BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034E12

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804950.1|  PREDICTED: gamma aminobutyrate transaminase ...    302   2e-96   Nicotiana sylvestris
ref|XP_009592076.1|  PREDICTED: gamma aminobutyrate transaminase ...    299   3e-95   Nicotiana tomentosiformis
ref|XP_010313637.1|  PREDICTED: gamma aminobutyrate transaminase ...    298   5e-95   
ref|XP_009789181.1|  PREDICTED: gamma aminobutyrate transaminase ...    297   2e-94   Nicotiana sylvestris
ref|XP_006351982.1|  PREDICTED: gamma aminobutyrate transaminase ...    295   8e-94   Solanum tuberosum [potatoes]
ref|NP_001233777.1|  gamma aminobutyrate transaminase 3, chloropl...    295   1e-93   
ref|XP_006357874.1|  PREDICTED: gamma aminobutyrate transaminase ...    293   5e-93   Solanum tuberosum [potatoes]
gb|AGX01485.1|  mitochondrial gamma aminobutyrate transaminase 1        290   8e-92   Nicotiana tabacum [American tobacco]
ref|NP_001234336.1|  gamma aminobutyrate transaminase 1, mitochon...    288   3e-91   
ref|XP_009610291.1|  PREDICTED: gamma aminobutyrate transaminase ...    288   4e-91   Nicotiana tomentosiformis
ref|XP_009610292.1|  PREDICTED: gamma aminobutyrate transaminase ...    278   2e-87   Nicotiana tomentosiformis
ref|XP_011100393.1|  PREDICTED: gamma aminobutyrate transaminase ...    276   2e-86   Sesamum indicum [beniseed]
gb|KDP30431.1|  hypothetical protein JCGZ_16670                         276   2e-86   Jatropha curcas
gb|EYU42835.1|  hypothetical protein MIMGU_mgv1a004733mg                275   4e-86   Erythranthe guttata [common monkey flower]
gb|AGF95098.1|  4-aminobutyrate aminotransferase                        265   5e-86   Prunus persica
ref|XP_010941664.1|  PREDICTED: probable gamma-aminobutyrate tran...    275   7e-86   Elaeis guineensis
ref|XP_008652021.1|  PREDICTED: gamma aminobutyrate transaminase ...    272   6e-85   
ref|XP_006429770.1|  hypothetical protein CICLE_v10011509mg             271   2e-84   Citrus clementina [clementine]
gb|KDO64363.1|  hypothetical protein CISIN_1g010250mg                   270   3e-84   Citrus sinensis [apfelsine]
ref|XP_010036076.1|  PREDICTED: gamma aminobutyrate transaminase ...    270   4e-84   Eucalyptus grandis [rose gum]
gb|KHG00607.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    265   2e-83   Gossypium arboreum [tree cotton]
ref|XP_008229658.1|  PREDICTED: gamma aminobutyrate transaminase ...    268   4e-83   Prunus mume [ume]
ref|XP_009399251.1|  PREDICTED: probable gamma-aminobutyrate tran...    267   4e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798241.1|  PREDICTED: gamma-aminobutyrate transaminase ...    266   1e-82   
ref|XP_007215238.1|  hypothetical protein PRUPE_ppa004369mg             266   2e-82   Prunus persica
ref|XP_011100394.1|  PREDICTED: gamma aminobutyrate transaminase ...    265   2e-82   
ref|XP_007049029.1|  Pyridoxal phosphate-dependent transferases s...    265   8e-82   
ref|XP_002307913.1|  POLLEN-PISTIL INTERACTION 2 family protein         263   2e-81   
ref|XP_009347869.1|  PREDICTED: probable gamma-aminobutyrate tran...    263   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_009349581.1|  PREDICTED: gamma aminobutyrate transaminase ...    263   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_009349580.1|  PREDICTED: gamma aminobutyrate transaminase ...    263   4e-81   Pyrus x bretschneideri [bai li]
ref|XP_002322549.2|  hypothetical protein POPTR_0016s02000g             262   6e-81   Populus trichocarpa [western balsam poplar]
ref|XP_006858237.1|  hypothetical protein AMTR_s00062p00194620          261   9e-81   Amborella trichopoda
ref|XP_008365554.1|  PREDICTED: gamma-aminobutyrate transaminase ...    261   1e-80   
gb|AFS28620.1|  gamma-aminobutyrate transaminase 1                      261   1e-80   Malus domestica [apple tree]
sp|B8BBZ7.1|GATP3_ORYSI  RecName: Full=Probable gamma-aminobutyra...    261   1e-80   Oryza sativa Indica Group [Indian rice]
ref|XP_011001061.1|  PREDICTED: gamma aminobutyrate transaminase ...    261   2e-80   Populus euphratica
ref|XP_002445207.1|  hypothetical protein SORBIDRAFT_07g005930          260   3e-80   Sorghum bicolor [broomcorn]
ref|NP_001061237.1|  Os08g0205900                                       259   6e-80   
ref|XP_010260596.1|  PREDICTED: probable gamma-aminobutyrate tran...    259   1e-79   Nelumbo nucifera [Indian lotus]
emb|CDP16027.1|  unnamed protein product                                259   1e-79   Coffea canephora [robusta coffee]
ref|NP_001280788.1|  gamma aminobutyrate transaminase 3, chloropl...    258   1e-79   Malus domestica [apple tree]
ref|XP_004303943.1|  PREDICTED: gamma aminobutyrate transaminase ...    258   2e-79   Fragaria vesca subsp. vesca
ref|XP_008378345.1|  PREDICTED: gamma aminobutyrate transaminase ...    258   2e-79   Malus domestica [apple tree]
ref|XP_011004456.1|  PREDICTED: gamma aminobutyrate transaminase ...    258   3e-79   Populus euphratica
ref|XP_004972609.1|  PREDICTED: probable gamma-aminobutyrate tran...    257   3e-79   Setaria italica
ref|XP_006659928.1|  PREDICTED: probable gamma-aminobutyrate tran...    258   4e-79   
ref|XP_002268803.1|  PREDICTED: gamma aminobutyrate transaminase ...    257   4e-79   Vitis vinifera
emb|CBI34106.3|  unnamed protein product                                257   6e-79   Vitis vinifera
ref|XP_010234450.1|  PREDICTED: probable gamma-aminobutyrate tran...    257   6e-79   Brachypodium distachyon [annual false brome]
ref|XP_003573535.1|  PREDICTED: probable gamma-aminobutyrate tran...    256   8e-79   Brachypodium distachyon [annual false brome]
gb|AFW59441.1|  putative aminotransferase class III superfamily p...    254   1e-78   
ref|XP_002521054.1|  aminobutyrate aminotransferase, putative           256   1e-78   
ref|XP_009597725.1|  PREDICTED: gamma aminobutyrate transaminase ...    244   2e-78   
dbj|BAK05511.1|  predicted protein                                      255   3e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152508.1|  aminotransferase y4uB                              254   4e-78   Zea mays [maize]
gb|ACF87978.1|  unknown                                                 254   4e-78   Zea mays [maize]
ref|NP_001053863.1|  Os04g0614600                                       254   4e-78   
gb|EEC77995.1|  hypothetical protein OsI_17385                          254   5e-78   Oryza sativa Indica Group [Indian rice]
sp|Q01K11.1|GATP1_ORYSI  RecName: Full=Gamma-aminobutyrate transa...    254   7e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_004171018.1|  PREDICTED: gamma aminobutyrate transaminase ...    254   7e-78   
ref|XP_004147736.1|  PREDICTED: gamma aminobutyrate transaminase ...    253   9e-78   Cucumis sativus [cucumbers]
ref|XP_006652817.1|  PREDICTED: gamma-aminobutyrate transaminase ...    253   1e-77   Oryza brachyantha
ref|XP_004976801.1|  PREDICTED: gamma-aminobutyrate transaminase ...    253   2e-77   Setaria italica
ref|XP_006592029.1|  PREDICTED: gamma aminobutyrate transaminase ...    252   3e-77   Glycine max [soybeans]
ref|XP_008677242.1|  PREDICTED: aminotransferase y4uB isoform X1        251   5e-77   Zea mays [maize]
dbj|BAI66419.1|  aminotransferase                                       251   7e-77   Triticum aestivum [Canadian hard winter wheat]
gb|AFW61009.1|  putative aminotransferase class III superfamily p...    251   7e-77   
gb|AFW61008.1|  putative aminotransferase class III superfamily p...    251   7e-77   
emb|CDY58748.1|  BnaCnng33690D                                          251   8e-77   Brassica napus [oilseed rape]
gb|KHN05488.1|  Putative aminotransferase y4uB                          250   1e-76   Glycine soja [wild soybean]
ref|XP_008451896.1|  PREDICTED: gamma aminobutyrate transaminase ...    250   2e-76   Cucumis melo [Oriental melon]
ref|NP_001148620.1|  aminotransferase y4uB                              250   2e-76   Zea mays [maize]
ref|XP_009776834.1|  PREDICTED: gamma aminobutyrate transaminase ...    245   2e-76   Nicotiana sylvestris
ref|XP_006406200.1|  hypothetical protein EUTSA_v10020563mg             249   3e-76   Eutrema salsugineum [saltwater cress]
ref|XP_008451895.1|  PREDICTED: gamma aminobutyrate transaminase ...    249   3e-76   Cucumis melo [Oriental melon]
ref|XP_003580544.1|  PREDICTED: gamma-aminobutyrate transaminase ...    249   4e-76   Brachypodium distachyon [annual false brome]
ref|XP_002883348.1|  gamma-aminobutyrate transaminase subunit pre...    249   5e-76   
ref|XP_010525162.1|  PREDICTED: gamma-aminobutyrate transaminase ...    248   7e-76   Tarenaya hassleriana [spider flower]
ref|XP_010525163.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-aminob...    248   1e-75   Tarenaya hassleriana [spider flower]
ref|XP_002447091.1|  hypothetical protein SORBIDRAFT_06g028440          248   1e-75   Sorghum bicolor [broomcorn]
ref|XP_006406198.1|  hypothetical protein EUTSA_v10020531mg             248   1e-75   
tpg|DAA59557.1|  TPA: putative aminotransferase class III superfa...    246   2e-75   
ref|XP_003537747.1|  PREDICTED: gamma aminobutyrate transaminase ...    247   3e-75   Glycine max [soybeans]
ref|XP_010488236.1|  PREDICTED: gamma-aminobutyrate transaminase ...    246   4e-75   Camelina sativa [gold-of-pleasure]
gb|KDO64364.1|  hypothetical protein CISIN_1g010250mg                   244   6e-75   Citrus sinensis [apfelsine]
gb|KHN09253.1|  Putative aminotransferase y4uB                          247   7e-75   Glycine soja [wild soybean]
ref|XP_009145420.1|  PREDICTED: gamma-aminobutyrate transaminase ...    246   8e-75   Brassica rapa
emb|CDY37389.1|  BnaC05g30410D                                          246   9e-75   Brassica napus [oilseed rape]
gb|KJB22727.1|  hypothetical protein B456_004G063100                    245   1e-74   Gossypium raimondii
ref|XP_010511056.1|  PREDICTED: gamma-aminobutyrate transaminase ...    246   1e-74   
ref|XP_006592030.1|  PREDICTED: gamma aminobutyrate transaminase ...    244   2e-74   Glycine max [soybeans]
ref|XP_009109118.1|  PREDICTED: gamma-aminobutyrate transaminase ...    245   2e-74   Brassica rapa
emb|CDY39506.1|  BnaA01g24820D                                          244   3e-74   Brassica napus [oilseed rape]
ref|XP_008668890.1|  PREDICTED: gamma-aminobutyrate transaminase ...    244   3e-74   Zea mays [maize]
gb|ADM13673.1|  putative aminotransferase                               243   4e-74   Capsicum annuum
ref|XP_007131572.1|  hypothetical protein PHAVU_011G024300g             244   5e-74   Phaseolus vulgaris [French bean]
ref|XP_006297475.1|  hypothetical protein CARUB_v10013496mg             243   1e-73   
ref|XP_004505667.1|  PREDICTED: gamma aminobutyrate transaminase ...    243   1e-73   Cicer arietinum [garbanzo]
ref|XP_010313638.1|  PREDICTED: gamma aminobutyrate transaminase ...    241   1e-73   
gb|KFK39511.1|  hypothetical protein AALP_AA3G253600                    243   1e-73   Arabis alpina [alpine rockcress]
ref|XP_010466490.1|  PREDICTED: gamma-aminobutyrate transaminase ...    242   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_004244777.1|  PREDICTED: gamma aminobutyrate transaminase ...    241   2e-73   Solanum lycopersicum
gb|AAC78480.1|  putative aminotransferase                               240   4e-73   Capsicum chinense [bonnet pepper]
gb|AAK52899.1|AF351125_1  gamma-aminobutyrate transaminase subuni...    241   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566700.1|  gamma-aminobutyrate transaminase POP2                 241   6e-73   Arabidopsis thaliana [mouse-ear cress]
gb|ADG65346.1|  putative aminotransferase                               239   1e-72   Capsicum frutescens [bird pepper]
dbj|BAB03068.1|  aminotransferase-like protein                          239   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189947.1|  gamma-aminobutyrate transaminase POP2              240   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648197.1|  PREDICTED: gamma aminobutyrate transaminase ...    239   3e-72   Vitis vinifera
emb|CBI34103.3|  unnamed protein product                                238   6e-72   Vitis vinifera
ref|XP_011467676.1|  PREDICTED: gamma aminobutyrate transaminase ...    235   2e-71   Fragaria vesca subsp. vesca
gb|ABF69998.1|  gamma-aminobutyrate transaminase, putative              237   3e-71   Musa acuminata [banana]
ref|XP_003607298.1|  Aminotransferase y4uB                              236   4e-71   Medicago truncatula
ref|XP_010680154.1|  PREDICTED: gamma aminobutyrate transaminase ...    235   1e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001053862.1|  Os04g0614500                                       232   1e-69   
gb|EPS57260.1|  hypothetical protein M569_17559                         220   2e-69   Genlisea aurea
ref|XP_009145417.1|  PREDICTED: gamma-aminobutyrate transaminase ...    231   2e-69   Brassica rapa
emb|CDY10622.1|  BnaA05g17400D                                          230   3e-69   Brassica napus [oilseed rape]
ref|XP_006351980.1|  PREDICTED: gamma aminobutyrate transaminase ...    229   8e-69   Solanum tuberosum [potatoes]
ref|XP_006652818.1|  PREDICTED: probable gamma-aminobutyrate tran...    228   4e-68   Oryza brachyantha
ref|XP_008464679.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    229   4e-68   Cucumis melo [Oriental melon]
emb|CAD12664.1|  viroid RNA-binding protein                             228   4e-68   Solanum lycopersicum
gb|AFK39370.1|  unknown                                                 227   5e-68   Lotus japonicus
ref|XP_004166491.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    226   1e-67   
ref|XP_004145993.1|  PREDICTED: gamma aminobutyrate transaminase ...    227   1e-67   
ref|XP_004147774.1|  PREDICTED: gamma aminobutyrate transaminase ...    226   2e-67   Cucumis sativus [cucumbers]
ref|XP_010093137.1|  putative aminotransferase y4uB                     225   3e-67   
ref|NP_001234340.1|  gamma aminobutyrate transaminase 2                 224   6e-67   
gb|EEC77994.1|  hypothetical protein OsI_17384                          224   1e-66   Oryza sativa Indica Group [Indian rice]
ref|NP_001045660.1|  Os02g0112900                                       219   1e-64   
gb|AAK11219.1|AF324485_1  aminotransferase-like protein                 219   1e-64   Oryza sativa [red rice]
gb|EEE61675.1|  hypothetical protein OsJ_16144                          216   6e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451902.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    215   9e-64   
gb|EMS61591.1|  putative aminotransferase y4uB                          201   2e-57   Triticum urartu
ref|XP_002978448.1|  hypothetical protein SELMODRAFT_177017             199   3e-57   Selaginella moellendorffii
ref|XP_002970285.1|  hypothetical protein SELMODRAFT_270846             199   3e-57   Selaginella moellendorffii
ref|XP_001783174.1|  predicted protein                                  197   2e-56   
ref|XP_008662070.1|  PREDICTED: aminotransferase y4uB isoform X1        189   1e-53   Zea mays [maize]
gb|EMT06765.1|  Putative aminotransferase y4uB                          190   1e-53   
gb|EMT11453.1|  Putative aminotransferase y4uB                          190   2e-53   
ref|XP_001762156.1|  predicted protein                                  188   2e-53   
ref|XP_004173032.1|  PREDICTED: gamma aminobutyrate transaminase ...    184   4e-52   
gb|EEC77996.1|  hypothetical protein OsI_17386                          178   4e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008652184.1|  PREDICTED: gamma-aminobutyrate transaminase ...    159   2e-45   
ref|XP_008652185.1|  PREDICTED: gamma-aminobutyrate transaminase ...    158   2e-45   Zea mays [maize]
gb|EMS53048.1|  putative aminotransferase y4uB                          162   4e-43   Triticum urartu
ref|WP_041862975.1|  aminotransferase                                   153   5e-40   Bordetella petrii
emb|CAP43438.1|  putative aminotransferase                              152   5e-40   Bordetella petrii
ref|WP_013742690.1|  aminotransferase                                   151   2e-39   Pusillimonas sp. T7-7
ref|WP_044433671.1|  aminotransferase                                   151   2e-39   Skermanella aerolata
ref|WP_026641250.1|  aminotransferase                                   150   3e-39   Bordetella petrii
ref|XP_011468608.1|  PREDICTED: gamma aminobutyrate transaminase ...    145   2e-38   Fragaria vesca subsp. vesca
