663  KASSQWRKVQNRL  675



>ref|XP_007143139.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15133.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
Length=772

 Score =   125 bits (315),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            HV  +E KA + E L++A K EAK+AFKALLESANVGSDWTWD+ +R I NDKRYGALK 
Sbjct  207  HV-AAETKAVEPETLIFANKMEAKDAFKALLESANVGSDWTWDRAMRLIINDKRYGALKT  265

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
              ERKQAFNEYL QRKK E EE+R++Q+KA+E+F KMLEES +L SSTRWS
Sbjct  266  LSERKQAFNEYLNQRKKHEGEEKRMKQKKAREDFKKMLEESTDLASSTRWS  316


 Score = 90.9 bits (224),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE+DERFKAVER+ DR D+F  +L +L  KE+A+ QE+ +RN +EY+ FLE+C FI
Sbjct  318  AMSIFENDERFKAVERDRDRRDMFEIFLEELLNKERARVQEERKRNIMEYKKFLESCDFI  377

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  378  KASTQWRKVQDRL  390



>gb|KCW63560.1| hypothetical protein EUGRSUZ_G01189 [Eucalyptus grandis]
Length=859

 Score =   124 bits (312),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 12/137 (9%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHV------TVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            S+GVS +QD E K     NI V      T+ EEK  + EP  YATK EAK AF ALLE+A
Sbjct  435  SAGVS-VQDKEAK-----NIEVSAEGAETLVEEKLTNSEPSPYATKLEAKAAFNALLENA  488

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSDWTW++ +R I NDKRYGALK  GERK+AFNE++ QRKK +AE RR +Q+KA++ F
Sbjct  489  NIGSDWTWERAMRIIINDKRYGALKTLGERKEAFNEFVGQRKKQDAEGRRFQQKKARDNF  548

Query  372  TKMLEESKELTSSTRWS  422
             +MLEE +ELTSS+RWS
Sbjct  549  KQMLEECRELTSSSRWS  565


 Score = 91.7 bits (226),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            VT+FE+DERFKA+ER+ DR+D+F +++V+L+KKE+ ++ E+ ++N  EYR FLE+C FIK
Sbjct  568  VTLFEEDERFKAIERDKDRKDIFESFIVELEKKERERSLEERKKNMREYRQFLESCDFIK  627

Query  601  VDTQWRKVQDLL  636
              +QWRK+QD L
Sbjct  628  ASSQWRKLQDRL  639



>gb|KCW63559.1| hypothetical protein EUGRSUZ_G01189 [Eucalyptus grandis]
Length=989

 Score =   124 bits (312),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 12/137 (9%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHV------TVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            S+GVS +QD E K     NI V      T+ EEK  + EP  YATK EAK AF ALLE+A
Sbjct  435  SAGVS-VQDKEAK-----NIEVSAEGAETLVEEKLTNSEPSPYATKLEAKAAFNALLENA  488

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSDWTW++ +R I NDKRYGALK  GERK+AFNE++ QRKK +AE RR +Q+KA++ F
Sbjct  489  NIGSDWTWERAMRIIINDKRYGALKTLGERKEAFNEFVGQRKKQDAEGRRFQQKKARDNF  548

Query  372  TKMLEESKELTSSTRWS  422
             +MLEE +ELTSS+RWS
Sbjct  549  KQMLEECRELTSSSRWS  565


 Score = 91.7 bits (226),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            VT+FE+DERFKA+ER+ DR+D+F +++V+L+KKE+ ++ E+ ++N  EYR FLE+C FIK
Sbjct  568  VTLFEEDERFKAIERDKDRKDIFESFIVELEKKERERSLEERKKNMREYRQFLESCDFIK  627

Query  601  VDTQWRKVQDLL  636
              +QWRK+QD L
Sbjct  628  ASSQWRKLQDRL  639



>ref|XP_010065860.1| PREDICTED: pre-mRNA-processing protein 40A-like [Eucalyptus grandis]
 gb|KCW63558.1| hypothetical protein EUGRSUZ_G01189 [Eucalyptus grandis]
Length=1026

 Score =   124 bits (311),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 12/137 (9%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHV------TVSEEKAADEEPLVYATKQEAKNAFKALLESA  191
            S+GVS +QD E K     NI V      T+ EEK  + EP  YATK EAK AF ALLE+A
Sbjct  435  SAGVS-VQDKEAK-----NIEVSAEGAETLVEEKLTNSEPSPYATKLEAKAAFNALLENA  488

Query  192  NVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeF  371
            N+GSDWTW++ +R I NDKRYGALK  GERK+AFNE++ QRKK +AE RR +Q+KA++ F
Sbjct  489  NIGSDWTWERAMRIIINDKRYGALKTLGERKEAFNEFVGQRKKQDAEGRRFQQKKARDNF  548

Query  372  TKMLEESKELTSSTRWS  422
             +MLEE +ELTSS+RWS
Sbjct  549  KQMLEECRELTSSSRWS  565


 Score = 91.7 bits (226),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            VT+FE+DERFKA+ER+ DR+D+F +++V+L+KKE+ ++ E+ ++N  EYR FLE+C FIK
Sbjct  568  VTLFEEDERFKAIERDKDRKDIFESFIVELEKKERERSLEERKKNMREYRQFLESCDFIK  627

Query  601  VDTQWRKVQDLL  636
              +QWRK+QD L
Sbjct  628  ASSQWRKLQDRL  639



>ref|XP_007143137.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 ref|XP_007143138.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15131.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15132.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
Length=1019

 Score =   126 bits (316),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            HV  +E KA + E L++A K EAK+AFKALLESANVGSDWTWD+ +R I NDKRYGALK 
Sbjct  454  HV-AAETKAVEPETLIFANKMEAKDAFKALLESANVGSDWTWDRAMRLIINDKRYGALKT  512

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
              ERKQAFNEYL QRKK E EE+R++Q+KA+E+F KMLEES +L SSTRWS
Sbjct  513  LSERKQAFNEYLNQRKKHEGEEKRMKQKKAREDFKKMLEESTDLASSTRWS  563


 Score = 89.7 bits (221),  Expect(2) = 3e-47, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE+DERFKAVER+ DR D+F  +L +L  KE+A+ QE+ +RN +EY+ FLE+C FI
Sbjct  565  AMSIFENDERFKAVERDRDRRDMFEIFLEELLNKERARVQEERKRNIMEYKKFLESCDFI  624

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  625  KASTQWRKVQDRL  637



>ref|XP_007143140.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
 gb|ESW15134.1| hypothetical protein PHAVU_007G047100g [Phaseolus vulgaris]
Length=1020

 Score =   126 bits (316),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            HV  +E KA + E L++A K EAK+AFKALLESANVGSDWTWD+ +R I NDKRYGALK 
Sbjct  454  HV-AAETKAVEPETLIFANKMEAKDAFKALLESANVGSDWTWDRAMRLIINDKRYGALKT  512

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
              ERKQAFNEYL QRKK E EE+R++Q+KA+E+F KMLEES +L SSTRWS
Sbjct  513  LSERKQAFNEYLNQRKKHEGEEKRMKQKKAREDFKKMLEESTDLASSTRWS  563


 Score = 89.7 bits (221),  Expect(2) = 3e-47, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             ++IFE+DERFKAVER+ DR D+F  +L +L  KE+A+ QE+ +RN +EY+ FLE+C FI
Sbjct  565  AMSIFENDERFKAVERDRDRRDMFEIFLEELLNKERARVQEERKRNIMEYKKFLESCDFI  624

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  625  KASTQWRKVQDRL  637



>emb|CDY12575.1| BnaC06g01010D [Brassica napus]
Length=610

 Score =   122 bits (306),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP++YATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  37   NMTPAGDKANVEEPMMYATKQEAKAAFKSLLESVNVQSDWTWEQTTKVIVHDKRYGALRT  96

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  97   LGERKQAFNEYLGQRKKVEAEERRWRQKKAREEFVKMLEECEELSSSMKWS  147


 Score = 93.2 bits (230),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA  ++R+   EYR FLETC +I
Sbjct  149  ALSLFENDERFKAVDRPRDREDLFDNYIVELERKEREKAVAEHRQKMAEYRKFLETCDYI  208

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  209  KASTQWRKIQDRL  221



>emb|CDY47957.1| BnaA10g28290D [Brassica napus]
Length=647

 Score =   122 bits (306),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +3

Query  90   HVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKI  269
            ++T + +KA  EEP++YATKQEAK AFK+LLES NV SDWTW+QT + I +DKRYGAL+ 
Sbjct  37   NMTPAGDKANVEEPMMYATKQEAKAAFKSLLESVNVQSDWTWEQTTKEIVHDKRYGALRT  96

Query  270  HGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             GERKQAFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +WS
Sbjct  97   LGERKQAFNEYLGQRKKVEAEERRWRQKKAREEFVKMLEECEELSSSMKWS  147


 Score = 92.8 bits (229),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DERFKAV+R  DREDLF NY+V+L++KE+ KA  ++R+   EYR FLETC +I
Sbjct  149  ALSLFENDERFKAVDRPRDREDLFDNYIVELERKEREKAVVEHRQKMAEYRKFLETCDYI  208

Query  598  KVDTQWRKVQDLL  636
            K  TQWRK+QD L
Sbjct  209  KASTQWRKIQDRL  221



>ref|XP_011457824.1| PREDICTED: pre-mRNA-processing protein 40A-like [Fragaria vesca 
subsp. vesca]
Length=1031

 Score =   129 bits (323),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = +3

Query  99   VSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGE  278
            ++EEK  D EP+ Y+ K EAK+AFKALLES N+GSDWTWD+ +R I NDKRYG LK  GE
Sbjct  441  IAEEKPIDLEPMSYSNKLEAKDAFKALLESTNIGSDWTWDRAMRVIINDKRYGVLKTLGE  500

Query  279  RKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            RKQAFNE++ QRKK E EERR++Q+KA+EEFTKMLEE  ELTSSTRW
Sbjct  501  RKQAFNEFVGQRKKQEVEERRIKQKKAREEFTKMLEECSELTSSTRW  547


 Score = 85.5 bits (210),  Expect(2) = 9e-47, Method: Composition-based stats.
 Identities = 47/71 (66%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            ++FE+DERFKAVER+ DR DLF +YL +LQKKE+AKAQE+ + + VEYR FLE+C FIK 
Sbjct  552  SLFENDERFKAVERDRDRRDLFDSYLEELQKKERAKAQEERKLHIVEYRQFLESCDFIKA  611

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  612  SSQWRKVQDRL  622



>ref|XP_008236261.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A-like 
[Prunus mume]
Length=1009

 Score =   117 bits (293),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +3

Query  24   VASSGVSSIQDIE--MKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANV  197
            V+S+ V  +Q+ E      T   I+   SEEK  D EP+ Y  K EAK+AFKALL S N+
Sbjct  411  VSSADVVPVQENEEATDDVTGKKINDISSEEKPVDREPISYENKLEAKDAFKALLVSTNI  470

Query  198  GSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTK  377
            GSDWTWD+ +R I NDKRYGALK  GERKQAFNE+L+QRKK EAEERR++Q+KA+EEF K
Sbjct  471  GSDWTWDRAMRVIINDKRYGALKTLGERKQAFNEFLVQRKKQEAEERRIKQKKAREEFKK  530

Query  378  MLEESKELTSSTRW  419
            MLE S     STRW
Sbjct  531  MLEVS--YVPSTRW  542


 Score = 96.7 bits (239),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE DERF+AVER+ DR D+F NY+ +LQKKE+AKA E+ + N +EYR FLE+C FIK 
Sbjct  547  SIFEHDERFRAVERDRDRRDMFENYVEELQKKERAKAMEERKHNIMEYRQFLESCDFIKA  606

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  607  SSQWRKVQDRL  617



>ref|XP_008380122.1| PREDICTED: pre-mRNA-processing protein 40A-like [Malus domestica]
Length=1031

 Score =   150 bits (379),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 111/140 (79%), Gaps = 5/140 (4%)
 Frame = +3

Query  18   QVVASSGVSSI--QDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALL  182
            Q +ASS       QDIE  K   + A  ++VT SEEK  D+EPLVYA KQEAK AFK+LL
Sbjct  417  QDIASSAADGTLTQDIEEAKRGMAVAGKVNVTPSEEKTFDDEPLVYANKQEAKTAFKSLL  476

Query  183  ESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkak  362
            ESANV SDWTW+QT+R I  DKRYGALK  GERKQAFNEYL QRKKLE EERR+RQ+KA+
Sbjct  477  ESANVQSDWTWEQTMREIITDKRYGALKTLGERKQAFNEYLGQRKKLENEERRMRQKKAR  536

Query  363  eeFTKMLEESKELTSSTRWS  422
            EEFTKMLEES+ELTS+TRWS
Sbjct  537  EEFTKMLEESRELTSATRWS  556


 Score = 62.0 bits (149),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 18/73 (25%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V++FE+DERFKAVER  DREDL+ +Y+V+L++KEK KA E++++N              
Sbjct  558  AVSMFENDERFKAVERARDREDLYESYIVELERKEKQKAAEEHKQN--------------  603

Query  598  KVDTQWRKVQDLL  636
                 WRKVQD L
Sbjct  604  ----IWRKVQDRL  612



>ref|XP_006343435.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X3 [Solanum 
tuberosum]
Length=864

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +S QDIE  K   + A  I+V  +EEK+ADEEP +YATKQEAKNAFK
Sbjct  387  ENLSPQVASSLSGASSQDIEEAKKGMAVAGKINVVPAEEKSADEEPFLYATKQEAKNAFK  446

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERRLRQR
Sbjct  447  ALLESANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRLRQR  506

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKELTSSTRWS
Sbjct  507  KAKEEFTKMLEESKELTSSTRWS  529


 Score =   136 bits (343),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  501  RRLRQRKAKEEFTKMLEESKELTSSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  556

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE++KAQE+YRRNR+EY+ FLETCGFIKVDTQWRKVQDLL
Sbjct  557  YLVDLQKKERSKAQEEYRRNRLEYKQFLETCGFIKVDTQWRKVQDLL  603



>ref|XP_006343434.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Solanum 
tuberosum]
Length=872

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 120/143 (84%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +S QDIE  K   + A  I+V  +EEK+ADEEP +YATKQEAKNAFK
Sbjct  387  ENLSPQVASSLSGASSQDIEEAKKGMAVAGKINVVPAEEKSADEEPFLYATKQEAKNAFK  446

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLESANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERRLRQR
Sbjct  447  ALLESANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRLRQR  506

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKELTSSTRWS
Sbjct  507  KAKEEFTKMLEESKELTSSTRWS  529


 Score =   135 bits (341),  Expect = 8e-33, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  501  RRLRQRKAKEEFTKMLEESKELTSSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  556

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE++KAQE+YRRNR+EY+ FLETCGFIKVDTQWRKVQDLL
Sbjct  557  YLVDLQKKERSKAQEEYRRNRLEYKQFLETCGFIKVDTQWRKVQDLL  603



>gb|KEH44000.1| pre-mRNA-processing 40A-like protein [Medicago truncatula]
Length=1008

 Score =   124 bits (312),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = +3

Query  72   STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKR  251
            S   N++   SE K+ + E  VYA K EAK+AFKALLES NVGSDW W++ +R I NDKR
Sbjct  438  SIGENVNDVASETKSVEPESFVYANKMEAKDAFKALLESVNVGSDWNWERAMRLIINDKR  497

Query  252  YGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            YGALK  GERKQAFNEYL QRKK EAEE+R++ +KA+E+F KMLEES ELTSS R+S
Sbjct  498  YGALKSLGERKQAFNEYLSQRKKQEAEEKRMKHKKAREDFRKMLEESTELTSSIRYS  554


 Score = 87.0 bits (214),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             + IFE+D+RFKAVERE DR+D+  ++L +L  KE+AK  E+ +RN VEYR FLE+C FI
Sbjct  556  AIAIFENDDRFKAVERERDRKDMIESFLEELLNKERAKVLEERKRNTVEYRKFLESCDFI  615

Query  598  KVDTQWRKVQDLL  636
            K +TQ+RKVQD L
Sbjct  616  KANTQYRKVQDRL  628



>emb|CDO97301.1| unnamed protein product [Coffea canephora]
Length=871

 Score =   125 bits (315),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +GVS     E KK    +     SEEK  ++ PLVY  K EAK AFKALLE+ NVGSDWT
Sbjct  418  AGVSPGNSEEAKKDIKDSAR---SEEKTVEQGPLVYENKLEAKTAFKALLETENVGSDWT  474

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            WDQ +R I ND+RYGALK  GERKQAFNE+  Q+KK EAEERR RQ+KA+E+F KMLEE 
Sbjct  475  WDQAMRVIINDRRYGALKSLGERKQAFNEFASQKKKQEAEERRARQKKAREDFKKMLEEC  534

Query  393  KELTSSTRWS  422
            KELT S RWS
Sbjct  535  KELTPSIRWS  544


 Score = 84.7 bits (208),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 59/111 (53%), Gaps = 38/111 (34%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKK--------------------------  519
             ++IFEDDERFKAVER  DREDLF NY  +L+KK                          
Sbjct  546  AISIFEDDERFKAVERAKDREDLFENYKEELEKKVHSNLIYRFTNQLNSNEFVSDTIFFF  605

Query  520  ------------EKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
                        E+AKA E+ +RNRVEY  FL++C FIK  +QWRKVQD L
Sbjct  606  HCCYGLRASPVMERAKAMEEQKRNRVEYLEFLKSCDFIKASSQWRKVQDRL  656



>ref|XP_002885323.1| FF domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61582.1| FF domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=960

 Score =   113 bits (283),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            +EEK  ++E   +  K EA + FK+LL+SANVGSDWTW+Q +R I ND+RYGAL+  GER
Sbjct  403  TEEKQINQENFSFNNKSEAGDVFKSLLKSANVGSDWTWEQAMREIINDRRYGALRTLGER  462

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L+Q K+   EER  RQRK  E+F +MLEE  ELT STRWS
Sbjct  463  KQAFNEFLLQTKRAAEEERLARQRKRYEDFKRMLEECVELTPSTRWS  509


 Score = 96.7 bits (239),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKA+ERE DR ++F +++ +L++KE+ KA ED +RN +EYR FLE+C FI
Sbjct  511  AVTMFEDDERFKALEREKDRRNIFEDHVSELKEKERVKALEDRKRNIIEYRRFLESCNFI  570

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  571  KPNSQWRKVQDRL  583



>emb|CDY51697.1| BnaA05g36840D [Brassica napus]
Length=994

 Score =   110 bits (276),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            SE K   +E + Y  K EA + FK+LL+SANVGSDWTW+Q +R I ND+RYG L+  GER
Sbjct  435  SEGKQIHQENISYTNKSEAVDVFKSLLKSANVGSDWTWEQAMREIINDRRYGVLRTLGER  494

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L Q +K   EE+  RQ K  E+F +MLEES ELT STRWS
Sbjct  495  KQAFNEFLAQMRKAAEEEKIARQLKRYEDFRRMLEESVELTPSTRWS  541


 Score = 96.3 bits (238),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+ EDDERFK VERE DR ++F +++ DL++KE+ KA ED +RN VEYR FLE+C FI
Sbjct  543  AVTMLEDDERFKVVEREKDRRNIFEDHISDLKEKERVKAFEDRKRNIVEYRRFLESCNFI  602

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  603  KPNSQWRKVQDRL  615



>ref|XP_010692587.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=813

 Score =   133 bits (334),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            EK AD+EPLV+A+KQEAK AFK+LLESANV SDWTWDQ +R I NDKRYGALK  GERKQ
Sbjct  214  EKPADDEPLVFASKQEAKAAFKSLLESANVQSDWTWDQAMRVIVNDKRYGALKTLGERKQ  273

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK EAEERR+RQ+KAKEEF KMLEES+ LTSS +WS
Sbjct  274  AFNEYLGQRKKQEAEERRMRQKKAKEEFMKMLEESEVLTSSIKWS  318


 Score = 72.8 bits (177),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERFKAVE+  DR++LF NYLV+LQKKEK KA+E+YRRNR EY  FLE+C FI
Sbjct  320  AITMFEDDERFKAVEKPKDRQELFENYLVELQKKEKEKAEEEYRRNREEYWKFLESCDFI  379

Query  598  KVDTQWRKVQDLL  636
            + ++ WRKVQD L
Sbjct  380  EANSLWRKVQDRL  392



>ref|XP_010692586.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1019

 Score =   133 bits (335),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            EK AD+EPLV+A+KQEAK AFK+LLESANV SDWTWDQ +R I NDKRYGALK  GERKQ
Sbjct  420  EKPADDEPLVFASKQEAKAAFKSLLESANVQSDWTWDQAMRVIVNDKRYGALKTLGERKQ  479

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            AFNEYL QRKK EAEERR+RQ+KAKEEF KMLEES+ LTSS +WS
Sbjct  480  AFNEYLGQRKKQEAEERRMRQKKAKEEFMKMLEESEVLTSSIKWS  524


 Score = 71.6 bits (174),  Expect(2) = 5e-44, Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERFKAVE+  DR++LF NYLV+LQKKEK KA+E+YRRNR EY  FLE+C FI
Sbjct  526  AITMFEDDERFKAVEKPKDRQELFENYLVELQKKEKEKAEEEYRRNREEYWKFLESCDFI  585

Query  598  KVDTQWRKVQDLL  636
            + ++ WRKVQD L
Sbjct  586  EANSLWRKVQDRL  598



>ref|XP_009145760.1| PREDICTED: pre-mRNA-processing protein 40B isoform X2 [Brassica 
rapa]
Length=824

 Score =   110 bits (276),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            SE K   +E + Y  K EA + FK+LL+SANVGSDWTW+Q +R I ND+RYG L+  GER
Sbjct  434  SEGKQIHQENISYTNKSEAVDVFKSLLKSANVGSDWTWEQAMREIINDRRYGVLRTLGER  493

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L Q +K   EE+  RQ K  E+F +MLEES ELT STRWS
Sbjct  494  KQAFNEFLAQMRKAAEEEKIARQLKRYEDFRRMLEESVELTPSTRWS  540


 Score = 93.6 bits (231),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+ EDDERFK VERE DR ++F +++ DL++KE+ KA  D +RN VEYR FLE+C FI
Sbjct  542  AVTMLEDDERFKVVEREKDRRNIFEDHISDLKEKERVKAFGDRKRNIVEYRRFLESCNFI  601

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  602  KPNSQWRKVQDRL  614



>ref|XP_009145759.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Brassica 
rapa]
Length=993

 Score =   110 bits (275),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            SE K   +E + Y  K EA + FK+LL+SANVGSDWTW+Q +R I ND+RYG L+  GER
Sbjct  434  SEGKQIHQENISYTNKSEAVDVFKSLLKSANVGSDWTWEQAMREIINDRRYGVLRTLGER  493

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L Q +K   EE+  RQ K  E+F +MLEES ELT STRWS
Sbjct  494  KQAFNEFLAQMRKAAEEEKIARQLKRYEDFRRMLEESVELTPSTRWS  540


 Score = 93.6 bits (231),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+ EDDERFK VERE DR ++F +++ DL++KE+ KA  D +RN VEYR FLE+C FI
Sbjct  542  AVTMLEDDERFKVVEREKDRRNIFEDHISDLKEKERVKAFGDRKRNIVEYRRFLESCNFI  601

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  602  KPNSQWRKVQDRL  614



>ref|XP_009606231.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Nicotiana 
tomentosiformis]
Length=1042

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  397  ENLSPQVASSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  456

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  457  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  516

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  517  KAKEEFTKMLEESKELISSTRWS  539


 Score =   130 bits (327),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  511  RRHRQRKAKEEFTKMLEESKELISSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  566

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE+AKAQE+YR NR+EYR FLETCGFIKVDTQWRKVQDLL
Sbjct  567  YLVDLQKKERAKAQEEYRHNRLEYRQFLETCGFIKVDTQWRKVQDLL  613



>ref|XP_009606230.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Nicotiana 
tomentosiformis]
Length=1050

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  405  ENLSPQVASSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  464

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  465  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  524

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  525  KAKEEFTKMLEESKELISSTRWS  547


 Score =   130 bits (328),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  519  RRHRQRKAKEEFTKMLEESKELISSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  574

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE+AKAQE+YR NR+EYR FLETCGFIKVDTQWRKVQDLL
Sbjct  575  YLVDLQKKERAKAQEEYRHNRLEYRQFLETCGFIKVDTQWRKVQDLL  621



>ref|XP_009606232.1| PREDICTED: pre-mRNA-processing protein 40A isoform X3 [Nicotiana 
tomentosiformis]
Length=1042

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  397  ENLSPQVASSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  456

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  457  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  516

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  517  KAKEEFTKMLEESKELISSTRWS  539


 Score =   130 bits (327),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  511  RRHRQRKAKEEFTKMLEESKELISSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  566

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE+AKAQE+YR NR+EYR FLETCGFIKVDTQWRKVQDLL
Sbjct  567  YLVDLQKKERAKAQEEYRHNRLEYRQFLETCGFIKVDTQWRKVQDLL  613