ref|WP_018897972.1|  aminotransferase                                   148   3e-38   Rhizobium sp. 2MFCol3.1
ref|WP_028355511.1|  aminotransferase                                   148   3e-38   Bordetella
ref|WP_034191978.1|  aminotransferase                                   147   5e-38   Burkholderia cenocepacia
ref|WP_025516482.1|  aminotransferase                                   147   8e-38   Bordetella trematum
ref|WP_039371201.1|  aminotransferase                                   146   2e-37   Burkholderia
ref|WP_042300360.1|  aminotransferase                                   146   2e-37   Paraburkholderia kururiensis
ref|WP_017775036.1|  aminotransferase                                   145   2e-37   Paraburkholderia kururiensis
ref|WP_024509951.1|  aminotransferase                                   145   3e-37   Bradyrhizobium sp. ARR65
ref|WP_031360219.1|  aminotransferase                                   145   3e-37   Caballeronia sordidicola
ref|WP_023048105.1|  MULTISPECIES: aminotransferase                     145   4e-37   Pseudomonas
ref|WP_024810724.1|  aminotransferase                                   144   8e-37   Oceanicola sp. HL-35
ref|WP_012417867.1|  aminotransferase                                   144   1e-36   Bordetella avium
ref|WP_012367259.1|  aminotransferase                                   143   1e-36   Burkholderia ambifaria
ref|WP_018898134.1|  hypothetical protein                               143   2e-36   Rhizobium sp. 2MFCol3.1
ref|WP_035541932.1|  aminotransferase                                   143   2e-36   Burkholderia sp. UYPR1.413
ref|WP_028466856.1|  aminotransferase                                   143   2e-36   Nisaea denitrificans
ref|WP_043683550.1|  aminotransferase                                   143   2e-36   Castellaniella defragrans
ref|WP_029014519.1|  aminotransferase                                   143   2e-36   Niveispirillum irakense
ref|WP_037458242.1|  aminotransferase                                   142   3e-36   Skermanella stibiiresistens
ref|WP_012566210.1|  aminotransferase                                   142   3e-36   Rhodospirillum centenum
ref|WP_037454523.1|  aminotransferase                                   142   3e-36   Skermanella stibiiresistens
ref|WP_032964494.1|  aminotransferase                                   142   3e-36   Bordetella hinzii
ref|WP_029579725.1|  aminotransferase                                   142   4e-36   Bordetella hinzii
ref|WP_034802113.1|  aminotransferase                                   142   4e-36   
ref|WP_026987379.1|  aminotransferase                                   142   4e-36   Fodinicurvata fenggangensis
ref|WP_043683574.1|  aminotransferase                                   142   5e-36   Castellaniella defragrans
gb|KDP71648.1|  aminotransferase                                        142   5e-36   Ensifer adhaerens
ref|WP_007733279.1|  aminotransferase                                   142   6e-36   Burkholderia sp. BT03
ref|WP_009770733.1|  aminotransferase                                   141   7e-36   Paraburkholderia hospita
ref|WP_005014723.1|  aminotransferase                                   141   8e-36   Bordetella holmesii
ref|WP_041798615.1|  aminotransferase                                   141   1e-35   
ref|WP_035988183.1|  aminotransferase                                   141   1e-35   Paraburkholderia caribensis
ref|WP_040121086.1|  aminotransferase                                   141   1e-35   Sinorhizobium meliloti
gb|ABD06201.1|  aminotransferase                                        141   1e-35   Rhodopseudomonas palustris HaA2
ref|WP_025165321.1|  aminotransferase                                   140   1e-35   Pseudomonas taeanensis
ref|WP_044033419.1|  aminotransferase                                   140   1e-35   Roseobacter denitrificans
gb|ABG31913.1|  aminotransferase                                        140   1e-35   Roseobacter denitrificans OCh 114
gb|EWM49408.1|  aminotransferase class-III family protein               141   2e-35   Bordetella holmesii 35009
ref|WP_018430650.1|  hypothetical protein                               140   2e-35   Hoeflea sp. 108
ref|WP_028793896.1|  aminotransferase                                   140   2e-35   Thalassobaculum
ref|WP_043209568.1|  aminotransferase                                   140   2e-35   Bordetella pseudohinzii
ref|WP_020949918.1|  adenosylmethionine-8-amino-7-oxononanoate am...    140   2e-35   Paracoccus aminophilus
ref|WP_039191434.1|  aminotransferase                                   140   2e-35   Aureimonas altamirensis
ref|WP_029742660.1|  aminotransferase                                   140   3e-35   Rhizobiales bacterium
ref|WP_023663383.1|  aminotransferase                                   140   3e-35   Pseudomonas
ref|WP_018904326.1|  aminotransferase                                   140   3e-35   Variovorax paradoxus
ref|WP_041710497.1|  aminotransferase                                   140   3e-35   
ref|WP_028003714.1|  aminotransferase                                   140   3e-35   Sinorhizobium meliloti
ref|WP_017128138.1|  hypothetical protein                               139   4e-35   Pseudomonas gingeri
ref|WP_018010394.1|  aminotransferase                                   139   4e-35   Sinorhizobium medicae
gb|AFK64419.1|  aminotransferase                                        140   4e-35   Advenella kashmirensis WT001
ref|WP_025374662.1|  aminotransferase                                   139   5e-35   Advenella mimigardefordensis
ref|WP_011969374.1|  aminotransferase                                   139   6e-35   Sinorhizobium medicae
dbj|GAK69890.1|  putative aminotransferase                              139   6e-35   Agrobacterium rubi TR3 = NBRC 13261
ref|WP_026616781.1|  aminotransferase                                   139   6e-35   Ensifer aridi
ref|WP_038761742.1|  aminotransferase                                   139   7e-35   
ref|WP_008069788.1|  aminotransferase                                   139   8e-35   Pseudomonas sp. GM79
ref|WP_027517565.1|  aminotransferase                                   139   8e-35   Bradyrhizobium sp. WSM1417
ref|WP_027569703.1|  aminotransferase                                   138   9e-35   Bradyrhizobium sp. URHA0013
ref|WP_007591914.1|  aminotransferase                                   138   1e-34   Bradyrhizobium sp. WSM1253
ref|WP_025035884.1|  aminotransferase                                   138   1e-34   Bradyrhizobium sp. DOA9
ref|WP_008129949.1|  aminotransferase                                   138   1e-34   Bradyrhizobium sp. YR681
ref|WP_007609403.1|  aminotransferase                                   138   1e-34   Bradyrhizobium sp. WSM471
ref|WP_042133140.1|  aminotransferase                                   138   1e-34   Pseudomonas
ref|WP_036350477.1|  aminotransferase                                   138   1e-34   Microvirga sp. BSC39
ref|WP_018456285.1|  aminotransferase                                   138   1e-34   Bradyrhizobium
ref|WP_027542945.1|  aminotransferase                                   138   1e-34   Bradyrhizobium sp. WSM2254
ref|WP_028055523.1|  aminotransferase                                   138   1e-34   Sinorhizobium meliloti
ref|WP_027283997.1|  aminotransferase                                   138   1e-34   Rubritepida flocculans
ref|WP_022729947.1|  aminotransferase                                   138   1e-34   Fodinicurvata sediminis
gb|EJZ32369.1|  aminotransferase                                        138   1e-34   
ref|WP_036349682.1|  aminotransferase                                   138   2e-34   
emb|CCF21345.1|  Uncharacterized aminotransferase y4uB                  137   2e-34   Rhizobium sp. NT-26
ref|WP_036022740.1|  aminotransferase                                   137   2e-34   Bradyrhizobium yuanmingense
ref|WP_036000540.1|  aminotransferase                                   137   2e-34   Bradyrhizobium yuanmingense
ref|WP_034858533.1|  aminotransferase                                   137   2e-34   Ensifer sojae
ref|WP_018317519.1|  aminotransferase                                   137   2e-34   Bradyrhizobium sp. WSM2793
ref|WP_016494812.1|  putative aminotransferase                          137   2e-34   Pseudomonas resinovorans
ref|WP_023628464.1|  aminotransferase                                   137   2e-34   Pseudomonas
ref|WP_023002240.1|  MULTISPECIES: aminotransferase                     137   2e-34   Labrenzia
ref|WP_035675727.1|  aminotransferase                                   137   2e-34   Bradyrhizobium liaoningense
ref|WP_037395619.1|  aminotransferase                                   137   2e-34   Sinorhizobium fredii
ref|WP_036995912.1|  aminotransferase                                   137   2e-34   Pseudomonas donghuensis
ref|WP_033067194.1|  aminotransferase                                   137   2e-34   
ref|WP_037434041.1|  aminotransferase                                   137   2e-34   Sinorhizobium fredii
ref|WP_042778065.1|  aminotransferase                                   137   2e-34   Sinorhizobium fredii
gb|EGD57468.1|  aminotransferase                                        137   3e-34   Novosphingobium nitrogenifigens DSM 19370
ref|WP_036500215.1|  aminotransferase                                   137   3e-34   
ref|WP_036993733.1|  aminotransferase                                   137   3e-34   
ref|WP_027557626.1|  MULTISPECIES: aminotransferase                     137   3e-34   Bradyrhizobium
ref|WP_035715448.1|  aminotransferase                                   137   3e-34   Bradyrhizobium sp. CCBAU 43298
ref|WP_035675507.1|  aminotransferase                                   137   3e-34   Azospirillum
ref|WP_019171585.1|  aminotransferase                                   137   3e-34   Pseudaminobacter salicylatoxidans
ref|WP_014239351.1|  aminotransferase                                   137   3e-34   Azospirillum brasilense
ref|WP_027551405.1|  aminotransferase                                   137   3e-34   Bradyrhizobium sp. Cp5.3
ref|WP_026226723.1|  aminotransferase                                   137   4e-34   Hoeflea sp. 108
ref|WP_028181072.1|  aminotransferase                                   137   4e-34   Bradyrhizobium japonicum
ref|WP_038526098.1|  aminotransferase                                   137   4e-34   Azospirillum brasilense
ref|WP_040973849.1|  aminotransferase                                   137   4e-34   Mesorhizobium sp. ORS 3324
ref|WP_003525818.1|  aminotransferase                                   136   4e-34   Sinorhizobium meliloti
ref|WP_026621810.1|  aminotransferase                                   136   4e-34   Ensifer sp. WSM1721
ref|WP_011086907.1|  MULTISPECIES: aminotransferase                     136   4e-34   Bradyrhizobium diazoefficiens
ref|WP_021586359.1|  MULTISPECIES: aminotransferase                     136   4e-34   Ochrobactrum
ref|WP_028171115.1|  MULTISPECIES: aminotransferase                     136   4e-34   Bradyrhizobium
ref|WP_028136798.1|  aminotransferase                                   136   4e-34   Bradyrhizobium japonicum
gb|ELS27909.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    136   4e-34   Pseudomonas furukawaii
gb|EEE56165.1|  hypothetical protein OsJ_05081                          137   4e-34   Oryza sativa Japonica Group [Japonica rice]
ref|WP_027576286.1|  aminotransferase                                   136   5e-34   Bradyrhizobium sp. WSM1743
ref|WP_016558738.1|  aminotransferase                                   136   5e-34   Rhizobium grahamii
ref|WP_015008570.1|  aminotransferase                                   136   5e-34   Sinorhizobium meliloti
ref|WP_010975253.1|  aminotransferase                                   136   5e-34   Sinorhizobium meliloti
ref|WP_017277372.1|  aminotransferase                                   136   5e-34   Sinorhizobium meliloti
ref|WP_017273373.1|  aminotransferase                                   136   5e-34   Sinorhizobium meliloti
ref|WP_027991581.1|  aminotransferase                                   136   5e-34   Sinorhizobium meliloti
ref|WP_040060658.1|  aminotransferase                                   136   5e-34   
gb|AJD51480.1|  aminotransferase                                        136   5e-34   Thalassospira xiamenensis M-5 = DSM 17429
ref|WP_017266638.1|  aminotransferase                                   136   5e-34   Sinorhizobium meliloti
ref|WP_013850008.1|  aminotransferase                                   136   5e-34   Sinorhizobium/Ensifer group
gb|KEO56896.1|  aminotransferase                                        136   5e-34   Thalassospira permensis NBRC 106175
ref|WP_022709596.1|  aminotransferase                                   136   5e-34   Pseudochrobactrum
gb|AAF99609.1|AF247644_1  family II aminotransferase                    136   6e-34   Pseudomonas fluorescens
ref|WP_037990023.1|  aminotransferase                                   136   6e-34   
ref|WP_024338082.1|  aminotransferase                                   136   6e-34   Bradyrhizobium japonicum
ref|WP_029043410.1|  aminotransferase                                   136   6e-34   Cupriavidus
ref|WP_028144979.1|  MULTISPECIES: aminotransferase                     136   6e-34   Bradyrhizobium
gb|ETF04525.1|  aminotransferase                                        136   6e-34   Advenella kashmirensis W13003
ref|WP_018645424.1|  aminotransferase                                   136   6e-34   
ref|WP_028053780.1|  aminotransferase                                   136   7e-34   
gb|KJC51996.1|  aminotransferase                                        136   7e-34   
ref|WP_027535373.1|  aminotransferase                                   136   7e-34   
gb|KJC55260.1|  aminotransferase                                        136   7e-34   
ref|WP_013962061.1|  aminotransferase                                   136   7e-34   
ref|WP_035705889.1|  aminotransferase                                   136   7e-34   
ref|WP_025899271.1|  aminotransferase                                   136   7e-34   
ref|WP_026756592.1|  aminotransferase                                   135   8e-34   
ref|WP_037131992.1|  aminotransferase                                   135   8e-34   
ref|WP_036577631.1|  aminotransferase                                   135   8e-34   
emb|CCQ73232.1|  Aminotransferase                                       135   8e-34   
ref|WP_029925894.1|  MULTISPECIES: aminotransferase                     135   8e-34   
ref|WP_010658032.1|  aminotransferase                                   135   8e-34   
ref|WP_011982390.1|  aminotransferase                                   135   8e-34   
ref|WP_015243391.1|  Adenosylmethionine-8-amino-7-oxononanoate am...    135   9e-34   
ref|WP_035022366.1|  MULTISPECIES: aminotransferase                     135   1e-33   
ref|WP_027523883.1|  aminotransferase                                   135   1e-33   
ref|WP_025038425.1|  aminotransferase                                   135   1e-33   
ref|WP_007681117.1|  aminotransferase                                   135   1e-33   
ref|WP_014193010.1|  aminotransferase                                   135   1e-33   
dbj|BAO90602.1|  aminotransferase                                       135   1e-33   
ref|WP_034103255.1|  aminotransferase                                   135   1e-33   
ref|WP_006465915.1|  aminotransferase                                   135   1e-33   
ref|WP_037017213.1|  aminotransferase                                   135   1e-33   
ref|WP_041006007.1|  aminotransferase                                   135   1e-33   
ref|WP_036487003.1|  aminotransferase                                   135   1e-33   
ref|WP_015686609.1|  aminotransferase                                   135   2e-33   
ref|WP_035741142.1|  aminotransferase                                   135   2e-33   
ref|WP_007758462.1|  aminotransferase                                   135   2e-33   
ref|WP_008190932.1|  aminotransferase                                   135   2e-33   
ref|WP_020950496.1|  aminotransferase                                   135   2e-33   