>gb|KJB63967.1| hypothetical protein B456_010G027200 [Gossypium raimondii]
Length=675

 Score =   152 bits (385),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 109/130 (84%), Gaps = 3/130 (2%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  386  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  445

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEES  392
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEES
Sbjct  446  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEES  505

Query  393  KELTSSTRWS  422
            KELTSS RWS
Sbjct  506  KELTSSMRWS  515


 Score = 50.4 bits (119),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNR  558
            ++FE+DERFKAVER  DREDLF NY+VDL++K++ + + +  ++R
Sbjct  519  SLFENDERFKAVERARDREDLFENYIVDLERKKEREREREKGKDR  563



>ref|XP_009765765.1| PREDICTED: pre-mRNA-processing protein 40A isoform X2 [Nicotiana 
sylvestris]
Length=1044

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  398  ENLSPQVSSSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  457

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  458  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  517

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  518  KAKEEFTKMLEESKELISSTRWS  540


 Score =   130 bits (327),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  512  RRHRQRKAKEEFTKMLEESKELISSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  567

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE+AKAQE+YR+NR+EYR FLETCGFIKVDTQWRKVQDLL
Sbjct  568  YLVDLQKKERAKAQEEYRQNRLEYRHFLETCGFIKVDTQWRKVQDLL  614



>ref|XP_009765764.1| PREDICTED: pre-mRNA-processing protein 40A isoform X1 [Nicotiana 
sylvestris]
Length=1052

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  3    ENSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFK  173
            EN SPQV +S   +SIQDIE  K   + A  ++V  +EEK  +EEP +YATKQEAKNAFK
Sbjct  406  ENLSPQVSSSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFK  465

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE ANV SDWTW+QT+R I NDKRYGALK  GERKQAFNEYLMQRKK EAEERR RQR
Sbjct  466  ALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQR  525

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KAKEEFTKMLEESKEL SSTRWS
Sbjct  526  KAKEEFTKMLEESKELISSTRWS  548


 Score =   130 bits (328),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 81/107 (76%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  R R+   +  K    S+    S R        VT+FEDDERFKAVEREADREDLFRN
Sbjct  520  RRHRQRKAKEEFTKMLEESKELISSTR----WSKAVTMFEDDERFKAVEREADREDLFRN  575

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            YLVDLQKKE+AKAQE+YR+NR+EYR FLETCGFIKVDTQWRKVQDLL
Sbjct  576  YLVDLQKKERAKAQEEYRQNRLEYRHFLETCGFIKVDTQWRKVQDLL  622



>emb|CDY24627.1| BnaC05g33110D [Brassica napus]
Length=994

 Score =   107 bits (266),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 74/107 (69%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            SE K   +E   Y  K EA + FK+LL+S NVGSDWTW+Q +R I ND+RYG L+  GER
Sbjct  435  SEGKQIHQENFSYTNKSEAVDVFKSLLKSVNVGSDWTWEQAMREIINDRRYGVLRTLGER  494

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L Q +K   EE+  RQ K  E+F +MLEE  ELT STRWS
Sbjct  495  KQAFNEFLAQMRKAAEEEKIARQLKRYEDFRRMLEECVELTPSTRWS  541


 Score = 95.9 bits (237),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+ EDDERFK VERE DR ++F +++ DL++KE+ KA ED +RN VEYR FLE+C FI
Sbjct  543  AVTMLEDDERFKVVEREKDRRNIFEDHISDLKEKERVKAFEDRKRNIVEYRRFLESCNFI  602

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  603  KPNSQWRKVQDRL  615



>ref|XP_001774266.1| predicted protein [Physcomitrella patens]
 gb|EDQ60902.1| predicted protein [Physcomitrella patens]
Length=1182

 Score =   112 bits (280),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 98/154 (64%), Gaps = 24/154 (16%)
 Frame = +3

Query  42   SSIQDIEMKKST---ATNIHVT-VSEEKAA--DEEPLVYATKQEAKNAFKALLESANVGS  203
            +S QD E  K      + I+++ V EEK +   EEP  YA+K EAKNAFK LLES +V +
Sbjct  516  TSAQDFEEAKKVMLVTSKINISPVLEEKPSLVSEEPQTYASKTEAKNAFKELLESVHVEA  575

Query  204  DWTWDQTVRAIANDKRYGALKIHGERKQAFNE------------------YLMqrkklea  329
            DWTW+Q +R I NDKRYGALK  GERKQAFNE                  YL  RKK E+
Sbjct  576  DWTWEQAMRVIINDKRYGALKTLGERKQAFNEASVEPSIIAANCTFYSRHYLAHRKKQES  635

Query  330  eerrlrqrkakeeFTKMLEESKELTSSTRWSNNF  431
            EE+R +Q+ A+E+F  MLEESK+LTSS RWS  F
Sbjct  636  EEKRAKQKIAREQFRAMLEESKDLTSSMRWSKAF  669


 Score = 90.9 bits (224),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFEDD RF AVER+ +RE+L+ +Y+VDL++KE+ KA+E+ ++   EYR +LE CGFIK 
Sbjct  670  SIFEDDPRFLAVERDREREELYEDYMVDLERKEREKAREERKKYIAEYRSYLENCGFIKA  729

Query  604  DTQWRKVQDLL  636
             TQWRKVQD L
Sbjct  730  TTQWRKVQDRL  740



>ref|XP_010507899.1| PREDICTED: pre-mRNA-processing protein 40B-like [Camelina sativa]
Length=974

 Score =   104 bits (259),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   +E      K E  + FK+LL+SANVGSDWTW+Q +R I ND+RYG L+  GERK
Sbjct  418  EEKQILQENFSCDNKLEPGDVFKSLLKSANVGSDWTWEQAMREIINDRRYGVLRTLGERK  477

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L+Q K+   EER  RQRK  +EF +MLEE  EL+ STRWS
Sbjct  478  QAFNEFLLQMKRSAEEERLARQRKRYDEFKRMLEECVELSPSTRWS  523


 Score = 98.6 bits (244),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VTIFEDDERFKAVERE DR ++F +++ +L++KE+ KA ED +RN +EYR FLE+C FI
Sbjct  525  AVTIFEDDERFKAVEREKDRRNIFEDHVNELKEKERVKALEDRKRNIIEYRRFLESCNFI  584

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  585  KPNSQWRKVQDRL  597



>gb|KHN23176.1| Pre-mRNA-processing factor 40 like A [Glycine soja]
Length=1016

 Score =   107 bits (268),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 65/107 (61%), Gaps = 29/107 (27%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            +E KA + EP VYA K EAK+AFKALLES NVGSDWTWD+++R I NDKRYGALK  GER
Sbjct  465  AETKAVEPEPPVYANKMEAKDAFKALLESVNVGSDWTWDRSMRLIINDKRYGALKTLGER  524

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFN                             EES +LTSS RWS
Sbjct  525  KQAFN-----------------------------EESTDLTSSARWS  542


 Score = 95.1 bits (235),  Expect(2) = 3e-43, Method: Composition-based stats.
 Identities = 45/73 (62%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V+IFE+DERFKAVER+ DR D+F ++L +L  KE+AK QE+ +RN +EY+ FLE+C FI
Sbjct  544  AVSIFENDERFKAVERDRDRRDMFESFLEELLNKERAKVQEERKRNIMEYKKFLESCDFI  603

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQD L
Sbjct  604  KASTQWRKVQDRL  616



>ref|NP_188601.4| pre-mRNA-processing protein 40B [Arabidopsis thaliana]
 sp|F4JCC1.1|PR35B_ARATH RecName: Full=Pre-mRNA-processing protein 40B; AltName: Full=Mediator 
of RNA polymerase II transcription subunit 35b [Arabidopsis 
thaliana]
 gb|AEE76274.1| pre-mRNA-processing protein 40B [Arabidopsis thaliana]
Length=992

 Score =   110 bits (274),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            +EEK   +E   +  K EA + FK+LL+SA VGSDWTW+Q +R I NDKRYGAL+  GER
Sbjct  435  TEEKQIHQESFSFNNKLEAVDVFKSLLKSAKVGSDWTWEQAMREIINDKRYGALRTLGER  494

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L+Q K+   EER  RQ+K  E+F +MLEE  ELT STRWS
Sbjct  495  KQAFNEFLLQTKRAAEEERLARQKKLYEDFKRMLEECVELTPSTRWS  541


 Score = 92.8 bits (229),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            VT+FEDDERFKA+ERE DR ++F +++ +L++K + KA ED +RN +EY+ FLE+C FIK
Sbjct  544  VTMFEDDERFKALEREKDRRNIFEDHVSELKEKGRVKALEDRKRNIIEYKRFLESCNFIK  603

Query  601  VDTQWRKVQDLL  636
             ++QWRKVQD L
Sbjct  604  PNSQWRKVQDRL  615



>ref|XP_006406474.1| hypothetical protein EUTSA_v10019995mg [Eutrema salsugineum]
 gb|ESQ47927.1| hypothetical protein EUTSA_v10019995mg [Eutrema salsugineum]
Length=978

 Score =   108 bits (269),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   +E   Y  K EA + FK LL+S NVGSDWTW+Q +R I ND+RYG L+  GERK
Sbjct  441  EEKQIHQENFSYNNKSEAVDVFKYLLKSVNVGSDWTWEQAMREIINDRRYGVLRTLGERK  500

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L+Q K+   EE+  RQ+K  E+F +MLEE  ELT STRWS
Sbjct  501  QAFNEFLVQMKRAAEEEKVARQKKRYEDFRRMLEECLELTPSTRWS  546


 Score = 94.4 bits (233),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+ EDDERFK VERE DR ++F +++ DL++KE+ KA ED +RN  EYR FLE+C FI
Sbjct  548  AVTMLEDDERFKDVEREKDRRNIFEDHITDLKEKERVKALEDRKRNITEYRRFLESCNFI  607

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  608  KPNSQWRKVQDRL  620



>ref|XP_002966973.1| hypothetical protein SELMODRAFT_439841 [Selaginella moellendorffii]
 gb|EFJ31572.1| hypothetical protein SELMODRAFT_439841 [Selaginella moellendorffii]
Length=809

 Score =   134 bits (336),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = +3

Query  12   SPQVVASSGVSSIQDIEMKKSTATNIHVTVSEEKA-ADEEPLV-YATKQEAKNAFKALLE  185
            SP  +A SG  + +  E  + T  ++ V +SE K+ + EEPL+ YATK EAK+AFK LLE
Sbjct  207  SPAPLAGSGADAAESTEETQQTQQDLEVGISEGKSFSTEEPLISYATKNEAKSAFKELLE  266

Query  186  SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkake  365
            + +V SDWTWDQ +R I NDKRYGALK  GERKQAFNEYL QRKKL+ EE+RL+Q+KA+E
Sbjct  267  AMHVQSDWTWDQAMRVIINDKRYGALKSLGERKQAFNEYLAQRKKLDLEEKRLKQKKARE  326

Query  366  eFTKMLEESKELTSSTRWS  422
            +F KMLEESKELTS+ RWS
Sbjct  327  DFIKMLEESKELTSAMRWS  345


 Score = 68.2 bits (165),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            V++FE D RF AV++E +REDLF +YL+DL++KE+ KA+E+ +++R ++R +LE+C FIK
Sbjct  348  VSLFESDPRFHAVDKEREREDLFDDYLLDLERKERDKAREEKKKSRADFRSYLESCDFIK  407

Query  601  VDTQWRKVQDLL  636
            V++ WRK+QD L
Sbjct  408  VNSHWRKIQDKL  419



>ref|XP_010691544.1| PREDICTED: pre-mRNA-processing protein 40A-like [Beta vulgaris 
subsp. vulgaris]
Length=1004

 Score =   125 bits (315),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 2/122 (2%)
 Frame = +3

Query  60   EMKKST--ATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRA  233
            E  KST  A   +VTV EEKA + E L YA+KQEAK+ FKALLES+NV SDWTW+Q +R 
Sbjct  423  EDNKSTGIAGKTNVTVQEEKATEPETLTYASKQEAKDVFKALLESSNVESDWTWEQAMRL  482

Query  234  IANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSST  413
            I NDKRY AL+  GERKQAFNE+L Q+KK EAEERR + +KA+E+F KMLE+  ELTS+T
Sbjct  483  IINDKRYAALRSLGERKQAFNEFLSQKKKQEAEERRAKNKKAREDFRKMLEDCGELTSTT  542

Query  414  RW  419
            RW
Sbjct  543  RW  544


 Score = 75.5 bits (184),  Expect(2) = 7e-43, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             + +F  DERFKA+ER  DRED+F  YL +L KKE+AK +E+ ++N +EYR FLE+C FI
Sbjct  547  AINMFGSDERFKAIERVRDREDMFEEYLTELDKKERAKEEEERQQNIMEYRKFLESCDFI  606

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKV+D L
Sbjct  607  KANSQWRKVKDRL  619



>ref|XP_010557530.1| PREDICTED: pre-mRNA-processing protein 40B isoform X2 [Tarenaya 
hassleriana]
Length=983

 Score =   112 bits (280),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYL  305
            E + YA K E  +AFK+LLESANVGSDWTW+Q +R I  DKRYGAL+  GERKQAFNE+L
Sbjct  427  ELVSYANKLEVTDAFKSLLESANVGSDWTWEQAMRVIITDKRYGALRTLGERKQAFNEFL  486

Query  306  MqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            +Q+K  EAEERR++Q K  EEF KMLEE  ELT STRWS
Sbjct  487  IQKKIEEAEERRVKQNKKCEEFKKMLEECMELTPSTRWS  525


 Score = 86.7 bits (213),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +FE DERFKA++RE DR D+F +++ ++++KE+ KA E+ +RN +EYR FLE C FI
Sbjct  527  AVNMFEGDERFKALDREKDRRDIFEDHIDEMKEKERVKALEERKRNIIEYRNFLEYCDFI  586

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  587  KPNSQWRKVQDRL  599



>ref|XP_010557525.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557526.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557527.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557528.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557529.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557534.1| PREDICTED: pre-mRNA-processing protein 40B isoform X1 [Tarenaya 
hassleriana]
Length=985

 Score =   112 bits (280),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYL  305
            E + YA K E  +AFK+LLESANVGSDWTW+Q +R I  DKRYGAL+  GERKQAFNE+L
Sbjct  427  ELVSYANKLEVTDAFKSLLESANVGSDWTWEQAMRVIITDKRYGALRTLGERKQAFNEFL  486

Query  306  MqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            +Q+K  EAEERR++Q K  EEF KMLEE  ELT STRWS
Sbjct  487  IQKKIEEAEERRVKQNKKCEEFKKMLEECMELTPSTRWS  525


 Score = 86.7 bits (213),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +FE DERFKA++RE DR D+F +++ ++++KE+ KA E+ +RN +EYR FLE C FI
Sbjct  527  AVNMFEGDERFKALDREKDRRDIFEDHIDEMKEKERVKALEERKRNIIEYRNFLEYCDFI  586

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  587  KPNSQWRKVQDRL  599



>ref|XP_010557531.1| PREDICTED: pre-mRNA-processing protein 40B isoform X3 [Tarenaya 
hassleriana]
Length=953

 Score =   112 bits (280),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYL  305
            E + YA K E  +AFK+LLESANVGSDWTW+Q +R I  DKRYGAL+  GERKQAFNE+L
Sbjct  395  ELVSYANKLEVTDAFKSLLESANVGSDWTWEQAMRVIITDKRYGALRTLGERKQAFNEFL  454

Query  306  MqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            +Q+K  EAEERR++Q K  EEF KMLEE  ELT STRWS
Sbjct  455  IQKKIEEAEERRVKQNKKCEEFKKMLEECMELTPSTRWS  493


 Score = 86.7 bits (213),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +FE DERFKA++RE DR D+F +++ ++++KE+ KA E+ +RN +EYR FLE C FI
Sbjct  495  AVNMFEGDERFKALDREKDRRDIFEDHIDEMKEKERVKALEERKRNIIEYRNFLEYCDFI  554

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  555  KPNSQWRKVQDRL  567



>ref|XP_010557533.1| PREDICTED: pre-mRNA-processing protein 40B isoform X4 [Tarenaya 
hassleriana]
Length=873

 Score =   112 bits (280),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +3

Query  126  EPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYL  305
            E + YA K E  +AFK+LLESANVGSDWTW+Q +R I  DKRYGAL+  GERKQAFNE+L
Sbjct  315  ELVSYANKLEVTDAFKSLLESANVGSDWTWEQAMRVIITDKRYGALRTLGERKQAFNEFL  374

Query  306  MqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            +Q+K  EAEERR++Q K  EEF KMLEE  ELT STRWS
Sbjct  375  IQKKIEEAEERRVKQNKKCEEFKKMLEECMELTPSTRWS  413


 Score = 86.3 bits (212),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             V +FE DERFKA++RE DR D+F +++ ++++KE+ KA E+ +RN +EYR FLE C FI
Sbjct  415  AVNMFEGDERFKALDREKDRRDIFEDHIDEMKEKERVKALEERKRNIIEYRNFLEYCDFI  474

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  475  KPNSQWRKVQDRL  487



>ref|XP_010466124.1| PREDICTED: pre-mRNA-processing protein 40B-like isoform X2 [Camelina 
sativa]
Length=990

 Score =   102 bits (255),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   +E      K E  + FK+LLESANVGSDWTW+Q +R I ND+RYG L+  GERK
Sbjct  434  EEKQILQENFSCDNKLEPWDVFKSLLESANVGSDWTWEQAMREIINDRRYGVLRTLGERK  493

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q K+   EER  RQRK  +EF +MLEE  EL+ STRWS
Sbjct  494  QAFNEFLAQMKRSAEEERLARQRKRYDEFKRMLEECVELSPSTRWS  539


 Score = 96.3 bits (238),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKA+ERE DR ++F +++ +L++KE+ KA ED +RN +EYR FLE+C FI
Sbjct  541  AVTMFEDDERFKALEREKDRRNIFEDHVNELKEKERVKALEDRKRNIIEYRRFLESCNFI  600

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  601  KPNSQWRKVQDRL  613



>ref|XP_010489948.1| PREDICTED: pre-mRNA-processing protein 40B-like [Camelina sativa]
Length=958

 Score =   102 bits (254),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   +E      K E  + FK+LL+SANVGSDW W+Q +R I ND+RYG L+  GERK
Sbjct  431  EEKQILQENFSCDNKLEPGDVFKSLLKSANVGSDWAWEQAMREIINDRRYGVLRTLGERK  490

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L+Q K+   EER  RQRK  +EF +MLEE  EL+ STRWS
Sbjct  491  QAFNEFLLQMKRSAEEERLARQRKRYDEFKRMLEECVELSPSTRWS  536


 Score = 96.3 bits (238),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKA+ERE DR ++F +++ +L++KE+ KA ED +RN +EYR FLE+C FI
Sbjct  538  AVTMFEDDERFKALEREKDRRNIFEDHVNELKEKERVKALEDRKRNIIEYRRFLESCNFI  597

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  598  KPNSQWRKVQDRL  610



>gb|EYU39080.1| hypothetical protein MIMGU_mgv1a000980mg [Erythranthe guttata]
Length=923

 Score =   119 bits (297),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = +3

Query  99   VSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGE  278
            + EE+  D+ PLVY TK+EAKNAFKALLE++NVGSDW+WDQ +R I  D+RYGAL+  GE
Sbjct  397  LPEEQKLDDGPLVYETKEEAKNAFKALLEASNVGSDWSWDQAMRLIIKDRRYGALRTLGE  456

Query  279  RKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            RKQ FNE + Q+KK EAEERR RQ+KAKE+F  ML+E K+LT +TRWS
Sbjct  457  RKQTFNECVGQKKKQEAEERRARQKKAKEDFKTMLQECKDLTYTTRWS  504


 Score = 79.7 bits (195),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE DERF+A++R  DREDLF ++L +L++KE+AKA E+ + ++ EY  FL++C F+
Sbjct  506  AISMFEKDERFQAIDRVKDREDLFDDHLEELKQKERAKALEEKKLHKAEYLEFLKSCDFV  565

Query  598  KVDTQWRKVQDLL  636
            +  +QWR+VQD L
Sbjct  566  RASSQWRRVQDRL  578



>ref|XP_010466123.1| PREDICTED: pre-mRNA-processing protein 40B-like isoform X1 [Camelina 
sativa]
Length=872

 Score =   102 bits (254),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   +E      K E  + FK+LLESANVGSDWTW+Q +R I ND+RYG L+  GERK
Sbjct  316  EEKQILQENFSCDNKLEPWDVFKSLLESANVGSDWTWEQAMREIINDRRYGVLRTLGERK  375

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q K+   EER  RQRK  +EF +MLEE  EL+ STRWS
Sbjct  376  QAFNEFLAQMKRSAEEERLARQRKRYDEFKRMLEECVELSPSTRWS  421


 Score = 95.5 bits (236),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKA+ERE DR ++F +++ +L++KE+ KA ED +RN +EYR FLE+C FI
Sbjct  423  AVTMFEDDERFKALEREKDRRNIFEDHVNELKEKERVKALEDRKRNIIEYRRFLESCNFI  482

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  483  KPNSQWRKVQDRL  495



>gb|EPS71108.1| hypothetical protein M569_03648, partial [Genlisea aurea]
Length=667

 Score =   107 bits (266),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +3

Query  150  QEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkklea  329
            Q+AK AF+ALLESAN+GSDWTWDQ +R I ND+RYGAL+  GERKQAFNE+L Q+KK +A
Sbjct  249  QDAKIAFRALLESANIGSDWTWDQAMRVIINDRRYGALRSLGERKQAFNEFLGQKKKRDA  308

Query  330  eerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            EE+R++Q+++KEEF  ML+E K+LTS+ RWS
Sbjct  309  EEKRVKQKRSKEEFKVMLQECKDLTSAMRWS  339


 Score = 90.1 bits (222),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE DERF+AVER  DREDLF  +L DL+KKE+AKA E++RR +VEY  +L++C FI
Sbjct  341  AISMFEKDERFQAVERMKDREDLFEAHLEDLKKKERAKALEEHRRQKVEYIEYLKSCDFI  400

Query  598  KVDTQWRKVQ  627
            K  +QWRKVQ
Sbjct  401  KASSQWRKVQ  410



>ref|XP_006299213.1| hypothetical protein CARUB_v10015361mg [Capsella rubella]
 gb|EOA32111.1| hypothetical protein CARUB_v10015361mg [Capsella rubella]
Length=987

 Score =   101 bits (251),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK   ++      K E  + FK+LL+SANVG DWTW+Q +R I ND+RYGAL+  GERK
Sbjct  431  EEKQIHQDNFSSNNKLEPGDVFKSLLKSANVGPDWTWEQALREIINDRRYGALRTLGERK  490

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L+Q K+   EER  RQRK  EEF +MLEE  EL  S RWS
Sbjct  491  QAFNEFLLQMKRSAEEERLARQRKRYEEFKRMLEECVELAPSMRWS  536


 Score = 95.9 bits (237),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             VT+FEDDERFKA+ERE DR ++F +++ +L++KE+ KA ED +RN +EYR FLE+C FI
Sbjct  538  AVTMFEDDERFKALEREKDRRNIFEDHINELKEKERVKALEDRKRNIIEYRRFLESCNFI  597

Query  598  KVDTQWRKVQDLL  636
            K ++QWRKVQD L
Sbjct  598  KSNSQWRKVQDRL  610



>gb|EEC70813.1| hypothetical protein OsI_02277 [Oryza sativa Indica Group]
Length=1026

 Score =   138 bits (348),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +3

Query  87   IHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALK  266
            I+VT  E+K ++EEP+ YA K EAKNAFKALLES+NV SDWTWDQ +R I NDKRYGALK
Sbjct  387  INVTPVEDKTSEEEPVTYANKLEAKNAFKALLESSNVESDWTWDQAMRVIINDKRYGALK  446

Query  267  IHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
              GERKQAFNEYL QRKKLEAEERR++QRKA+++F  MLEESKELTSSTRWS
Sbjct  447  TLGERKQAFNEYLNQRKKLEAEERRIKQRKARDDFLAMLEESKELTSSTRWS  498


 Score = 51.2 bits (121),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 31/73 (42%), Positives = 38/73 (52%), Gaps = 27/73 (37%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+FEDDERF AVER  +REDLF +YL++LQK                           
Sbjct  500  AITMFEDDERFSAVERPREREDLFESYLMELQK---------------------------  532

Query  598  KVDTQWRKVQDLL  636
            K  TQWRKVQ+ L
Sbjct  533  KTSTQWRKVQERL  545



>ref|XP_004156902.1| PREDICTED: pre-mRNA-processing protein 40A-like [Cucumis sativus]
Length=983

 Score =   124 bits (311),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 94/130 (72%), Gaps = 5/130 (4%)
 Frame = +3