ref|WP_037063023.1|  aminotransferase                                   135   2e-33   
ref|WP_041006181.1|  aminotransferase                                   135   2e-33   
ref|WP_027300272.1|  aminotransferase                                   135   2e-33   
ref|WP_040996134.1|  aminotransferase                                   135   2e-33   
ref|WP_042727875.1|  aminotransferase                                   135   2e-33   
ref|WP_037123301.1|  aminotransferase                                   134   2e-33   
ref|WP_040983804.1|  aminotransferase                                   134   2e-33   
ref|WP_041957850.1|  aminotransferase                                   134   2e-33   
ref|WP_017227445.1|  hypothetical protein                               134   2e-33   
ref|WP_027263575.1|  aminotransferase                                   134   2e-33   
ref|WP_028754908.1|  aminotransferase                                   134   2e-33   
ref|WP_007995736.1|  aminotransferase                                   134   3e-33   
ref|WP_003576511.1|  aminotransferase                                   134   3e-33   
ref|WP_037081315.1|  aminotransferase                                   134   3e-33   
ref|WP_007257253.1|  aminotransferase                                   134   3e-33   
ref|WP_038376943.1|  aminotransferase                                   134   3e-33   
ref|WP_022733433.1|  aminotransferase                                   134   3e-33   
ref|WP_038591093.1|  aminotransferase                                   134   3e-33   
ref|WP_035633702.1|  aminotransferase                                   134   3e-33   
ref|WP_003813182.1|  putative aminotransferase                          134   3e-33   
ref|WP_033464289.1|  aminotransferase                                   134   3e-33   
ref|WP_010928538.1|  aminotransferase                                   134   3e-33   
ref|WP_023430501.1|  Aminotransferase, class III                        134   3e-33   
ref|WP_010926321.1|  aminotransferase                                   134   3e-33   
ref|WP_038546843.1|  aminotransferase                                   134   3e-33   
ref|WP_037156550.1|  aminotransferase                                   134   4e-33   
ref|WP_015343311.1|  aminotransferase class-III                         134   4e-33   
ref|WP_031242205.1|  aminotransferase                                   134   4e-33   
ref|WP_017275479.1|  omega amino acid--pyruvate aminotransferase        134   4e-33   
ref|WP_018701456.1|  hypothetical protein                               134   4e-33   
ref|WP_044417924.1|  aminotransferase                                   134   5e-33   
ref|WP_028157521.1|  aminotransferase                                   133   6e-33   
ref|WP_024849370.1|  aminotransferase                                   133   6e-33   
ref|WP_006934289.1|  aminotransferase                                   133   6e-33   
ref|WP_039149393.1|  aminotransferase                                   133   6e-33   
ref|WP_038957353.1|  aminotransferase                                   133   6e-33   
gb|AHY51042.1|  hypothetical protein BJS_03890                          133   6e-33   
ref|WP_014495749.1|  aminotransferase                                   133   6e-33   
ref|WP_020049965.1|  aminotransferase                                   133   6e-33   
ref|WP_028147775.1|  aminotransferase                                   133   6e-33   
ref|WP_019647031.1|  hypothetical protein                               133   6e-33   
ref|WP_036367910.1|  aminotransferase                                   133   7e-33   
ref|WP_038313987.1|  aminotransferase                                   133   7e-33   
ref|WP_028880172.1|  aminotransferase                                   133   7e-33   
ref|WP_027165281.1|  aminotransferase                                   133   7e-33   
ref|WP_007798845.1|  aminotransferase                                   133   7e-33   
ref|WP_038945793.1|  aminotransferase                                   133   8e-33   
ref|WP_025031754.1|  aminotransferase                                   133   8e-33   
gb|ESW84520.1|  aminotransferase                                        133   8e-33   
ref|WP_036032589.1|  aminotransferase                                   131   9e-33   
ref|WP_041794682.1|  aminotransferase                                   133   9e-33   
ref|WP_031211906.1|  aminotransferase                                   133   9e-33   
ref|WP_036521510.1|  aminotransferase                                   133   9e-33   
ref|WP_016733076.1|  aminotransferase                                   132   1e-32   
ref|WP_029350573.1|  aminotransferase                                   132   1e-32   
ref|WP_028002805.1|  aminotransferase                                   132   1e-32   
emb|CCG07898.1|  Aminotransferase                                       133   1e-32   
ref|WP_011425411.1|  aminotransferase                                   132   1e-32   
ref|WP_038688957.1|  aminotransferase                                   132   1e-32   
ref|WP_008597642.1|  aminotransferase                                   132   1e-32   
ref|WP_017140341.1|  aminotransferase                                   132   1e-32   
ref|WP_043761730.1|  aminotransferase                                   132   1e-32   
ref|WP_041670771.1|  aminotransferase                                   132   1e-32   
gb|EKX59897.1|  Omega-amino acid--pyruvate aminotransferase             132   1e-32   
ref|WP_011339161.1|  aminotransferase                                   132   1e-32   
gb|ACM03296.1|  Aminotransferase                                        132   1e-32   
ref|WP_037114065.1|  aminotransferase                                   132   1e-32   
ref|WP_037138943.1|  aminotransferase                                   132   1e-32   
ref|WP_012483828.1|  aminotransferase                                   132   1e-32   
emb|CDX30075.1|  Gamma aminobutyrate transaminase 1, mitochondrial      132   1e-32   
ref|WP_028286734.1|  aminotransferase                                   132   1e-32   
ref|WP_028601482.1|  aminotransferase                                   132   1e-32   
gb|ENS36263.1|  hypothetical protein C087_00163                         130   2e-32   
ref|WP_042639479.1|  aminotransferase                                   132   2e-32   
ref|WP_007924918.1|  aminotransferase                                   132   2e-32   
ref|WP_023797840.1|  aminotransferase                                   132   2e-32   
emb|CCV15251.1|  Uncharacterized aminotransferase y4uB                  132   2e-32   
ref|WP_007008906.1|  aminotransferase                                   132   2e-32   
ref|WP_038937402.1|  MULTISPECIES: aminotransferase                     132   2e-32   
ref|WP_029617577.1|  aminotransferase                                   132   2e-32   
ref|WP_011084499.1|  MULTISPECIES: aminotransferase                     132   2e-32   
ref|WP_010140242.1|  aminotransferase                                   132   2e-32   
ref|WP_028144457.1|  aminotransferase                                   132   2e-32   
ref|WP_035716738.1|  aminotransferase                                   132   2e-32   
ref|WP_037164468.1|  MULTISPECIES: aminotransferase                     132   2e-32   
ref|WP_014498006.1|  MULTISPECIES: aminotransferase                     132   2e-32   
ref|WP_036242028.1|  aminotransferase                                   132   2e-32   
gb|KJF72733.1|  aminotransferase                                        132   2e-32   
ref|WP_043948562.1|  aminotransferase                                   132   2e-32   
ref|WP_035681626.1|  aminotransferase                                   132   2e-32   
ref|WP_035668747.1|  MULTISPECIES: aminotransferase                     132   2e-32   
gb|EDQ03816.1|  aminotransferase                                        132   2e-32   
ref|WP_040701702.1|  aminotransferase                                   132   2e-32   
ref|WP_033967567.1|  aminotransferase                                   132   2e-32   
ref|WP_025769698.1|  aminotransferase                                   132   2e-32   
ref|WP_025056008.1|  aminotransferase                                   132   2e-32   
gb|KGJ67633.1|  putative aminotransferase                               132   2e-32   
gb|AHY56964.1|  aminotransferase                                        132   2e-32   
ref|WP_037088027.1|  aminotransferase                                   132   2e-32   
gb|EGJ19989.1|  aminotransferase                                        132   2e-32   
ref|WP_029062246.1|  aminotransferase                                   131   2e-32   
gb|EXU84827.1|  aminotransferase                                        131   3e-32   
ref|WP_028958672.1|  aminotransferase                                   131   3e-32   
ref|WP_017750300.1|  aminotransferase                                   131   3e-32   
ref|WP_044287138.1|  aminotransferase                                   131   3e-32   
ref|WP_024589111.1|  aminotransferase                                   131   3e-32   
ref|WP_002967099.1|  MULTISPECIES: aminotransferase                     131   3e-32   
ref|WP_008933706.1|  aminotransferase                                   131   3e-32   
ref|WP_011842797.1|  aminotransferase                                   131   3e-32   
ref|WP_006195177.1|  hypothetical protein                               131   3e-32   
ref|WP_004689415.1|  aminotransferase                                   131   3e-32   
ref|WP_006212579.1|  hypothetical protein                               131   3e-32   
ref|WP_004687895.1|  aminotransferase                                   131   3e-32   
ref|WP_018389309.1|  aminotransferase                                   131   3e-32   
ref|WP_002965440.1|  aminotransferase                                   131   3e-32   
ref|WP_006120346.1|  hypothetical protein                               131   3e-32   
ref|WP_035693855.1|  aminotransferase                                   131   3e-32   
ref|WP_010930858.1|  aminotransferase                                   131   3e-32   
ref|XP_003389628.1|  PREDICTED: gamma aminobutyrate transaminase ...    131   4e-32   
ref|WP_028096189.1|  aminotransferase                                   131   4e-32   
ref|WP_037014756.1|  aminotransferase                                   131   4e-32   
ref|WP_009469786.1|  aminotransferase                                   131   4e-32   
ref|WP_009756518.1|  aminotransferase                                   130   5e-32   
ref|WP_036639320.1|  aminotransferase                                   130   5e-32   
ref|WP_011810918.1|  aminotransferase                                   130   5e-32   
ref|WP_042694454.1|  aminotransferase                                   130   5e-32   
ref|WP_037210883.1|  aminotransferase                                   130   5e-32   
ref|WP_023513399.1|  hypothetical protein                               130   5e-32   
ref|WP_008935239.1|  MULTISPECIES: aminotransferase                     130   6e-32   
ref|WP_027230049.1|  aminotransferase                                   130   6e-32   
ref|WP_029003855.1|  aminotransferase                                   130   8e-32   
ref|WP_033534791.1|  aminotransferase                                   130   8e-32   
ref|WP_006191222.1|  MULTISPECIES: aminotransferase                     130   8e-32   
ref|WP_015039513.1|  aminotransferase                                   130   8e-32   
ref|WP_035838674.1|  aminotransferase                                   130   8e-32   
gb|EFG84567.1|  aminotransferase                                        130   9e-32   
ref|WP_027136175.1|  aminotransferase                                   130   9e-32   
ref|WP_040511780.1|  aminotransferase                                   130   9e-32   
ref|WP_014249011.1|  aminotransferase                                   130   9e-32   
ref|WP_043621741.1|  aminotransferase                                   130   9e-32   
ref|WP_015931963.1|  aminotransferase                                   130   1e-31   
ref|WP_019860204.1|  MULTISPECIES: aminotransferase                     130   1e-31   
ref|WP_012783843.1|  aminotransferase                                   130   1e-31   
ref|WP_043754256.1|  aminotransferase                                   130   1e-31   
ref|WP_008840155.1|  aminotransferase                                   130   1e-31   
ref|WP_019013610.1|  hypothetical protein                               130   1e-31   
ref|WP_009542240.1|  Adenosylmethionine-8-amino-7-oxononanoate am...    129   1e-31   
ref|WP_037377324.1|  aminotransferase                                   129   1e-31   
ref|WP_011481392.1|  aminotransferase                                   129   1e-31   
ref|WP_043774658.1|  aminotransferase                                   129   1e-31   
ref|WP_007439629.1|  aminotransferase                                   129   1e-31   
ref|WP_012317851.1|  MULTISPECIES: aminotransferase                     129   1e-31   
ref|WP_042692198.1|  aminotransferase                                   129   1e-31   
ref|WP_027151432.1|  aminotransferase                                   129   2e-31   
ref|WP_024514240.1|  aminotransferase                                   129   2e-31   
ref|WP_013166382.1|  aminotransferase                                   129   2e-31   
gb|ETX26904.1|  aminotransferase                                        129   2e-31   
ref|WP_006337224.1|  hypothetical protein                               129   2e-31   
ref|WP_037924369.1|  aminotransferase                                   129   2e-31   
ref|WP_021692667.1|  omega-amino acid--pyruvate aminotransferase        129   2e-31   
ref|WP_007564734.1|  aminotransferase                                   129   2e-31   
ref|WP_029060118.1|  aminotransferase                                   129   2e-31   
ref|WP_027478674.1|  aminotransferase                                   129   3e-31   
gb|AJG22960.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    129   3e-31   
ref|WP_043358048.1|  aminotransferase                                   129   3e-31   
ref|WP_034843846.1|  aminotransferase                                   128   3e-31   
ref|WP_042671767.1|  aminotransferase                                   129   3e-31   
ref|WP_040998245.1|  aminotransferase                                   128   3e-31   
emb|CDX33772.1|  Gamma aminobutyrate transaminase 1, mitochondrial      128   3e-31   
ref|WP_007828597.1|  aminotransferase                                   128   3e-31   
ref|WP_010687211.1|  class-III aminotransferase                         128   4e-31   
ref|WP_019573261.1|  aminotransferase                                   128   4e-31   
dbj|BAQ49040.1|  aminotransferase                                       128   4e-31   
ref|WP_008884557.1|  aminotransferase                                   128   4e-31   
ref|WP_006133114.1|  aminotransferase                                   128   4e-31   
ref|WP_027280237.1|  aminotransferase                                   128   5e-31   
ref|WP_043335026.1|  aminotransferase                                   128   5e-31   
ref|WP_043363568.1|  aminotransferase                                   128   5e-31   
ref|WP_028137934.1|  aminotransferase                                   128   5e-31   
ref|WP_027036295.1|  aminotransferase                                   127   6e-31   
ref|WP_013533162.1|  aminotransferase                                   127   6e-31   
ref|WP_020093654.1|  aminotransferase                                   127   6e-31   
ref|WP_035809638.1|  aminotransferase                                   127   6e-31   
ref|WP_023808986.1|  aminotransferase                                   127   6e-31   
ref|WP_027163995.1|  aminotransferase                                   127   6e-31   
ref|WP_024502400.1|  aminotransferase                                   127   6e-31   
gb|ABP72164.1|  aminotransferase                                        127   6e-31   
ref|WP_038972945.1|  aminotransferase                                   127   7e-31   
ref|WP_036254762.1|  MULTISPECIES: aminotransferase                     127   7e-31   



>ref|XP_009804950.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Nicotiana sylvestris]
Length=516

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 165/194 (85%), Gaps = 3/194 (2%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGS-HVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--ST  236
            +AMI+RLL  T+K A    GS H KH+PAVS     I+R  +  R++S Q S+QND  ST
Sbjct  1    MAMISRLLRSTVKAAITAQGSFHAKHIPAVSSLQEHIVRNSTQARYNSTQASLQNDIPST  60

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            D +GF GHDMLAPFTAGWQ+TD+ PL+IEKSEGSYVYDI G+KYLD+LAGLWCTALGGNE
Sbjct  61   DNRGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSYVYDIKGRKYLDTLAGLWCTALGGNE  120

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTANKMAKAFFTNSGSEANDT 
Sbjct  121  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTANKMAKAFFTNSGSEANDTQ  180

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  181  VKLVWYYNNALGRP  194



>ref|XP_009592076.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=516

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 165/194 (85%), Gaps = 3/194 (2%)
 Frame = +3

Query  66   VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--ST  236
            +AMI+RLL  T+K A T Q G H KH+PAVS     I+R  +  R++S + S+QND  +T
Sbjct  1    MAMISRLLRSTIKAAITAQGGFHTKHIPAVSSLQEHIVRNSTQARYNSTEASLQNDIPAT  60

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            D +GF GHDMLAPFTAGWQ+TD+ PL+IEKSEGSYVYDI G+KYLD+LAGLWCTALGGNE
Sbjct  61   DNRGFRGHDMLAPFTAGWQSTDVDPLIIEKSEGSYVYDIKGRKYLDTLAGLWCTALGGNE  120

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FT NKMAKAFFTNSGSEANDT 
Sbjct  121  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTTNKMAKAFFTNSGSEANDTQ  180

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  181  VKLVWYYNNALGRP  194



>ref|XP_010313637.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=516

 Score =   298 bits (764),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 161/193 (83%), Gaps = 2/193 (1%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STD  239
            +A I  L+G  +  ATNQVG HVKH+PAV      I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
             +G+ GHDMLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEP
Sbjct  61   VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP  120

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLN LPFYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDT V
Sbjct  121  RLVAAATKQLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  600  KLVWYYNNALGRP  638
            KLVWYYNNALGRP
Sbjct  181  KLVWYYNNALGRP  193



>ref|XP_009789181.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Nicotiana sylvestris]
Length=516

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STD  239
            +A I  L+G  +  ATNQVGS VKH+P VS     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSRVKHIPVVSNLQKQIVCDPKQIRWSSTETSLKNDISSAD  60

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
             +G+ GHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  61   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  120

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLN LPFYHSFWNRTTKPSLDLA ELLD FTANKMAKAFFTNSGSEANDT V
Sbjct  121  RLVAAATKQLNQLPFYHSFWNRTTKPSLDLATELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  600  KLVWYYNNALGRP  638
            KLVWYYNNALGRP
Sbjct  181  KLVWYYNNALGRP  193



>ref|XP_006351982.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Solanum tuberosum]
Length=516