Query  30   SSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDW  209
            + GVS+ +  E KK T+        EE+A D++   Y  KQEAKNAFKALLESANVGSDW
Sbjct  412  TDGVSAQELEETKKDTSDEKVEFTLEERAIDQDTSAYPNKQEAKNAFKALLESANVGSDW  471

Query  210  TWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEE  389
            TWD+ +R I NDKRYGALK  GERKQAFNE     KK E EERR +Q+KA+EEF KMLEE
Sbjct  472  TWDRAMRIIINDKRYGALKTLGERKQAFNE-----KKQEVEERRTKQKKAREEFRKMLEE  526

Query  390  SKELTSSTRW  419
            S ELTSS RW
Sbjct  527  STELTSSMRW  536


 Score = 60.5 bits (145),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 16/71 (23%)
 Frame = +1

Query  424  TIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKV  603
            +IFE+DERF+AVER+ DR DLF ++L +L+ KE+AKAQE+                  K 
Sbjct  541  SIFENDERFQAVERDRDRRDLFESFLEELKNKERAKAQEER----------------FKA  584

Query  604  DTQWRKVQDLL  636
             +QWRKVQD L
Sbjct  585  SSQWRKVQDRL  595



>ref|XP_002313923.2| hypothetical protein POPTR_0009s08880g [Populus trichocarpa]
 gb|EEE87878.2| hypothetical protein POPTR_0009s08880g [Populus trichocarpa]
Length=888

 Score =   132 bits (333),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK+ +++PL+YA K EAKNAFKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  343  EEKSINQDPLLYADKLEAKNAFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  402

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            QAFNE+L Q++K EAEERR++Q+K +EEF KMLE SKELT+S RWS
Sbjct  403  QAFNEFLGQKRKQEAEERRVKQKKTREEFKKMLEGSKELTASMRWS  448


 Score = 49.3 bits (116),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 35/72 (49%), Gaps = 27/72 (38%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
             T+FE+DERFKAVERE DR DL   YL +L++                           K
Sbjct  451  ATLFENDERFKAVERERDRRDLIETYLQELEE---------------------------K  483

Query  601  VDTQWRKVQDLL  636
              TQWRKVQD L
Sbjct  484  ASTQWRKVQDRL  495



>ref|XP_002961039.1| hypothetical protein SELMODRAFT_402621 [Selaginella moellendorffii]
 gb|EFJ38578.1| hypothetical protein SELMODRAFT_402621 [Selaginella moellendorffii]
Length=799

 Score =   103 bits (256),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +3

Query  12   SPQVVASSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKA--LLE  185
            SP  +A SG    +  E  + T  ++ V     K      L +   QEAK +  +  LLE
Sbjct  207  SPAPLAGSGADVAEATEETQQTQQDLEVG---SKCGFLCILRFEYPQEAKKSLPSIELLE  263

Query  186  SANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkake  365
            + +V SDWTWDQ +R I NDKRYGALK  GERKQAFNEYL QRKKL+ EE+RL+Q+KA+E
Sbjct  264  AMHVQSDWTWDQAMRVIINDKRYGALKSLGERKQAFNEYLAQRKKLDLEEKRLKQKKARE  323

Query  366  eFTKMLEESKELTSSTRWS  422
            +F KMLEESKELTS+ RWS
Sbjct  324  DFIKMLEESKELTSAMRWS  342


 Score = 68.2 bits (165),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            V++FE D RF AV++E +REDLF +YL+DL++KE+ KA+E+ +++R ++R +LE+C FIK
Sbjct  345  VSLFESDPRFHAVDKEREREDLFDDYLLDLERKERDKAREEKKKSRADFRSYLESCDFIK  404

Query  601  VDTQWRKVQDLL  636
            V++ WRK+QD L
Sbjct  405  VNSHWRKIQDKL  416



>gb|KHG26690.1| Pre-mRNA-processing factor 40 A [Gossypium arboreum]
Length=960

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 99/119 (83%), Gaps = 3/119 (3%)
 Frame = +3

Query  42   SSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWT  212
            +S QDIE  K   +TA  +++T  EEK  D+EPLVYA K EAKNAFK+LLESANV SDWT
Sbjct  409  ASAQDIEEAKKGMATAGKVNMTPVEEKVPDDEPLVYANKLEAKNAFKSLLESANVQSDWT  468

Query  213  WDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEE  389
            W+QT+R I NDKRYGALK  GERKQAFNEYL QRKKLEAEERR+RQ+KA+EEFTKMLEE
Sbjct  469  WEQTMREIINDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEE  527


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 21/88 (24%)
 Frame = +1

Query  436  DDERFKAVEREADREDLFRNYLVDLQK---------------------KEKAKAQEDYRR  552
            +D+R+ A++   +R+  F  YL   +K                     +E+  A E+ RR
Sbjct  478  NDKRYGALKTLGERKQAFNEYLGQRKKLEAEERRMRQKKAREEFTKMLEEREYAAEEKRR  537

Query  553  NRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            N  EYR FLE+C FIK ++QWRKVQD L
Sbjct  538  NIAEYRKFLESCDFIKANSQWRKVQDRL  565



>gb|KDO49546.1| hypothetical protein CISIN_1g001687mg [Citrus sinensis]
Length=873

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 89/106 (84%), Gaps = 0/106 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEK  ++E   YA K EAKNAFKALLESANVGSDWTWDQ +RAI ND+RYGAL+  GERK
Sbjct  464  EEKTVEQEHFAYANKLEAKNAFKALLESANVGSDWTWDQALRAIINDRRYGALRTLGERK  523

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
             AFNEYL Q+KK +AEERRL+ +KA++++ KMLEES ELTSSTRWS
Sbjct  524  TAFNEYLGQKKKQDAEERRLKLKKARDDYKKMLEESVELTSSTRWS  569


 Score =   103 bits (256),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = +1

Query  316  RNWRLRRGASDREKPRRNSRRCWKSPRNLHHQQDGVTIFEDDERFKAVEREADREDLFRN  495
            R  +L++   D +K    S     S R        VT+FE+DERFKA+ERE DR+D+F +
Sbjct  541  RRLKLKKARDDYKKMLEESVELTSSTR----WSKAVTMFENDERFKALERERDRKDMFDD  596

Query  496  YLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            +L +L++KE+AKAQE+ +RN +EYR FLE+C FIK +TQWRKVQD L
Sbjct  597  HLDELKQKERAKAQEERKRNIIEYRKFLESCDFIKANTQWRKVQDRL  643


 Score = 37.0 bits (84),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  69   KSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLE-SANVGSDWTWDQTVRAIAND  245
            + TA N ++   +++ A+E  L     ++A++ +K +LE S  + S   W + V    ND
Sbjct  522  RKTAFNEYLGQKKKQDAEERRLKL---KKARDDYKKMLEESVELTSSTRWSKAVTMFEND  578

Query  246  KRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            +R+ AL+   +RK  F+++L + K+ E  + +  +++   E+ K LE    + ++T+W
Sbjct  579  ERFKALERERDRKDMFDDHLDELKQKERAKAQEERKRNIIEYRKFLESCDFIKANTQW  636


 Score = 36.2 bits (82),  Expect(2) = 9e-05, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 15/81 (19%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKE-------KAKAQEDYRRNRVEYRXFLE--  582
             E DER   +++  DR ++F+ YL DL+K+E       K +  +  R+NR E+R  +E  
Sbjct  643  LEADERCSRLDK-MDRLEIFQEYLNDLEKEEEEQRKIQKEELSKTERKNRDEFRKLMEAD  701

Query  583  -TCGFIKVDTQWR----KVQD  630
               G +   T WR    KV+D
Sbjct  702  VALGTLTAKTNWRDYCIKVKD  722



>gb|EMT05751.1| Pre-mRNA-processing factor 40-A-like protein [Aegilops tauschii]
Length=975

 Score = 84.7 bits (208),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 29/142 (20%)
 Frame = +3

Query  6    NSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKA  176
            +S P    +   +S +D+E  K    TA  I+VT  E+K ++EEP+VYATK EAKNAFK+
Sbjct  377  SSVPSTTDTKVGASAEDLEEAKKTMPTAGKINVTPLEDKTSEEEPVVYATKLEAKNAFKS  436

Query  177  LLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrk  356
            LLESANV SDW+WDQ                          YL QRKK+E EERR++QRK
Sbjct  437  LLESANVQSDWSWDQ--------------------------YLNQRKKIEVEERRVKQRK  470

Query  357  akeeFTKMLEESKELTSSTRWS  422
            A+++F  MLEE K+LTSS RWS
Sbjct  471  ARDDFFTMLEECKDLTSSLRWS  492


 Score = 75.1 bits (183),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 10/83 (12%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+F  DERF AVER  +REDLF NYLV+LQKKEKAKA E+++R   EYR FLE+C FI
Sbjct  494  AITMFGHDERFNAVERPKEREDLFENYLVELQKKEKAKAAEEHKRRIAEYREFLESCDFI  553

Query  598  K----------VDTQWRKVQDLL  636
            K           +TQWRKVQD L
Sbjct  554  KSVIIVRLYAQANTQWRKVQDRL  576



>gb|EMS61804.1| Pre-mRNA-processing factor 40-like protein A [Triticum urartu]
Length=971

 Score = 85.1 bits (209),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 29/142 (20%)
 Frame = +3

Query  6    NSSPQVVASSGVSSIQDIEMKK---STATNIHVTVSEEKAADEEPLVYATKQEAKNAFKA  176
            +S P    +   +S +D+E  K    TA  I+VT  E+K ++EEP+VYATK EAKNAFK+
Sbjct  373  SSVPSTTDTKVGASAEDLEEAKKTMPTAGKINVTPLEDKTSEEEPVVYATKLEAKNAFKS  432

Query  177  LLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrk  356
            LLESANV SDW+WDQ                          YL QRKK+E EERR++QRK
Sbjct  433  LLESANVQSDWSWDQ--------------------------YLNQRKKIEVEERRVKQRK  466

Query  357  akeeFTKMLEESKELTSSTRWS  422
            A+++F  MLEE K+LTSS RWS
Sbjct  467  ARDDFLTMLEECKDLTSSLRWS  488


 Score = 74.3 bits (181),  Expect(2) = 2e-30, Method: Composition-based stats.
 Identities = 49/83 (59%), Positives = 58/83 (70%), Gaps = 10/83 (12%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +T+F  DERF AVER  +REDLF NYLV+LQKKEKAKA E+++R   EYR FLE+C FI
Sbjct  490  AITMFGHDERFNAVERPKEREDLFENYLVELQKKEKAKAAEEHKRRIAEYREFLESCDFI  549

Query  598  K----------VDTQWRKVQDLL  636
            K           +TQWRKVQD L
Sbjct  550  KSVIIVRLYAQANTQWRKVQDRL  572



>ref|XP_011092488.1| PREDICTED: pre-mRNA-processing protein 40A-like isoform X2 [Sesamum 
indicum]
Length=1049

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 99/143 (69%), Gaps = 4/143 (3%)
 Frame = +3

Query  6    NSSPQVVASSGVSSIQDIEMKKSTATNIHVT----VSEEKAADEEPLVYATKQEAKNAFK  173
            N SPQ  A S V +  +      T+  I  +      E K  +  PLVY +K+ AKNAFK
Sbjct  459  NKSPQDAAPSSVDTFAESVEGADTSAGISGSGGNNAPEVKKVEHGPLVYESKEGAKNAFK  518

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
            ALLE+ANVG DW WDQ +R I ND+RYGALK  GERKQ FNE++ Q+KK EAEE+R RQ+
Sbjct  519  ALLETANVGPDWNWDQAMRVIINDRRYGALKTLGERKQTFNEFIGQKKKQEAEEKRARQK  578

Query  354  kakeeFTKMLEESKELTSSTRWS  422
            KA+E F KML+ESK+LTSSTRWS
Sbjct  579  KARENFKKMLQESKDLTSSTRWS  601


 Score = 87.0 bits (214),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 44/99 (44%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +1

Query  349  REKPRRNSRRCWKSPRNLHHQ---QDGVTIFEDDERFKAVEREADREDLFRNYLVDLQKK  519
            ++K R N ++  +  ++L         +++FE DERF+AVER  DREDLF ++L +L++K
Sbjct  577  QKKARENFKKMLQESKDLTSSTRWSKAISMFEKDERFQAVERAKDREDLFEDHLEELKRK  636

Query  520  EKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            E+AKA E+++R++ EY  FL++C FIK  +QWRKVQ+ L
Sbjct  637  ERAKALEEHKRHKAEYLEFLKSCDFIKASSQWRKVQNRL  675



>dbj|BAB02553.1| formin binding protein-like [Arabidopsis thaliana]
Length=844

 Score =   110 bits (274),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = +3

Query  102  SEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGER  281
            +EEK   +E   +  K EA + FK+LL+SA VGSDWTW+Q +R I NDKRYGAL+  GER
Sbjct  272  TEEKQIHQESFSFNNKLEAVDVFKSLLKSAKVGSDWTWEQAMREIINDKRYGALRTLGER  331

Query  282  KQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            KQAFNE+L+Q K+   EER  RQ+K  E+F +MLEE  ELT STRWS
Sbjct  332  KQAFNEFLLQTKRAAEEERLARQKKLYEDFKRMLEECVELTPSTRWS  378


 Score = 45.8 bits (107),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 27/72 (38%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            VT+FEDDERFKA+ERE DR ++F +++ +L++K                           
Sbjct  381  VTMFEDDERFKALEREKDRRNIFEDHVSELKEKP--------------------------  414

Query  601  VDTQWRKVQDLL  636
             ++QWRKVQD L
Sbjct  415  -NSQWRKVQDRL  425



>gb|KFK39294.1| hypothetical protein AALP_AA3G226000 [Arabis alpina]
Length=709

 Score = 94.4 bits (233),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = +3

Query  153  EAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleae  332
            EA + FK+LLESANVGSDWTW+Q +R I N++RYGAL+  GERKQAFNE+L + K+   E
Sbjct  223  EAVDVFKSLLESANVGSDWTWEQAMREIINERRYGALRTLGERKQAFNEFLGELKRAAEE  282

Query  333  errlrqrkakeeFTKMLEESKELTSSTRWS  422
            ER  RQRK  E+F +ML    ELT +TRWS
Sbjct  283  ERVARQRKRYEDFKRML----ELTPTTRWS  308


 Score = 59.7 bits (143),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  502  VDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            +DL++KE  KA ED +RN  EYR FLE+C FIK ++QW KVQDLL
Sbjct  313  IDLKEKEGVKALEDRKRNISEYRRFLESCDFIKPNSQWCKVQDLL  357



>gb|KFK39295.1| hypothetical protein AALP_AA3G226000 [Arabis alpina]
Length=725

 Score = 94.4 bits (233),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 4/90 (4%)
 Frame = +3

Query  153  EAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleae  332
            EA + FK+LLESANVGSDWTW+Q +R I N++RYGAL+  GERKQAFNE+L + K+   E
Sbjct  223  EAVDVFKSLLESANVGSDWTWEQAMREIINERRYGALRTLGERKQAFNEFLGELKRAAEE  282

Query  333  errlrqrkakeeFTKMLEESKELTSSTRWS  422
            ER  RQRK  E+F +ML    ELT +TRWS
Sbjct  283  ERVARQRKRYEDFKRML----ELTPTTRWS  308


 Score = 59.7 bits (143),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = +1

Query  502  VDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            +DL++KE  KA ED +RN  EYR FLE+C FIK ++QW KVQDLL
Sbjct  313  IDLKEKEGVKALEDRKRNISEYRRFLESCDFIKPNSQWCKVQDLL  357



>gb|AAF69150.1|AC007915_2 F27F5.2 [Arabidopsis thaliana]
Length=937

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +3

Query  108  EKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQ  287
            +KA  EEP+VYATKQEAK AFK+LLES NV SDWTW+QT++ I +DKRYGAL+  GERKQ
Sbjct  398  DKANVEEPMVYATKQEAKAAFKSLLESVNVHSDWTWEQTLKEIVHDKRYGALRTLGERKQ  457

Query  288  AFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWSN  425
            AFNEYL QRKK+EAEERR RQ+KA+EEF KMLEE +EL+SS +W +
Sbjct  458  AFNEYLGQRKKVEAEERRRRQKKAREEFVKMLEECEELSSSLKWRD  503


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +1

Query  421  VTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIK  600
            V + E+ E   +  +  DREDLF NY+V+L++KE+ KA E++R+   +YR FLETC +IK
Sbjct  486  VKMLEECEELSSSLKWRDREDLFDNYIVELERKEREKAAEEHRQYMADYRKFLETCDYIK  545

Query  601  VDTQWRKVQDLL  636
              TQWRK+QD L
Sbjct  546  AGTQWRKIQDRL  557



>ref|XP_007201807.1| hypothetical protein PRUPE_ppa000966mg [Prunus persica]
 gb|EMJ03006.1| hypothetical protein PRUPE_ppa000966mg [Prunus persica]
Length=947

 Score =   115 bits (287),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +3

Query  63   MKKSTATNIHVTVSEEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            M   T   ++   SEEK  D EP+ Y  K EAK+AFKALLES N+GSDWTWD+ +R I N
Sbjct  413  MDDVTGKKMNDIASEEKPVDREPISYENKLEAKDAFKALLESTNIGSDWTWDRAMRVIIN  472

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLE  386
            DKRYGALK  GERKQAFNE+L+QRKK EAEERR++Q+KA+EEF KMLE
Sbjct  473  DKRYGALKTLGERKQAFNEFLVQRKKQEAEERRIKQKKAREEFKKMLE  520


 Score = 32.3 bits (72),  Expect(2) = 9e-27, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 26/61 (43%), Gaps = 27/61 (44%)
 Frame = +1

Query  454  AVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDL  633
             VER+ DR D+F NY+ +LQK                           K  +QWRKVQD 
Sbjct  522  PVERDRDRRDMFENYVEELQK---------------------------KASSQWRKVQDR  554

Query  634  L  636
            L
Sbjct  555  L  555



>ref|XP_002300284.2| hypothetical protein POPTR_0001s29710g [Populus trichocarpa]
 gb|EEE85089.2| hypothetical protein POPTR_0001s29710g [Populus trichocarpa]
Length=972

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/94 (73%), Positives = 80/94 (85%), Gaps = 0/94 (0%)
 Frame = +3

Query  105  EEKAADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERK  284
            EEKA + EPL+YA K EAKN FKALLESANVGS+WTWDQ +R I NDKRYGALK  GERK
Sbjct  455  EEKAVNHEPLLYADKLEAKNLFKALLESANVGSEWTWDQAMRVIINDKRYGALKTLGERK  514

Query  285  QAFNEYLMqrkkleaeerrlrqrkakeeFTKMLE  386
            QAFNE+L Q++K EAEERR++Q+KA+EEF  MLE
Sbjct  515  QAFNEFLGQKRKQEAEERRIKQKKAREEFKNMLE  548



>ref|XP_005647286.1| hypothetical protein COCSUDRAFT_47676 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22742.1| hypothetical protein COCSUDRAFT_47676 [Coccomyxa subellipsoidea 
C-169]
Length=716

 Score = 89.0 bits (219),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  132  LVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMq  311
             +Y++K+EAK+AFK LL SA V SDW+W+QT+R+I +D RY ALK  GE+K  FNEY   
Sbjct  190  FMYSSKEEAKDAFKELLASAQVASDWSWEQTMRSIISDPRYSALKSLGEKKACFNEYQQA  249

Query  312  rkkleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
            RK  E  E+R R ++ +EEFT MLE + +L +STR+S
Sbjct  250  RKNEEVFEKRQRLKRGREEFTAMLESTTDLRASTRYS  286


 Score = 51.6 bits (122),  Expect(2) = 8e-25, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
               + EDD R+KAV+RE +RE L+ +++ +  KKE+   + + RR    +R  LE    I
Sbjct  288  AAALLEDDPRWKAVQRE-ERELLYADFIKEKDKKEREAKKAERRRRTAAFRVLLEKTTGI  346

Query  598  KVDTQWRKV  624
            KVDT WRK 
Sbjct  347  KVDTPWRKA  355



>ref|XP_011017521.1| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-processing protein 40A 
[Populus euphratica]
Length=734

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FE+DER+KAVER  DREDL  +Y+V+L++KEK KA ED+RRN  EYR FLE+C FI
Sbjct  329  AISLFENDERYKAVERARDREDLVDSYIVELERKEKEKAAEDHRRNVAEYRKFLESCDFI  388

Query  598  KVDTQWRKVQDLL  636
            K ++QWRK+QD L
Sbjct  389  KANSQWRKIQDHL  401



>ref|XP_005845731.1| hypothetical protein CHLNCDRAFT_136322 [Chlorella variabilis]
 gb|EFN53629.1| hypothetical protein CHLNCDRAFT_136322 [Chlorella variabilis]
Length=751

 Score = 75.1 bits (183),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +3

Query  138  YATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrk  317
            YAT  EAK+AFK LL  A + S  +WD+++R I  D+RYGALK  GE+K A+NEY+ QRK
Sbjct  255  YATTAEAKDAFKQLLTEAGISSGMSWDESMRLIVQDRRYGALKTLGEKKTAYNEYVQQRK  314

Query  318  kleaeerrlrqrkakeeFTKMLEESKEL  401
            K EAEE R R+ +AKE F  ML+E KEL
Sbjct  315  KEEAEEARQRRMQAKEGFYAMLDECKEL  342


 Score = 47.0 bits (110),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            + E D R++AV+   +RE+LF +++ + +K+EK   + + +R R  +R  LE    ++ D
Sbjct  358  LLELDARWQAVDAGKEREELFEDWVDEKEKQEKEARRAETKRRRGAFRELLERSKHVRHD  417

Query  607  TQWRKVQDLL  636
            T WRK QD L
Sbjct  418  TAWRKAQDRL  427



>ref|XP_001768158.1| predicted protein [Physcomitrella patens]
 gb|EDQ67031.1| predicted protein [Physcomitrella patens]
Length=618

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 62/93 (67%), Gaps = 8/93 (9%)
 Frame = +3

Query  42   SSIQDIE-----MKKSTATNIHVTVSEEKAA--DEEPLVYATKQEAKNAFKALLESANVG  200
            +S Q++E     M  ++  NI   V EEK     EEP  YA+K EAKNAFK LLES ++ 
Sbjct  523  TSAQELEEAKKVMVVTSKVNIS-PVPEEKPTLVSEEPQTYASKTEAKNAFKELLESVHIE  581

Query  201  SDWTWDQTVRAIANDKRYGALKIHGERKQAFNE  299
            +D TW+Q +R I NDKRYGALK  GERKQAFNE
Sbjct  582  ADCTWEQAMRVIINDKRYGALKTLGERKQAFNE  614



>ref|XP_002950379.1| hypothetical protein VOLCADRAFT_104642 [Volvox carteri f. nagariensis]
 gb|EFJ48580.1| hypothetical protein VOLCADRAFT_104642 [Volvox carteri f. nagariensis]
Length=951

 Score = 82.0 bits (201),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  114  AADEEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAF  293
            +AD +   +ATK+EAK+AFK LL S    SDWTW+Q +R   ND RY ALK  GERKQ F
Sbjct  482  SADPKSYTFATKEEAKDAFKELLASVGCRSDWTWEQAMRLTVNDPRYSALKTLGERKQTF  541

Query  294  NEYLMqrkkleaeerrlrqrkakeeFTKMLEESKEL  401
            NEY+  R+  E EE R RQR+A+E+F  ML  S+EL
Sbjct  542  NEYVQARRNEEKEEERRRQRQAREDFLAMLASSEEL  577


 Score = 32.3 bits (72),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +FEDD R+KAV  E +RE+LF +   +  K+EK + +++ +R    +R  LE+ G +K  
Sbjct  589  LFEDDPRWKAVP-EREREELFHDAQRERDKREKEERRQERKRRCNAFRELLESSG-LKPG  646

Query  607  TQWRKVQDLL  636
             +WRKV   L
Sbjct  647  AEWRKVSKRL  656



>ref|XP_001768159.1| predicted protein [Physcomitrella patens]
 gb|EDQ67032.1| predicted protein [Physcomitrella patens]
Length=563

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  418  GVTIFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFI  597
             +++FEDD RF AVE++ +RE+LF +Y++DL++KE+ KA+E+ +++  EYR FLE+C FI
Sbjct  6    ALSMFEDDPRFLAVEKDREREELFEDYMIDLERKEREKAREERKKHISEYRSFLESCDFI  65

Query  598  KVDTQWRKVQDLL  636
            K +TQWRKVQD L
Sbjct  66   KANTQWRKVQDRL  78



>gb|EFA77355.1| WW domain-containing protein [Polysphondylium pallidum PN500]
Length=640

 Score = 60.5 bits (145),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = +3

Query  147  KQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkle  326
            K  A   FK LL   +VGS W++++  + I ND RY  LK   ERK  F EYL+ RKK E
Sbjct  187  KDSANKIFKELLNDNDVGSTWSFERAQKIIINDDRYQVLKTMSERKMVFQEYLVDRKKFE  246