 Score =   295 bits (755),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 162/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STD  239
            +A I  L+G+ +  ATNQVG H+KH+ AVS     I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITNLIGYGIVAATNQVGPHIKHISAVSNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
             +G+ GHDMLAPFTAGW TTDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGG+EP
Sbjct  61   VRGYKGHDMLAPFTAGWHTTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGSEP  120

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLN LPFYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDT V
Sbjct  121  RLVAAATKQLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  600  KLVWYYNNALGRP  638
            KLVWYYNNALGRP
Sbjct  181  KLVWYYNNALGRP  193



>ref|NP_001233777.1| gamma aminobutyrate transaminase 3, chloroplastic [Solanum lycopersicum]
 sp|Q84P52.1|GATP3_SOLLC RecName: Full=Gamma aminobutyrate transaminase 3, chloroplastic; 
AltName: Full=Gamma-aminobutyrate transaminase isozyme 3; 
Short=LeGABA-TP3; Short=SlGABA-T3; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAO92257.1| gamma-aminobutyrate transaminase subunit precursor isozyme 3 
[Solanum lycopersicum]
 dbj|BAG16484.1| gamma aminobutyrate transaminase isoform3 [Solanum lycopersicum]
Length=520

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 160/193 (83%), Gaps = 2/193 (1%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STD  239
            +A I  L+G  +  ATNQVG HVKH+PAV      I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
             +G+ GHDMLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEP
Sbjct  61   VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP  120

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLN L FYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDT V
Sbjct  121  RLVAAATKQLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  600  KLVWYYNNALGRP  638
            KLVWYYNNALGRP
Sbjct  181  KLVWYYNNALGRP  193



>ref|XP_006357874.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Solanum tuberosum]
Length=515

 Score =   293 bits (750),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 162/194 (84%), Gaps = 4/194 (2%)
 Frame = +3

Query  66   VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--ST  236
            +A I+RL+G T+K A T Q G H K +PAVS     I++   P R+SS Q  ++ND   T
Sbjct  1    MAKISRLIGSTVKAAITAQAGFHAKRIPAVSSLQEHIVKST-PARYSSTQACLENDISGT  59

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            D KGF GHDMLAPFTAGWQ+TD+ PL+IEKSEGS+VYD+ G+KYLD+LAGLWCTALGGNE
Sbjct  60   DNKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYLDTLAGLWCTALGGNE  119

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAFFTNSGSEANDT 
Sbjct  120  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAFFTNSGSEANDTQ  179

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  180  VKLVWYYNNALGRP  193



>gb|AGX01485.1| mitochondrial gamma aminobutyrate transaminase 1 [Nicotiana tabacum]
Length=512

 Score =   290 bits (742),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STD  239
            +A I  L+G  +  ATNQVGSH+    A+S     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSHIS---AISNLQKQIVCDPIQVRWSSTETSLKNDISSAD  57

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
             +G+ GHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  58   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  117

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLN LPFYHSFWNRTTKPSLDLAKELLD FTANKMAKAFFTNSGSEANDT V
Sbjct  118  RLVAAATKQLNELPFYHSFWNRTTKPSLDLAKELLDMFTANKMAKAFFTNSGSEANDTQV  177

Query  600  KLVWYYNNALGRP  638
            KLVWYYNNALGRP
Sbjct  178  KLVWYYNNALGRP  190



>ref|NP_001234336.1| gamma aminobutyrate transaminase 1, mitochondrial [Solanum lycopersicum]
 sp|Q84P54.1|GATP1_SOLLC RecName: Full=Gamma aminobutyrate transaminase 1, mitochondrial; 
AltName: Full=Gamma-aminobutyrate transaminase isozyme 1; 
Short=LeGABA-TP1; Short=SlGABA-T1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAO92255.1| gamma-aminobutyrate transaminase subunit precursor isozyme 1 
[Solanum lycopersicum]
 dbj|BAG16482.1| gamma aminobutyrate transaminase isoform1 [Solanum lycopersicum]
Length=515

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 161/194 (83%), Gaps = 4/194 (2%)
 Frame = +3

Query  66   VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--ST  236
            +A I+RL G T+K A T Q G H K +PAVS     I++   P R++S Q  ++ND   T
Sbjct  1    MAKISRLFGSTVKAAITAQAGFHGKRIPAVSSLQEHIVKST-PARYNSTQACLENDISGT  59

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            D KGF GHDMLAPFTAGWQ+TD+ PL+IEKSEGS+VYD+ G+KY+D+LAGLWCTALGGNE
Sbjct  60   DNKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYIDTLAGLWCTALGGNE  119

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAFFTNSGSEANDT 
Sbjct  120  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAFFTNSGSEANDTQ  179

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  180  VKLVWYYNNALGRP  193



>ref|XP_009610291.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=513

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 158/193 (82%), Gaps = 5/193 (3%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STD  239
            +A I  L+G  +  ATNQVGSH+    AVS     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSHIS---AVSNLQKQIVCDPIQVRWSSTETSLKNDISSAD  57

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
             +G+ GHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  58   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  117

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLN LPFYHSFWNRTTKPSLDLAKELLD FT+NKMAKAFFTNSGSEANDT V
Sbjct  118  RLVAAATKQLNELPFYHSFWNRTTKPSLDLAKELLDLFTSNKMAKAFFTNSGSEANDTQV  177

Query  600  KLVWYYNNALGRP  638
            KLVWYYNNALGRP
Sbjct  178  KLVWYYNNALGRP  190



>ref|XP_009610292.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=510

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 152/186 (82%), Gaps = 5/186 (3%)
 Frame = +3

Query  87   LGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STDEKGFXGH  260
            L +  +   NQVGSH+    AVS     I+      RWSS + S++ND  S D +G+ GH
Sbjct  5    LDNVAQLTVNQVGSHIS---AVSNLQKQIVCDPIQVRWSSTETSLKNDISSADIRGYKGH  61

Query  261  DMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAM  440
            DMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRLV AA 
Sbjct  62   DMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAAT  121

Query  441  KQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYN  620
            KQLN LPFYHSFWNRTTKPSLDLAKELLD FT+NKMAKAFFTNSGSEANDT VKLVWYYN
Sbjct  122  KQLNELPFYHSFWNRTTKPSLDLAKELLDLFTSNKMAKAFFTNSGSEANDTQVKLVWYYN  181

Query  621  NALGRP  638
            NALGRP
Sbjct  182  NALGRP  187



>ref|XP_011100393.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Sesamum indicum]
Length=512

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STDEK  245
            M++RLL  TL+ A+ Q G +VK + A       +++     +    + S+Q D  STD+K
Sbjct  1    MMHRLLQLTLRNAS-QAGHYVKDISAGKNLQKHLVQASVRAKSYGTEASLQKDVSSTDDK  59

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G+ GHDMLAPFTAGWQTTDL+PLVIEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRL
Sbjct  60   GYKGHDMLAPFTAGWQTTDLNPLVIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRL  119

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA KQLNTLPFYHSFWNRTTKPSLDLAKEL + FTANKMAK FFTNSGSEAND+ VKL
Sbjct  120  VAAATKQLNTLPFYHSFWNRTTKPSLDLAKELSEMFTANKMAKVFFTNSGSEANDSQVKL  179

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  180  VWYYNNALGRP  190



>gb|KDP30431.1| hypothetical protein JCGZ_16670 [Jatropha curcas]
Length=517

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 156/194 (80%), Gaps = 8/194 (4%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND-----ST  236
            +IN++L  TLK   NQ+GSH KH+ A   S   +       +    + S+Q D     S 
Sbjct  2    VINKILRSTLK---NQLGSHSKHVAASGSSQKHLASAPCLAKLYGTEASLQKDDSTTDSR  58

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            D +G+ GHDMLAPFTAGWQ+TDLHPLVI+KSEGSYVYDINGKKYLDSLAGLWCTALGG+E
Sbjct  59   DGRGYKGHDMLAPFTAGWQSTDLHPLVIDKSEGSYVYDINGKKYLDSLAGLWCTALGGSE  118

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKELL+TFT++KMAKAFFTNSGSEANDT 
Sbjct  119  PRLVAAATEQLHKLPFYHSFWNRTTKPSLDLAKELLETFTSSKMAKAFFTNSGSEANDTQ  178

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  179  VKLVWYYNNALGRP  192



>gb|EYU42835.1| hypothetical protein MIMGU_mgv1a004733mg [Erythranthe guttata]
Length=512

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 156/190 (82%), Gaps = 3/190 (2%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STDEKG  248
            ++RLL  TL+ A+ Q G  VK + A      ++I+     +  S +  +Q D  +TD+KG
Sbjct  1    MHRLLRLTLRNAS-QAGYCVKEISAGKNLPINVIQPPLLAKSYSTEAYLQKDPPTTDDKG  59

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGG+EPRLV
Sbjct  60   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTNGKKYLDSLAGLWCTALGGSEPRLV  119

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            DAA+KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK FFTNSGSEAND+ VKLV
Sbjct  120  DAAIKQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTATKMAKVFFTNSGSEANDSQVKLV  179

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  180  WYYNNALGRP  189



>gb|AGF95098.1| 4-aminobutyrate aminotransferase [Prunus persica]
Length=220

 Score =   265 bits (678),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 150/192 (78%), Gaps = 7/192 (4%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDS--TDEK-  245
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYVAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  246  -GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  422
             GF GH+MLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHEMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  423  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVK  602
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDT VK
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAFFTNSGSEANDTQVK  179

Query  603  LVWYYNNALGRP  638
            LVWYYNNALGRP
Sbjct  180  LVWYYNNALGRP  191



>ref|XP_010941664.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Elaeis guineensis]
Length=508

 Score =   275 bits (702),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 153/188 (81%), Gaps = 3/188 (2%)
 Frame = +3

Query  84   LLGHTLKR--ATNQVGSHVKHLP-AVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFX  254
            ++G +L R  A+++VG  ++H+  A      +     S  R  S++ S+Q D TDE+GF 
Sbjct  1    MIGKSLLRSKASSKVGMLIRHIATAEGLQSHAPPYIASVARLMSSEASLQTDPTDERGFK  60

Query  255  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  434
            GHDMLAPFTAGWQ+TDLHPLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGG+EPRLV+A
Sbjct  61   GHDMLAPFTAGWQSTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGSEPRLVEA  120

Query  435  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            A  QL  LPFYHSFWNRTTKPSLDLAKELL+TFTA KM K FFTNSGSEAND+ VKLVWY
Sbjct  121  ATAQLKKLPFYHSFWNRTTKPSLDLAKELLETFTARKMGKVFFTNSGSEANDSQVKLVWY  180

Query  615  YNNALGRP  638
            YNNALGRP
Sbjct  181  YNNALGRP  188



>ref|XP_008652021.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Zea mays]
 gb|KJB42908.1| hypothetical protein B456_007G173800 [Gossypium raimondii]
Length=515

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 151/190 (79%), Gaps = 6/190 (3%)
 Frame = +3

Query  78   NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEK---G  248
            N LL  TLK    Q+GS++K+  A   S    ++     R  S + S+Q D +D K   G
Sbjct  4    NSLLRSTLK---TQLGSYIKNAAAYRSSMDHPLKGALLARLYSTEPSLQRDDSDLKDGNG  60

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGGNEPRLV
Sbjct  61   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDANGKKYLDSLAGLWCTALGGNEPRLV  120

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA  QLN LPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAK FFTNSGSEANDT VKLV
Sbjct  121  EAATAQLNKLPFYHSFWNRTTKPSLDLAKDLLETFTATKMAKVFFTNSGSEANDTQVKLV  180

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  181  WYYNNALGRP  190



>ref|XP_006429770.1| hypothetical protein CICLE_v10011509mg [Citrus clementina]
 ref|XP_006481368.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Citrus sinensis]
 gb|ESR43010.1| hypothetical protein CICLE_v10011509mg [Citrus clementina]
Length=514

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = +3

Query  63   AVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDE  242
            A  + ++LL  +LK   +Q+GS  KH  A      ++ +     R+     S+Q + +  
Sbjct  4    AKMVTSKLLQSSLK---SQIGSFTKHFSASKSLSENLYQIPLLARFYGTDASLQKEDSTT  60

Query  243  KGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  422
             GF GHDMLAPFTAGWQ+TD+HPLVIEKSEGSYVYDINGKKYLDSL+GLWCTALGG+EPR
Sbjct  61   NGFKGHDMLAPFTAGWQSTDVHPLVIEKSEGSYVYDINGKKYLDSLSGLWCTALGGSEPR  120

Query  423  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVK  602
            LV AA  QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA+KMAK FFTNSGSEANDT VK
Sbjct  121  LVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVK  180