Query  327  aeerrlrqrkakeeFTKMLEESKELTSSTRW  419
             EE+R R+++ +EEF K+L+ES E+T +  W
Sbjct  247  LEEKRKREKRNREEFVKLLKESPEVTLTMSW  277


 Score = 51.2 bits (121),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDT  609
            F+ D ++ AVE E +REDLFR+Y+VDL+  EK + ++  R    + R   E+   I + +
Sbjct  284  FDGDPKWDAVESEKEREDLFRSYMVDLEHTEKDEREQAKRDQIRQLRHKFESDPTINLKS  343

Query  610  QWRKVQD  630
            QWRKV+D
Sbjct  344  QWRKVKD  350



>dbj|GAM22720.1| hypothetical protein SAMD00019534_058950 [Acytostelium subglobosum 
LB1]
Length=623

 Score = 60.5 bits (145),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  168  FKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlr  347
            FK +L+ A+V S+W++++  + +AND+RY  LK   ERKQAF EYL  RK  E EE+R +
Sbjct  183  FKDMLQQADVASNWSFEKAHKLVANDERYHLLKTMSERKQAFQEYLGDRKVFEYEEKRRK  242

Query  348  qrkakeeFTKMLEESKELTSSTRW  419
            +++ ++E  +ML ES E++ S  W
Sbjct  243  EKRCRDELVRMLRESPEVSPSMTW  266


 Score = 45.4 bits (106),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 45/68 (66%), Gaps = 2/68 (3%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRV-EYRXFLETCGFIKVD  606
            F+ D +++AV+ E +REDLFR Y++D+QK+EK   +++ RR+ +   R  LET   I + 
Sbjct  273  FDGDSKWEAVDSEREREDLFRTYVMDIQKREK-DDRDNLRRDTMRNLRAKLETNDLINLK  331

Query  607  TQWRKVQD  630
            T W K ++
Sbjct  332  TLWSKFKE  339



>ref|XP_004361782.1| WW domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG23931.1| WW domain-containing protein [Dictyostelium fasciculatum]
Length=607

 Score = 60.5 bits (145),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +3

Query  168  FKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlr  347
            FK LL+S +V S W++++  R I ND+RY  LK   ERK A+ EY++ RKK E EE++ +
Sbjct  167  FKELLQSHDVASSWSFERAQRVIINDERYQVLKTMSERKSAYQEYMVDRKKYEYEEKKKQ  226

Query  348  qrkakeeFTKMLEESKELTSSTRW  419
             +K +E   K+L+ES E+TSS  W
Sbjct  227  DKKNREALIKLLKESGEVTSSMTW  250


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +1

Query  430  FEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDT  609
            F+ D ++ AVE E +REDLFR  ++DL+KKEK       R    + +   E    I   T
Sbjct  257  FDGDPKWMAVESEREREDLFRMVVIDLEKKEKEDKDLAKRDLMKQIKAKFEVNLTITSRT  316

Query  610  QWRKVQD  630
            QWRKV++
Sbjct  317  QWRKVKE  323



>ref|XP_001692603.1| WW domain protein [Chlamydomonas reinhardtii]
 gb|EDP04081.1| WW domain protein [Chlamydomonas reinhardtii]
Length=746

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = +3

Query  138  YATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrk  317
            +ATK+EAK+ FK LL +    SDW+W+Q +R I ND RY ALK  GERKQ FNEY+  R+
Sbjct  350  FATKEEAKDCFKELLAAVGCRSDWSWEQAMRHIVNDPRYSALKSLGERKQTFNEYVQARR  409

Query  318  kleaeerrlrqrkakeeFTKMLEESKELTSS  410
              E EE R RQR+A+E+FT ML  S EL ++
Sbjct  410  NEEREEERRRQRQAREDFTAMLMSSDELKTT  440



>gb|KFH71285.1| hypothetical protein MVEG_01585 [Mortierella verticillata NRRL 
6337]
Length=775

 Score = 65.9 bits (159),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = +3

Query  138  YATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrk  317
            +ATK+EA+ AFK LL+   V S WTW+QT+RA+  +  Y ALK   ERK AF EY+ +R+
Sbjct  208  FATKEEAEKAFKNLLKETGVTSTWTWEQTMRAVVTNPLYRALKTTAERKTAFQEYVDERR  267

Query  318  kleaeerrlrqrkakeeFTKMLEESKELTSSTRWS  422
              E E+ + RQ+K + +  ++L  S ++T ++R++
Sbjct  268  IQEKEDEKARQKKLRHDLQELLANSDKVTHTSRYT  302


 Score = 35.8 bits (81),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F ++  FKA+E +  R  +F ++L +L +KEK +A+   +     +   L++   I   
Sbjct  307  LFAEEPAFKAIEDDRLRYSIFDSHLSELIRKEKDEARLKRKTGMAAFLSLLQSLKDITFM  366

Query  607  TQWRKVQDLL  636
            T+W + +DLL
Sbjct  367  TRWAEAKDLL  376



>ref|XP_006834601.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X2 
[Chrysochloris asiatica]
Length=955

 Score = 70.1 bits (170),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = +3

Query  6    NSSPQVVASSG-VSSIQDIEMKKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKAL  179
            +S+P V   SG +SS  +   K+ TA +      EE++   ++   + TK+EAK AFK L
Sbjct  342  SSTPAVQEQSGEISSNTEETSKQETAADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKEL  401

Query  180  LESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrka  359
            L+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + ++A
Sbjct  402  LKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEA  461

Query  360  keeFTKMLEESKELTSSTRW  419
            KE F + LE  +++TS+TR+
Sbjct  462  KESFQRFLENHEKMTSTTRY  481


 Score = 31.6 bits (70),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  466  EADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            E DR +++ + L  L KKEK +A++  +RN    +  L+    +   T W + Q  L
Sbjct  499  ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYL  555



>ref|XP_006834600.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X1 
[Chrysochloris asiatica]
Length=928

 Score = 70.1 bits (170),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 86/140 (61%), Gaps = 2/140 (1%)
 Frame = +3

Query  6    NSSPQVVASSG-VSSIQDIEMKKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKAL  179
            +S+P V   SG +SS  +   K+ TA +      EE++   ++   + TK+EAK AFK L
Sbjct  315  SSTPAVQEQSGEISSNTEETSKQETAADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKEL  374

Query  180  LESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrka  359
            L+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + ++A
Sbjct  375  LKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEA  434

Query  360  keeFTKMLEESKELTSSTRW  419
            KE F + LE  +++TS+TR+
Sbjct  435  KESFQRFLENHEKMTSTTRY  454


 Score = 31.6 bits (70),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  466  EADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            E DR +++ + L  L KKEK +A++  +RN    +  L+    +   T W + Q  L
Sbjct  472  ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYL  528



>ref|NP_001243869.1| uncharacterized protein LOC100170464 isoform 1 [Xenopus (Silurana) 
tropicalis]
Length=922

 Score = 68.2 bits (165),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ TW+Q ++ I ND RY AL    E+KQA+N Y +Q +K 
Sbjct  335  TKEEAKQAFKELLKEKRVPSNATWEQAMKMIINDPRYSALAKLSEKKQAYNAYKVQTEKE  394

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE RL+ ++AKE F K LE  +++TS+TR+
Sbjct  395  EKEEARLKYKEAKESFQKFLENHEKMTSTTRY  426


 Score = 33.1 bits (74),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F D E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  432  MFGDHEVWNAIT-ERDRLEIYEDVLFFLAKKEKEQAKQLRKRNWEALKNILDNMTNVTYS  490

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  491  TTWSEAQQYL  500



>ref|NP_001243870.1| uncharacterized protein LOC100170464 isoform 2 [Xenopus (Silurana) 
tropicalis]
Length=917

 Score = 68.2 bits (165),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ TW+Q ++ I ND RY AL    E+KQA+N Y +Q +K 
Sbjct  330  TKEEAKQAFKELLKEKRVPSNATWEQAMKMIINDPRYSALAKLSEKKQAYNAYKVQTEKE  389

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE RL+ ++AKE F K LE  +++TS+TR+
Sbjct  390  EKEEARLKYKEAKESFQKFLENHEKMTSTTRY  421


 Score = 33.1 bits (74),  Expect(2) = 4e-13, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F D E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  427  MFGDHEVWNAIT-ERDRLEIYEDVLFFLAKKEKEQAKQLRKRNWEALKNILDNMTNVTYS  485

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  486  TTWSEAQQYL  495



>ref|XP_004636725.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X2 
[Octodon degus]
Length=927

 Score = 69.7 bits (169),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +  S+IQD+ ++   ++N+  T   E  AD  P               + TK+EAK AFK
Sbjct  314  TNTSTIQDLSVE--VSSNVEETSKLEAVADFTPKKEEEENQPAKKTYTWNTKEEAKQAFK  371

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  372  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  431

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  432  EAKESFQRFLENHEKMTSTTRY  453


 Score = 31.2 bits (69),  Expect(2) = 5e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  459  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  517

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  518  TTWSEAQQYL  527



>gb|AAI30104.1| LOC100037011 protein [Xenopus laevis]
Length=811

 Score = 67.8 bits (164),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ TW+Q ++ I ND RY AL    E+KQA+N Y +Q +K 
Sbjct  330  TKEEAKQAFKELLKEKRVPSNATWEQAMKMIINDPRYSALAKLSEKKQAYNAYKVQTEKE  389

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE RL+ ++AKE F K LE  +++TS+TR+
Sbjct  390  EKEEARLKYKEAKESFQKFLENHEKMTSTTRY  421


 Score = 32.7 bits (73),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F D E + A+  E DR +++ + +  L KKEK +A++  +RN    +  L+    +   
Sbjct  427  MFVDLEVWNAIT-ERDRLEIYEDVMFFLAKKEKEQAKQLRKRNWEALKNILDNMTNVTFS  485

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  486  TTWSEAQQYL  495



>ref|XP_004636724.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X1 
[Octodon degus]
Length=954

 Score = 69.7 bits (169),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +  S+IQD+ ++   ++N+  T   E  AD  P               + TK+EAK AFK
Sbjct  341  TNTSTIQDLSVE--VSSNVEETSKLEAVADFTPKKEEEENQPAKKTYTWNTKEEAKQAFK  398

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  399  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  458

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  459  EAKESFQRFLENHEKMTSTTRY  480


 Score = 31.2 bits (69),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  486  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  544

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  545  TTWSEAQQYL  554



>ref|XP_004474339.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 2 
[Dasypus novemcinctus]
Length=1036

 Score = 68.6 bits (166),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  444  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  503

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  504  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  562


 Score = 32.3 bits (72),  Expect(2) = 6e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  568  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  626

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  627  TTWSEAQQYL  636



>ref|XP_004474338.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 1 
[Dasypus novemcinctus]
Length=1040

 Score = 68.2 bits (165),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  444  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  503

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  504  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  562


 Score = 32.3 bits (72),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  568  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  626

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  627  TTWSEAQQYL  636



>ref|XP_008115918.1| PREDICTED: pre-mRNA-processing factor 40 homolog A [Anolis carolinensis]
Length=1017

 Score = 67.4 bits (163),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  453  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  512

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE RL+ ++AKE F + LE  +++TS+TR+
Sbjct  513  EKEEARLKYKEAKESFQRFLENHEKMTSTTRY  544


 Score = 33.1 bits (74),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  550  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  608

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  609  TTWSEAQQYL  618



>ref|XP_004474341.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 4 
[Dasypus novemcinctus]
Length=1021

 Score = 68.2 bits (165),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  425  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  484

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  485  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  543


 Score = 32.3 bits (72),  Expect(2) = 7e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  549  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  607

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  608  TTWSEAQQYL  617



>ref|XP_004474340.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 3 
[Dasypus novemcinctus]
Length=1022

 Score = 68.2 bits (165),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  426  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  485

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  486  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  544


 Score = 32.3 bits (72),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  550  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  608

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  609  TTWSEAQQYL  618



>ref|XP_004474342.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 5 
[Dasypus novemcinctus]
Length=998

 Score = 68.2 bits (165),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  402  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  461

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  462  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  520


 Score = 32.3 bits (72),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  526  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  584

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  585  TTWSEAQQYL  594



>gb|EAX11480.1| hCG1811743, isoform CRA_b [Homo sapiens]
Length=948

 Score = 67.0 bits (162),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  471  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  530

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  531  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  562


 Score = 33.5 bits (75),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  568  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  626

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  627  TTWSEAQQYL  636



>ref|XP_010639709.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X1 
[Fukomys damarensis]
Length=994