Query  603  LVWYYNNALGRP  638
            LVWYYNNALGRP
Sbjct  181  LVWYYNNALGRP  192



>gb|KDO64363.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
Length=514

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = +3

Query  63   AVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDE  242
            A  + ++LL  +LK   +Q+GS  KH  A      ++ +     R+     S Q + +  
Sbjct  4    AKMVTSKLLQSSLK---SQIGSFTKHFSASKSLSENLYQIPLLARFYGTDASSQKEDSTT  60

Query  243  KGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  422
             GF GHDMLAPFTAGWQ+TD+HPLVIEKSEGSYVYD+NGKKYLDSLAGLWCTALGG+EPR
Sbjct  61   NGFKGHDMLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPR  120

Query  423  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVK  602
            LV AA  QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA+KMAK FFTNSGSEANDT VK
Sbjct  121  LVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVK  180

Query  603  LVWYYNNALGRP  638
            LVWYYNNALGRP
Sbjct  181  LVWYYNNALGRP  192



>ref|XP_010036076.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW47596.1| hypothetical protein EUGRSUZ_K01341 [Eucalyptus grandis]
Length=509

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  201  SSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSL  380
            +S Q     +S D  GF GHDMLAPFTAGWQTTDLHPLVIE+SEGSYVYDINGKKYLDSL
Sbjct  41   ASLQKEESTESKDGLGFKGHDMLAPFTAGWQTTDLHPLVIERSEGSYVYDINGKKYLDSL  100

Query  381  AGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAF  560
            AGLWCTALGGNEPRLV+AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  101  AGLWCTALGGNEPRLVNAAVAQLNTLPFYHSFWNRTTKPSLDLAKELLETFTARKMAKAF  160

Query  561  FTNSGSEANDTXVKLVWYYNNALGRP  638
            FTNSGSEANDT VKLVWYYNNALGRP
Sbjct  161  FTNSGSEANDTQVKLVWYYNNALGRP  186



>gb|KHG00607.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Gossypium 
arboreum]
Length=392

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 150/190 (79%), Gaps = 6/190 (3%)
 Frame = +3

Query  78   NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEK---G  248
            N LL  TLK    Q+GS++K+  A   S    ++     R  S + S+Q D +D K   G
Sbjct  4    NSLLRSTLK---TQLGSYIKNAAAYRSSMDHPLKGALLARLYSTEPSLQRDDSDLKDGNG  60

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD +GKKYLDSLAGLWCTALGG+EPRLV
Sbjct  61   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTHGKKYLDSLAGLWCTALGGSEPRLV  120

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA  QLN LPFYHSFWNRTTK SLDLAK+LL+TFTA KMAK FFTNSGSEANDT VKLV
Sbjct  121  EAATAQLNKLPFYHSFWNRTTKLSLDLAKDLLETFTATKMAKVFFTNSGSEANDTQVKLV  180

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  181  WYYNNALGRP  190



>ref|XP_008229658.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Prunus mume]
Length=514

 Score =   268 bits (684),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 150/192 (78%), Gaps = 7/192 (4%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDS--TDEK-  245
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYIAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  246  -GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  422
             GF GHDMLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHDMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  423  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVK  602
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDT VK
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAFFTNSGSEANDTQVK  179

Query  603  LVWYYNNALGRP  638
            LVWYYNNALGRP
Sbjct  180  LVWYYNNALGRP  191



>ref|XP_009399251.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=505

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            +R  S+   +Q++ST+E+GF GHDMLAPFTAGWQTTDLHPLVI+KSEGSYVYDINGKKYL
Sbjct  33   SRLMSSTAPLQSESTEERGFKGHDMLAPFTAGWQTTDLHPLVIDKSEGSYVYDINGKKYL  92

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            D+LAGLWCTALGGNEPRL+ AA  QLN LPFYHSFWNRTTKPSLDLAKE+L+ FTA KM 
Sbjct  93   DALAGLWCTALGGNEPRLIAAATAQLNKLPFYHSFWNRTTKPSLDLAKEILEIFTARKMG  152

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  153  KVFFTNSGSEANDSQVKLVWYYNNALGRP  181



>ref|XP_008798241.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial, 
partial [Phoenix dactylifera]
Length=506

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = +3

Query  105  RATNQVGSHVKHLP-AVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXGHDMLAPFT  281
            +A+++VG  ++H+  A            S  R   +Q S+  D TDEKGF GHDMLAPFT
Sbjct  10   KASSKVGMLIRHVATAERFQSHGPPYIASFARLMCSQASLLTDPTDEKGFKGHDMLAPFT  69

Query  282  AGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLP  461
            AGWQ+TDLHPLVIEKSEGSYVYD NGKKYLD+LAGLWCTALGG+EPRLV+AA  QL  LP
Sbjct  70   AGWQSTDLHPLVIEKSEGSYVYDNNGKKYLDTLAGLWCTALGGSEPRLVEAATAQLKKLP  129

Query  462  FYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            FYHSFWNRTTKPSLDLAKELL+TFTA KM K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  130  FYHSFWNRTTKPSLDLAKELLETFTARKMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  188



>ref|XP_007215238.1| hypothetical protein PRUPE_ppa004369mg [Prunus persica]
 gb|EMJ16437.1| hypothetical protein PRUPE_ppa004369mg [Prunus persica]
Length=514

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 150/192 (78%), Gaps = 7/192 (4%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDS--TDEK-  245
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYVAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  246  -GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  422
             GF GH+MLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHEMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  423  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVK  602
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDT VK
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAFFTNSGSEANDTQVK  179

Query  603  LVWYYNNALGRP  638
            LVWYYNNALGRP
Sbjct  180  LVWYYNNALGRP  191



>ref|XP_011100394.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Sesamum indicum]
Length=501

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 134/145 (92%), Gaps = 2/145 (1%)
 Frame = +3

Query  210  QVSVQND--STDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLA  383
            + S+Q D  STD+KG+ GHDMLAPFTAGWQTTDL+PLVIEKSEGSYVYD+NGKKYLD+LA
Sbjct  35   EASLQKDVSSTDDKGYKGHDMLAPFTAGWQTTDLNPLVIEKSEGSYVYDVNGKKYLDALA  94

Query  384  GLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFF  563
            GLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKEL + FTANKMAK FF
Sbjct  95   GLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELSEMFTANKMAKVFF  154

Query  564  TNSGSEANDTXVKLVWYYNNALGRP  638
            TNSGSEAND+ VKLVWYYNNALGRP
Sbjct  155  TNSGSEANDSQVKLVWYYNNALGRP  179



>ref|XP_007049029.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
 gb|EOX93186.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
Length=525

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 146/190 (77%), Gaps = 6/190 (3%)
 Frame = +3

Query  78   NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEK---G  248
            N  L  TLK    Q+GS++K+  A         +     R  S + S+Q + +D K   G
Sbjct  14   NSFLRSTLKL---QLGSYIKNAAAYRSFMDQSPKGPVLARLYSTEPSLQKEDSDLKDGNG  70

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD+NG+KYLD+LAGLWCTALGGNE RLV
Sbjct  71   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDVNGRKYLDTLAGLWCTALGGNEARLV  130

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
             AA  QLN LPFYHSFWNRTTKPSLDLAKELL TFTA KMAK FFTNSGSEANDT VKLV
Sbjct  131  AAATDQLNKLPFYHSFWNRTTKPSLDLAKELLGTFTARKMAKVFFTNSGSEANDTQVKLV  190

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  191  WYYNNALGRP  200



>ref|XP_002307913.1| POLLEN-PISTIL INTERACTION 2 family protein [Populus trichocarpa]
 gb|EEE91436.1| POLLEN-PISTIL INTERACTION 2 family protein [Populus trichocarpa]
Length=514

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 155/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQ-NDST-DEK  245
            +I++LL  TLK   +Q+ S +K+  A   S    +R     R  S + S+Q  DST D  
Sbjct  2    VISKLLRSTLK---SQLRSCIKNGTASGSSQEHHLRAPFLARLYSTKASLQKEDSTIDGN  58

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
             F GHDMLAPFTAGWQ++DL+PLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRL  118

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDT VKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  179  VWYYNNALGRP  189



>ref|XP_009347869.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Pyrus x bretschneideri]
Length=514

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +3

Query  222  QNDSTDEK---GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLW  392
            + +ST E+   GF GHDMLAPFTAGWQ+TDLHPL+IEKSEGSYVYD NGKKYLD+LAGLW
Sbjct  50   REESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGSYVYDSNGKKYLDALAGLW  109

Query  393  CTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNS  572
            CTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNS
Sbjct  110  CTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNS  169

Query  573  GSEANDTXVKLVWYYNNALGRP  638
            GSEANDT VKLVWYYNNALGRP
Sbjct  170  GSEANDTQVKLVWYYNNALGRP  191



>ref|XP_009349581.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=514

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 135/152 (89%), Gaps = 4/152 (3%)
 Frame = +3

Query  195  RWSSAQVSVQND--STDEKG--FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  362
            R  S   SVQ +  +TDEKG  F GHDMLAPFTAGWQ+TD+HPL+IEKSEGSY YD NGK
Sbjct  40   RSYSTGSSVQKEEPTTDEKGLGFKGHDMLAPFTAGWQSTDVHPLIIEKSEGSYAYDSNGK  99

Query  363  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  542
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  100  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  159

Query  543  KMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KMAKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  160  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP  191



>ref|XP_009349580.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=521

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 135/152 (89%), Gaps = 4/152 (3%)
 Frame = +3

Query  195  RWSSAQVSVQND--STDEKG--FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  362
            R  S   SVQ +  +TDEKG  F GHDMLAPFTAGWQ+TD+HPL+IEKSEGSY YD NGK
Sbjct  47   RSYSTGSSVQKEEPTTDEKGLGFKGHDMLAPFTAGWQSTDVHPLIIEKSEGSYAYDSNGK  106

Query  363  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  542
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  107  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  166

Query  543  KMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KMAKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  167  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP  198



>ref|XP_002322549.2| hypothetical protein POPTR_0016s02000g [Populus trichocarpa]
 gb|EEF04310.2| hypothetical protein POPTR_0016s02000g [Populus trichocarpa]
Length=514

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKG-  248
            +I++LL  TLK    Q+GS +K+  A   S   ++R     R    + S+Q + +  +G 
Sbjct  2    VISKLLRSTLKA---QLGSCIKNGTASGSSQEHLLRGPFLARLYGTEASLQKEDSTTEGN  58

Query  249  -FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
             F GHDMLAPFTAGWQ+ DL PLVIEKSEGSYVYDINGKKYLD+LAGLWCT+LGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSNDLDPLVIEKSEGSYVYDINGKKYLDALAGLWCTSLGGNEPRL  118

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDT VKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  179  VWYYNNALGRP  189



>ref|XP_006858237.1| hypothetical protein AMTR_s00062p00194620 [Amborella trichopoda]
 gb|ERN19704.1| hypothetical protein AMTR_s00062p00194620 [Amborella trichopoda]
Length=510

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 3/180 (2%)
 Frame = +3

Query  105  RATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STDEKGFXGHDMLAPF  278
            R+  Q+G  +KH+ A            +   +SS + S+Q+D   +++KGF GHDMLAPF
Sbjct  10   RSNLQLGKFIKHVAAARNLKVPPHHCPTFASYSS-EASLQSDVPESNDKGFKGHDMLAPF  68

Query  279  TAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTL  458
            TAGWQ+TDLHPLVI++SEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+AA +QLN L
Sbjct  69   TAGWQSTDLHPLVIDRSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEAATRQLNKL  128

Query  459  PFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            PFYHSFWNRTTKPSLDLA ELL+ FTA KM K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  129  PFYHSFWNRTTKPSLDLATELLEMFTARKMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  188



>ref|XP_008365554.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Malus domestica]
Length=514

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 3/150 (2%)
 Frame = +3

Query  198  WSSAQVSVQNDSTDEK---GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            +S+     + +ST E+   GF GHDMLAPFTAGWQ+TDLHPL+IEKSEG YVYD NGKKY
Sbjct  42   YSTGSPLRREESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGCYVYDSNGKKY  101

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            LD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA+KM
Sbjct  102  LDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKM  161

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            AKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  162  AKAFFTNSGSEANDTQVKLVWYYNNALGRP  191



>gb|AFS28620.1| gamma-aminobutyrate transaminase 1 [Malus domestica]
Length=514

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 3/150 (2%)
 Frame = +3

Query  198  WSSAQVSVQNDSTDEK---GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            +S+     + +ST E+   GF GHDMLAPFTAGWQ+TDLHPL+IEKSEG YVYD NGKKY
Sbjct  42   YSTGSPLRREESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGCYVYDSNGKKY  101

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            LD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA+KM
Sbjct  102  LDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKM  161

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            AKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  162  AKAFFTNSGSEANDTQVKLVWYYNNALGRP  191