 Score = 68.6 bits (166),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +  ++IQD+ ++   ++N   T  +E  AD  P               + TK+EAK AFK
Sbjct  377  TNTTAIQDLSVE--VSSNAEETSKQETVADFTPKKEEEENQPTKKTYTWNTKEEAKQAFK  434

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  435  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  494

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  495  EAKESFQRFLENHEKMTSTTRY  516


 Score = 31.6 bits (70),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  522  MFGELEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  580

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  581  TTWSEAQQYL  590



>ref|XP_010639710.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X2 
[Fukomys damarensis]
Length=990

 Score = 68.6 bits (166),  Expect(2) = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +  ++IQD+ ++   ++N   T  +E  AD  P               + TK+EAK AFK
Sbjct  377  TNTTAIQDLSVE--VSSNAEETSKQETVADFTPKKEEEENQPTKKTYTWNTKEEAKQAFK  434

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  435  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  494

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  495  EAKESFQRFLENHEKMTSTTRY  516


 Score = 31.6 bits (70),  Expect(2) = 8e-13, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  466  EADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            E DR +++ + L  L KKEK +A++  +RN    +  L+    +   T W + Q  L
Sbjct  534  ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYL  590



>ref|XP_004474343.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 6 
[Dasypus novemcinctus]
Length=994

 Score = 68.2 bits (165),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  402  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  461

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  462  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  520


 Score = 32.0 bits (71),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  526  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  584

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  585  TTWSEAQQYL  594



>ref|XP_010639711.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X3 
[Fukomys damarensis]
Length=976

 Score = 68.6 bits (166),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 15/142 (11%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +  ++IQD+ ++   ++N   T  +E  AD  P               + TK+EAK AFK
Sbjct  359  TNTTAIQDLSVE--VSSNAEETSKQETVADFTPKKEEEENQPTKKTYTWNTKEEAKQAFK  416

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  417  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  476

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  477  EAKESFQRFLENHEKMTSTTRY  498


 Score = 31.6 bits (70),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 17/57 (30%), Positives = 29/57 (51%), Gaps = 0/57 (0%)
 Frame = +1

Query  466  EADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVDTQWRKVQDLL  636
            E DR +++ + L  L KKEK +A++  +RN    +  L+    +   T W + Q  L
Sbjct  516  ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYL  572



>ref|XP_004474348.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 11 
[Dasypus novemcinctus]
Length=976

 Score = 68.2 bits (165),  Expect(2) = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  384  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  443

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  444  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  502


 Score = 32.0 bits (71),  Expect(2) = 9e-13, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  508  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  566

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  567  TTWSEAQQYL  576



>ref|XP_004474346.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 9 
[Dasypus novemcinctus]
Length=961

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  365  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  424

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  425  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  483


 Score = 31.6 bits (70),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  489  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  547

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  548  TTWSEAQQYL  557



>ref|XP_008169668.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X4 
[Chrysemys picta bellii]
Length=1052

 Score = 67.8 bits (164),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  468  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  527

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  528  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  559


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  565  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  623

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  624  TTWSEAQQYL  633



>ref|XP_007078563.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X2 
[Panthera tigris altaica]
Length=983

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 14/142 (10%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +   ++QD  M+ S+ T    T  +E  AD  P               + TK+EAK AFK
Sbjct  365  TSTPAVQDQSMEVSSNTG-EETAKQEAVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFK  423

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  424  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  483

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  484  EAKESFQRFLENHEKMTSTTRY  505


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  511  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  569

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  570  TTWSEAQQYL  579



>ref|XP_007078562.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X1 
[Panthera tigris altaica]
Length=1021

 Score = 67.8 bits (164),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 14/142 (10%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +   ++QD  M+ S+ T    T  +E  AD  P               + TK+EAK AFK
Sbjct  407  TSTPAVQDQSMEVSSNTG-EETAKQEAVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFK  465

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  466  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  525

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  526  EAKESFQRFLENHEKMTSTTRY  547


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  553  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  611

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  612  TTWSEAQQYL  621



>ref|XP_006055883.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X2 
[Bubalus bubalis]
Length=933

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYA--TKQEAKNAFKALL  182
            S+P V   S VSS    E  K           EE+ +      Y   TK+EAK AFK LL
Sbjct  317  STPSVQDQSEVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELL  376

Query  183  ESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkak  362
            +   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + ++AK
Sbjct  377  KEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAK  436

Query  363  eeFTKMLEESKELTSSTRW  419
            E F + LE  +++TS+TR+
Sbjct  437  ESFQRFLENHEKMTSTTRY  455


 Score = 31.6 bits (70),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  461  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  519

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  520  TTWSEAQQYL  529



>ref|XP_011283562.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X1 
[Felis catus]
Length=994

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 14/142 (10%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +   ++QD  M+ S+ T    T  +E  AD  P               + TK+EAK AFK
Sbjct  380  TSTPAVQDQSMEVSSNTG-EETAKQEAVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFK  438

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  439  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  498

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  499  EAKESFQRFLENHEKMTSTTRY  520


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  526  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  584

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  585  TTWSEAQQYL  594



>ref|XP_011283564.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X2 
[Felis catus]
Length=980

 Score = 67.8 bits (164),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 14/142 (10%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +   ++QD  M+ S+ T    T  +E  AD  P               + TK+EAK AFK
Sbjct  362  TSTPAVQDQSMEVSSNTG-EETAKQEAVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFK  420

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  421  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  480

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  481  EAKESFQRFLENHEKMTSTTRY  502


 Score = 32.0 bits (71),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  508  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  566

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  567  TTWSEAQQYL  576



>ref|XP_007078564.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X3 
[Panthera tigris altaica]
Length=979

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 80/142 (56%), Gaps = 14/142 (10%)
 Frame = +3

Query  33   SGVSSIQDIEMKKSTATNIHVTVSEEKAADEEP-------------LVYATKQEAKNAFK  173
            +   ++QD  M+ S+ T    T  +E  AD  P               + TK+EAK AFK
Sbjct  365  TSTPAVQDQSMEVSSNTG-EETAKQEAVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFK  423

Query  174  ALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqr  353
             LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + +
Sbjct  424  ELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYK  483

Query  354  kakeeFTKMLEESKELTSSTRW  419
            +AKE F + LE  +++TS+TR+
Sbjct  484  EAKESFQRFLENHEKMTSTTRY  505


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  511  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  569

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  570  TTWSEAQQYL  579



>ref|XP_010804566.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X3 
[Bos taurus]
 ref|XP_010800364.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X12 
[Bos taurus]
 ref|XP_010838311.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X3 
[Bison bison bison]
Length=933

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYA--TKQEAKNAFKALL  182
            S+P V   S VSS    E  K           EE+ +      Y   TK+EAK AFK LL
Sbjct  317  STPSVQDQSEVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELL  376

Query  183  ESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkak  362
            +   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + ++AK
Sbjct  377  KEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAK  436

Query  363  eeFTKMLEESKELTSSTRW  419
            E F + LE  +++TS+TR+
Sbjct  437  ESFQRFLENHEKMTSTTRY  455


 Score = 31.6 bits (70),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  461  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  519

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  520  TTWSEAQQYL  529



>ref|XP_010804583.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X9 
[Bos taurus]
 ref|XP_010800370.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X18 
[Bos taurus]
Length=914

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYA--TKQEAKNAFKALL  182
            S+P V   S VSS    E  K           EE+ +      Y   TK+EAK AFK LL
Sbjct  298  STPSVQDQSEVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELL  357

Query  183  ESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkak  362
            +   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + ++AK
Sbjct  358  KEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAK  417

Query  363  eeFTKMLEESKELTSSTRW  419
            E F + LE  +++TS+TR+
Sbjct  418  ESFQRFLENHEKMTSTTRY  436


 Score = 31.6 bits (70),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  442  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  500

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  501  TTWSEAQQYL  510



>dbj|BAG60744.1| unnamed protein product [Homo sapiens]
Length=816

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  312  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  371

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  372  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  403


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  409  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  467

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  468  TTWSEAQQYL  477



>ref|XP_005296523.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X6 
[Chrysemys picta bellii]
Length=1034

 Score = 67.8 bits (164),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  468  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  527

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  528  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  559


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  565  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  623

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  624  TTWSEAQQYL  633



>ref|XP_004474344.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform 7 
[Dasypus novemcinctus]
Length=957

 Score = 68.2 bits (165),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = +3

Query  66   KKSTATNIHVTVSEEKAAD-EEPLVYATKQEAKNAFKALLESANVGSDWTWDQTVRAIAN  242
            K+ TAT+      EE++   ++   + TK+EAK AFK LL+   V S+ +W+Q ++ I N
Sbjct  365  KQETATDFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIIN  424

Query  243  DKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            D RY AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  425  DPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  483


 Score = 31.6 bits (70),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  489  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  547

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  548  TTWSEAQQYL  557



>ref|XP_007494236.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X3 
[Monodelphis domestica]
Length=996

 Score = 67.0 bits (162),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  431  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  490

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  491  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  522


 Score = 32.7 bits (73),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  528  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  586

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  587  TTWSEAQQYL  596



>ref|XP_001365479.2| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X1 
[Monodelphis domestica]
Length=1038

 Score = 67.0 bits (162),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  473  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  532

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  533  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  564


 Score = 32.7 bits (73),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  570  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  628

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  629  TTWSEAQQYL  638



>gb|ELK35058.1| Pre-mRNA-processing factor 40 like protein A [Myotis davidii]
Length=1122

 Score = 67.0 bits (162),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  556  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  615

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  616  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  647


 Score = 32.7 bits (73),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  653  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  711

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  712  TTWSEAQQYL  721



>gb|KFP06598.1| Pre-mRNA-processing factor 40 A, partial [Calypte anna]
Length=879

 Score = 70.1 bits (170),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 74/115 (64%), Gaps = 4/115 (3%)
 Frame = +3

Query  87   IHVTVSEEKAADEEPL----VYATKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRY  254
            +H   S+++  D +P+     + TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY
Sbjct  290  VHSAASKKEEDDAQPVKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRY  349

Query  255  GALKIHGERKQAFNEYLMqrkkleaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
             AL    E+KQAFN Y +Q +K E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  350  SALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRY  404


 Score = 29.6 bits (65),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  410  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYC  468

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  469  TTWSEAQQYL  478



>gb|EPQ03406.1| Pre-mRNA-processing factor 40 like protein A [Myotis brandtii]
Length=1009

 Score = 67.0 bits (162),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  443  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  502

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  503  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  534


 Score = 32.7 bits (73),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  540  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  598

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  599  TTWSEAQQYL  608



>ref|XP_009235989.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X5 
[Pongo abelii]
Length=994

 Score = 67.4 bits (163),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  144  TKQEAKNAFKALLESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkl  323
            TK+EAK AFK LL+   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K 
Sbjct  429  TKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKE  488

Query  324  eaeerrlrqrkakeeFTKMLEESKELTSSTRW  419
            E EE R + ++AKE F + LE  +++TS+TR+
Sbjct  489  EKEEARSKYKEAKESFQRFLENHEKMTSTTRY  520


 Score = 32.3 bits (72),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  526  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  584

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  585  TTWSEAQQYL  594



>ref|XP_005676183.1| PREDICTED: pre-mRNA-processing factor 40 homolog A isoform X4 
[Capra hircus]
Length=918

 Score = 68.6 bits (166),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +3

Query  9    SSPQVVASSGVSSIQDIEMKKSTATNIHVTVSEEKAADEEPLVYA--TKQEAKNAFKALL  182
            S+P V   S VSS    E  K           EE+ +      Y   TK+EAK AFK LL
Sbjct  302  STPSVQDQSEVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELL  361

Query  183  ESANVGSDWTWDQTVRAIANDKRYGALKIHGERKQAFNEYLMqrkkleaeerrlrqrkak  362
            +   V S+ +W+Q ++ I ND RY AL    E+KQAFN Y +Q +K E EE R + ++AK
Sbjct  362  KEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAK  421

Query  363  eeFTKMLEESKELTSSTRW  419
            E F + LE  +++TS+TR+
Sbjct  422  ESFQRFLENHEKMTSTTRY  440


 Score = 31.2 bits (69),  Expect(2) = 1e-12, Method: Composition-based stats.
 Identities = 20/70 (29%), Positives = 36/70 (51%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  IFEDDERFKAVEREADREDLFRNYLVDLQKKEKAKAQEDYRRNRVEYRXFLETCGFIKVD  606
            +F + E + A+  E DR +++ + L  L KKEK +A++  +RN    +  L+    +   
Sbjct  446  MFGEMEVWNAIS-ERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYS  504

Query  607  TQWRKVQDLL  636
            T W + Q  L
Sbjct  505  TTWSEAQQYL  514



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125