>sp|B8BBZ7.1|GATP3_ORYSI RecName: Full=Probable gamma-aminobutyrate transaminase 3, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|EEC83087.1| hypothetical protein OsI_28220 [Oryza sativa Indica Group]
Length=510

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGF  251
            MI R L      A ++  S VKH+ A             P R+ S++ S+Q DST+E GF
Sbjct  1    MICRSLLLLRSNAASKASSIVKHVAATGCLPEYSSEA--PARYFSSESSLQVDSTEENGF  58

Query  252  XGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  431
             GH MLAPFTAGWQ+TDLHPLVI++SEGSYVYDINGKKY+D+LAGLW TALGGNEPRL+ 
Sbjct  59   KGHGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIK  118

Query  432  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVW  611
            AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+ VKLVW
Sbjct  119  AATDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIFFTNSGSEANDSQVKLVW  178

Query  612  YYNNALGRP  638
            YYNNALGRP
Sbjct  179  YYNNALGRP  187



>ref|XP_011001061.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Populus euphratica]
Length=514

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 153/191 (80%), Gaps = 5/191 (3%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKG-  248
            +I++LL  TLK    Q+ S +K+  A   S   ++R     R+   + S+Q + +  +G 
Sbjct  2    VISKLLRSTLKA---QLSSCIKNGTASGSSQEHLLRAPFLARFYGTKASLQKEDSTTEGN  58

Query  249  -FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
             F GHDMLAPFTAGWQ+ DL PLVIEKSEGSYVYDINGKKYLD+LAGLWCT+LGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSNDLDPLVIEKSEGSYVYDINGKKYLDALAGLWCTSLGGNEPRL  118

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDT VKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  179  VWYYNNALGRP  189



>ref|XP_002445207.1| hypothetical protein SORBIDRAFT_07g005930 [Sorghum bicolor]
 gb|EES14702.1| hypothetical protein SORBIDRAFT_07g005930 [Sorghum bicolor]
Length=509

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (79%), Gaps = 5/188 (3%)
 Frame = +3

Query  84   LLGHTLKR---ATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFX  254
            ++   L+R   A++QV   VK++ +     G      SP R  S++ S+Q  +T+E GF 
Sbjct  1    MIAQGLRRSSAASSQVSRLVKYIASAGRLQGGHSFSESPARCYSSEPSLQ--ATEENGFK  58

Query  255  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  434
            GH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY+D+LAGLWCTALGGNEPRLV A
Sbjct  59   GHSMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKYIDALAGLWCTALGGNEPRLVKA  118

Query  435  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            A +QL+ LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+ VKLVWY
Sbjct  119  ATEQLHKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKVFFTNSGSEANDSQVKLVWY  178

Query  615  YNNALGRP  638
            YNNALGRP
Sbjct  179  YNNALGRP  186



>ref|NP_001061237.1| Os08g0205900 [Oryza sativa Japonica Group]
 sp|Q6ZCF0.1|GATP3_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 3, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05337.1| putative gamma-aminobutyrate transaminase subunit precursor isozyme 
3 [Oryza sativa Japonica Group]
 dbj|BAD11549.1| putative gamma-aminobutyrate transaminase subunit precursor isozyme 
3 [Oryza sativa Japonica Group]
 dbj|BAF23151.1| Os08g0205900 [Oryza sativa Japonica Group]
 gb|EEE68226.1| hypothetical protein OsJ_26408 [Oryza sativa Japonica Group]
Length=510

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 144/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGF  251
            MI R L      A ++  + VKH+ A             P R+ S++ S+Q DST+E GF
Sbjct  1    MICRSLLLLRSNAASKASNIVKHVAATGCLPKYSSEA--PARYFSSEPSLQVDSTEENGF  58

Query  252  XGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  431
             GH MLAPFTAGWQ+TDLHPLVI++SEGSYVYDINGKKY+D+LAGLW TALGGNEPRL+ 
Sbjct  59   KGHGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIK  118

Query  432  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVW  611
            AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+ VKLVW
Sbjct  119  AATDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIFFTNSGSEANDSQVKLVW  178

Query  612  YYNNALGRP  638
            YYNNALGRP
Sbjct  179  YYNNALGRP  187



>ref|XP_010260596.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Nelumbo nucifera]
Length=517

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 131/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  195  RWSSAQVSVQNDST-----DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDING  359
            RW+S + S+Q +       D KGF GHDMLAPFTAGWQ+ DLHPLVIEKSEG YVYDING
Sbjct  40   RWNSTEASLQKEGQTPELKDGKGFKGHDMLAPFTAGWQSNDLHPLVIEKSEGCYVYDING  99

Query  360  KKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTA  539
             K+LDSLAGLWCTALGGNEPRLV AA KQL+TLPFYHSFWNRTTKPSLDLAK++L+ FTA
Sbjct  100  NKFLDSLAGLWCTALGGNEPRLVAAATKQLDTLPFYHSFWNRTTKPSLDLAKDILEIFTA  159

Query  540  NKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             KM K FFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  160  RKMGKVFFTNSGSEANDTQVKLVWYYNNALGRP  192



>emb|CDP16027.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 2/150 (1%)
 Frame = +3

Query  195  RWSSAQVSVQND--STDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            RW+S + + Q D  + D+KGF GH+MLAPFTAGWQ+TDL+PLVIE+SEGSYVYD+NGKKY
Sbjct  51   RWNSTEAAAQKDVSAIDDKGFKGHEMLAPFTAGWQSTDLNPLVIERSEGSYVYDVNGKKY  110

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            LD+LAGLW TALGGNEPRL+ AA KQLNTLPFYHSFWNRTTKPSLDLAKEL++ FT + M
Sbjct  111  LDALAGLWSTALGGNEPRLIAAAAKQLNTLPFYHSFWNRTTKPSLDLAKELIELFTPSTM  170

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            +KAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  171  SKAFFTNSGSEANDTQVKLVWYYNNALGRP  200



>ref|NP_001280788.1| gamma aminobutyrate transaminase 3, chloroplastic [Malus domestica]
 gb|AFS28621.1| gamma-aminobutyrate transaminase 2 [Malus domestica]
Length=514

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 133/152 (88%), Gaps = 4/152 (3%)
 Frame = +3

Query  195  RWSSAQVSVQND--STDEKG--FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  362
            R  S   SVQ +  +T EKG  F GHDMLAPFT GWQ+TDLHPL+IEKSEGSY YD NGK
Sbjct  40   RSYSTGSSVQKEEPTTVEKGLGFKGHDMLAPFTPGWQSTDLHPLIIEKSEGSYAYDSNGK  99

Query  363  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  542
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  100  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  159

Query  543  KMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KMAKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  160  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP  191



>ref|XP_004303943.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Fragaria vesca subsp. vesca]
Length=506

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 149/188 (79%), Gaps = 7/188 (4%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFX  254
            INRL+   L   T Q+GS +K++ A   S   +    S  R      ++Q+    E GF 
Sbjct  3    INRLVRSNL---TTQLGSCIKYVAASRSSQERLFSAPSIARVYGTSATLQS----EDGFK  55

Query  255  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  434
            GHDMLAPFT+G  ++D+HPL+IEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+A
Sbjct  56   GHDMLAPFTSGSLSSDVHPLLIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEA  115

Query  435  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            A +QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KM KAFFTNSGSEANDT VKLVWY
Sbjct  116  ATRQLNTLPFYHSFWNRTTRPSLDLAKDLLETFTATKMGKAFFTNSGSEANDTQVKLVWY  175

Query  615  YNNALGRP  638
            YNNALGRP
Sbjct  176  YNNALGRP  183



>ref|XP_008378345.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Malus domestica]
Length=521

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 133/152 (88%), Gaps = 4/152 (3%)
 Frame = +3

Query  195  RWSSAQVSVQND--STDEKG--FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  362
            R  S   SVQ +  +T EKG  F GHDMLAPFT GWQ+TDLHPL+IEKSEGSY YD NGK
Sbjct  47   RSYSTGSSVQKEEPTTVEKGLGFKGHDMLAPFTPGWQSTDLHPLIIEKSEGSYAYDSNGK  106

Query  363  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  542
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  107  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  166

Query  543  KMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KMAKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  167  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP  198



>ref|XP_011004456.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Populus euphratica]
Length=514

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 154/191 (81%), Gaps = 5/191 (3%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQ-NDST-DEK  245
            +I++LL  TLK   +Q+ S  K+  A   S   ++R     R  S + S+Q  DST D  
Sbjct  2    VISKLLRSTLK---SQLRSCTKNGTASGSSQEHLLRAPFLARLYSTKASLQKEDSTIDGN  58

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
             F GHDMLAPFTAGWQ++DL+PLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEP L
Sbjct  59   SFKGHDMLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPWL  118

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDT VKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  179  VWYYNNALGRP  189



>ref|XP_004972609.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial-like 
[Setaria italica]
Length=509

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 146/189 (77%), Gaps = 3/189 (2%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGF  251
            MI R L  +   A +Q    VK++ +     G+      P R+ S++ S++   T+E GF
Sbjct  1    MIARGLFRS-NAAASQFSRLVKYVASAGSLQGTHNFAEIPARYYSSEPSLKE--TEENGF  57

Query  252  XGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  431
             GH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY+D+LAGLWCTALGGNEPRL+ 
Sbjct  58   KGHSMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKYIDALAGLWCTALGGNEPRLIK  117

Query  432  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVW  611
            AA +QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+ VKLVW
Sbjct  118  AATEQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKVFFTNSGSEANDSQVKLVW  177

Query  612  YYNNALGRP  638
            YYNNALGRP
Sbjct  178  YYNNALGRP  186



>ref|XP_006659928.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial-like 
[Oryza brachyantha]
Length=537

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 0/150 (0%)
 Frame = +3

Query  189  PTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            P R+ S++ S+Q DST+E GF GH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY
Sbjct  65   PARYFSSEPSLQVDSTEENGFKGHGMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKY  124

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            +D+LAGLW TALGGNEPRL+ AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M
Sbjct  125  IDALAGLWSTALGGNEPRLIKAATDQLNKLPFYHSFWNRTTKPSLDLANEILMMFTAREM  184

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  185  GKVFFTNSGSEANDSQVKLVWYYNNALGRP  214



>ref|XP_002268803.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Vitis vinifera]
Length=516

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 149/194 (77%), Gaps = 6/194 (3%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTD----  239
            MI R L  +  R T  V S+  H+ A       ++R     RW+S + S+Q +  +    
Sbjct  1    MIFRNLVRSTLRNTQAV-SYKNHVAAARSLQEHLVRAPVLARWNSTEASMQREDAETELK  59

Query  240  -EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
              K F GHDMLAPFTAGWQ +D +PLVIEKS+G+YV+DINGKKYLDSLAGLWCTALGG+E
Sbjct  60   NAKEFKGHDMLAPFTAGWQASDTNPLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSE  119

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM KAFFTNSGSEANDT 
Sbjct  120  PRLVAAAIAQLNTLPFYHSFWNRTTKPSLDLAKELLNTFTATKMGKAFFTNSGSEANDTQ  179

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  180  VKLVWYYNNALGRP  193



>emb|CBI34106.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 149/194 (77%), Gaps = 6/194 (3%)
 Frame = +3

Query  72   MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTD----  239
            MI R L  +  R T  V S+  H+ A       ++R     RW+S + S+Q +  +    
Sbjct  1    MIFRNLVRSTLRNTQAV-SYKNHVAAARSLQEHLVRAPVLARWNSTEASMQREDAETELK  59

Query  240  -EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
              K F GHDMLAPFTAGWQ +D +PLVIEKS+G+YV+DINGKKYLDSLAGLWCTALGG+E
Sbjct  60   NAKEFKGHDMLAPFTAGWQASDTNPLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSE  119

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM KAFFTNSGSEANDT 
Sbjct  120  PRLVAAAIAQLNTLPFYHSFWNRTTKPSLDLAKELLNTFTATKMGKAFFTNSGSEANDTQ  179

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  180  VKLVWYYNNALGRP  193



>ref|XP_010234450.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
isoform X1 [Brachypodium distachyon]
Length=519

 Score =   257 bits (656),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +3

Query  189  PTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            P R+ S++ S+Q DST+E GF GH MLAPFTAGWQ+TD+HPLVI++SEG+Y YDINGKKY
Sbjct  47   PARYFSSEPSLQPDSTEEIGFKGHSMLAPFTAGWQSTDVHPLVIDRSEGAYAYDINGKKY  106

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            +D+LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M
Sbjct  107  IDALAGLWCTALGGNEPRLVKAATDQLNKLPFYHSFWNRTTKPSLDLANDILNMFTAREM  166

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  167  GKVFFTNSGSEANDSQVKLVWYYNNALGRP  196



>ref|XP_003573535.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
isoform X2 [Brachypodium distachyon]
Length=515

 Score =   256 bits (655),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +3

Query  189  PTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            P R+ S++ S+Q DST+E GF GH MLAPFTAGWQ+TD+HPLVI++SEG+Y YDINGKKY
Sbjct  43   PARYFSSEPSLQPDSTEEIGFKGHSMLAPFTAGWQSTDVHPLVIDRSEGAYAYDINGKKY  102

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            +D+LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M
Sbjct  103  IDALAGLWCTALGGNEPRLVKAATDQLNKLPFYHSFWNRTTKPSLDLANDILNMFTAREM  162

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  163  GKVFFTNSGSEANDSQVKLVWYYNNALGRP  192



>gb|AFW59441.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=447

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R  S+  S Q+D+T+E GF GH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRP  189



>ref|XP_002521054.1| aminobutyrate aminotransferase, putative [Ricinus communis]
 gb|EEF41338.1| aminobutyrate aminotransferase, putative [Ricinus communis]
Length=528

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 145/194 (75%), Gaps = 16/194 (8%)
 Frame = +3

Query  105  RATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDST----------------  236
            R   ++GS VKH  A   S   + +  S TR  S++  VQ +S                 
Sbjct  10   RIGFELGSCVKHANASGTSQKHLFQTASLTRLYSSEGFVQRESDNGGSSILRPATVADNF  69

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            D   + GHDMLAPFTAGWQ+TDL PLVIEKSEGSYVYDING KYLDSLAGLWCTALGGNE
Sbjct  70   DNCSYKGHDMLAPFTAGWQSTDLDPLVIEKSEGSYVYDINGNKYLDSLAGLWCTALGGNE  129

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDT 
Sbjct  130  PRLVAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTARKMAKAFFTNSGSEANDTQ  189

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  190  VKLVWYYNNALGRP  203



>ref|XP_009597725.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=155

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/130 (88%), Positives = 122/130 (94%), Gaps = 1/130 (1%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQ+ D+ PL+IEKSEGSYVYDINGKKYLD+L+GLWC  LGGNEPRLV
Sbjct  8    FGGHDMLAPFTAGWQS-DMGPLIIEKSEGSYVYDINGKKYLDTLSGLWCNPLGGNEPRLV  66

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKEL+D FTANKMAKAFFTNSGSEANDT VKLV
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELIDLFTANKMAKAFFTNSGSEANDTQVKLV  126

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  127  WYYNNALGRP  136



>dbj|BAK05511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R  S+  S Q +STDE GF GH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYDING KYL
Sbjct  40   VRHFSSASSPQTNSTDENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDINGNKYL  99

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTANKM 
Sbjct  100  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTANKMG  159

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  160  KAFFTNSGSEANDSQVKLVWYYNNALGRP  188



>ref|NP_001152508.1| aminotransferase y4uB [Zea mays]
 gb|ACG47973.1| aminotransferase y4uB [Zea mays]
Length=514

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R  S+  S Q+D+T+E GF GH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRP  189



>gb|ACF87978.1| unknown [Zea mays]
 gb|AFW59440.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=514

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R  S+  S Q+D+T+E GF GH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRP  189



>ref|NP_001053863.1| Os04g0614600 [Oryza sativa Japonica Group]
 sp|Q7XN11.2|GATP1_ORYSJ RecName: Full=Gamma-aminobutyrate transaminase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAQ14479.1|AF297651_1 putative aminotransferase [Oryza sativa]
 emb|CAE04333.2| OSJNBa0008M17.4 [Oryza sativa Japonica Group]
 dbj|BAF15777.1| Os04g0614600 [Oryza sativa Japonica Group]
 dbj|BAG95492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61676.1| hypothetical protein OsJ_16145 [Oryza sativa Japonica Group]
Length=516

 Score =   254 bits (650),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            TR  S+  S Q +ST+E GF GH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  44   TRHFSSVPSPQYNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  103

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  104  DSLAGLWCTALGGSEPRLVKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  163

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  164  KVFFTNSGSEANDSQVKLVWYYNNALGRP  192



>gb|EEC77995.1| hypothetical protein OsI_17385 [Oryza sativa Indica Group]
Length=496

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            TR  S+  S Q++ST+E GF GH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  47   TRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  106

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRL  AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  107  DSLAGLWCTALGGSEPRLAKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  166

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  167  KVFFTNSGSEANDSQVKLVWYYNNALGRP  195



>sp|Q01K11.1|GATP1_ORYSI RecName: Full=Gamma-aminobutyrate transaminase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 emb|CAH66914.1| OSIGBa0126B18.7 [Oryza sativa Indica Group]
Length=516

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            TR  S+  S Q++ST+E GF GH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  44   TRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  103

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRL  AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  104  DSLAGLWCTALGGSEPRLAKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  163

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  164  KVFFTNSGSEANDSQVKLVWYYNNALGRP  192



>ref|XP_004171018.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like, 
partial [Cucumis sativus]
Length=504

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 148/189 (78%), Gaps = 7/189 (4%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKH-LPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGF  251
            IN+LL  TL+   +Q+G+  K  + +   S    I     +R  S Q S Q +   + GF
Sbjct  3    INQLLRSTLR---SQLGTFAKTVISSGRASQEHAILAPFLSRLHSTQASAQKE---DSGF  56

Query  252  XGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  431
             GHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYLDSLAGLWCT+LGGNE RLV 
Sbjct  57   KGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYLDSLAGLWCTSLGGNESRLVA  116

Query  432  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVW  611
            AAMKQLNTLPFYHSFWNRTT+PSLDLAK+LL+ FTA KM K FF NSGSEANDT VKLVW
Sbjct  117  AAMKQLNTLPFYHSFWNRTTRPSLDLAKDLLEMFTARKMGKVFFVNSGSEANDTQVKLVW  176

Query  612  YYNNALGRP  638
            YYNNALGRP
Sbjct  177  YYNNALGRP  185



>ref|XP_004147736.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cucumis sativus]
 gb|KGN53495.1| hypothetical protein Csa_4G056830 [Cucumis sativus]
Length=507

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 148/189 (78%), Gaps = 7/189 (4%)
 Frame = +3

Query  75   INRLLGHTLKRATNQVGSHVKH-LPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGF  251
            IN+LL  TL+   +Q+G+  K  + +   S    I     +R  S Q S Q +   + GF
Sbjct  3    INQLLRSTLR---SQLGTFAKTVISSGRASQEHAILAPFLSRLHSTQASAQKE---DSGF  56

Query  252  XGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  431
             GHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYLDSLAGLWCT+LGGNE RLV 
Sbjct  57   KGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYLDSLAGLWCTSLGGNESRLVA  116

Query  432  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVW  611
            AAMKQLNTLPFYHSFWNRTT+PSLDLAK+LL+ FTA KM K FF NSGSEANDT VKLVW
Sbjct  117  AAMKQLNTLPFYHSFWNRTTRPSLDLAKDLLEMFTARKMGKVFFVNSGSEANDTQVKLVW  176

Query  612  YYNNALGRP  638
            YYNNALGRP
Sbjct  177  YYNNALGRP  185



>ref|XP_006652817.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Oryza brachyantha]
Length=513

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            +R  S+  S Q++ST+E GF GH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI GKKYL
Sbjct  41   SRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIEGKKYL  100

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKE+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLHKLPFYHSFWNRTTKPSLDLAKEMLSIFTAREMG  160

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRP  189



>ref|XP_004976801.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Setaria italica]
Length=512

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R  S+  S Q+DST+E GF GH MLAPFTAGWQ+ +LHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDSTEENGFKGHGMLAPFTAGWQSNELHPLIIERSEGSYVYDINGNKYL  100

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTT+PSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTRPSLDLAQEILSMFTAREMG  160

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRP  189



>ref|XP_006592029.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X1 [Glycine max]
Length=513

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            T  S A+ +  ND  + +GF GH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDTSSNDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  101

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFF NSGSEANDT VKLVWYYNNALGRP
Sbjct  162  KAFFVNSGSEANDTQVKLVWYYNNALGRP  190



>ref|XP_008677242.1| PREDICTED: aminotransferase y4uB isoform X1 [Zea mays]
Length=484

 Score =   251 bits (640),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = +3

Query  108  ATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAG  287
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GF GH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  288  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  467
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  468  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  186



>dbj|BAI66419.1| aminotransferase [Triticum aestivum]
Length=511

 Score =   251 bits (642),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R  S+  S Q +ST+E GF GH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYDING KYL
Sbjct  40   VRHFSSASSPQTNSTEENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDINGNKYL  99

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA+KM 
Sbjct  100  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMG  159

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  160  KAFFTNSGSEANDSHVKLVWYYNNALGRP  188



>gb|AFW61009.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=509

 Score =   251 bits (641),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = +3

Query  108  ATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAG  287
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GF GH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  288  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  467
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  468  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  186



>gb|AFW61008.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=493

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = +3

Query  108  ATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAG  287
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GF GH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  288  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  467
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  468  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  186



>emb|CDY58748.1| BnaCnng33690D [Brassica napus]
Length=498

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNEPRL
Sbjct  43   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEPRL  102

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDT VKL
Sbjct  103  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  162

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  163  VWYYNNALGRP  173



>gb|KHN05488.1| Putative aminotransferase y4uB [Glycine soja]
Length=513

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            T  S A+ +  ND  + +GF GH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDTSSNDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  101

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFF NSGS+ANDT VKLVWYYNNALGRP
Sbjct  162  KAFFVNSGSKANDTQVKLVWYYNNALGRP  190



>ref|XP_008451896.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=507

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 128/149 (86%), Gaps = 3/149 (2%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            +R  S Q S Q +   + GF GHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYL
Sbjct  40   SRLHSTQASAQKE---DSGFKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYL  96

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCT+LGGNE RLV AA  QLNTLPFYHSFWNRTT+PSLDLAKELL+ FTA KM 
Sbjct  97   DSLAGLWCTSLGGNESRLVAAATAQLNTLPFYHSFWNRTTRPSLDLAKELLEMFTARKMG  156

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FF NSGSEANDT VKLVWYYNNALGRP
Sbjct  157  KVFFVNSGSEANDTQVKLVWYYNNALGRP  185



>ref|NP_001148620.1| aminotransferase y4uB [Zea mays]
 gb|ACG32262.1| aminotransferase y4uB [Zea mays]
Length=509

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 2/177 (1%)
 Frame = +3

Query  108  ATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAG  287
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GF GH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  288  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  467
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  468  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSE+ND+ VKLVWYYNNALGRP
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSESNDSQVKLVWYYNNALGRP  186



>ref|XP_009776834.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Nicotiana sylvestris]
Length=347

 Score =   245 bits (626),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            GF GHDMLAPFTAGWQ+ D+ PL+IEKSEGSYVYDINGKKYLD+L+GLWC  LGGNEPRL
Sbjct  7    GFGGHDMLAPFTAGWQS-DMGPLIIEKSEGSYVYDINGKKYLDTLSGLWCNPLGGNEPRL  65

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V+AA KQLNTLPFYHSFWNRTTKPSLDLA+EL+D FTANKMAK FFTNSGSEANDT VKL
Sbjct  66   VEAATKQLNTLPFYHSFWNRTTKPSLDLARELIDLFTANKMAKVFFTNSGSEANDTQVKL  125

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  126  VWYYNNALGRP  136



>ref|XP_006406200.1| hypothetical protein EUTSA_v10020563mg [Eutrema salsugineum]
 gb|ESQ47653.1| hypothetical protein EUTSA_v10020563mg [Eutrema salsugineum]
Length=503

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/131 (89%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +G KYLDSLAGLWCTALGGNEPRL
Sbjct  48   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGTKYLDSLAGLWCTALGGNEPRL  107

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AAM+QLNTLPFYHSFWNRTTKPSLDLAK+LL  FTANKMAKAFFTNSGSEANDT VKL
Sbjct  108  VSAAMEQLNTLPFYHSFWNRTTKPSLDLAKDLLGMFTANKMAKAFFTNSGSEANDTQVKL  167

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  168  VWYYNNALGRP  178



>ref|XP_008451895.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=515

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 128/149 (86%), Gaps = 3/149 (2%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            +R  S Q S Q +   + GF GHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYL
Sbjct  48   SRLHSTQASAQKE---DSGFKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYL  104

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLWCT+LGGNE RLV AA  QLNTLPFYHSFWNRTT+PSLDLAKELL+ FTA KM 
Sbjct  105  DSLAGLWCTSLGGNESRLVAAATAQLNTLPFYHSFWNRTTRPSLDLAKELLEMFTARKMG  164

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            K FF NSGSEANDT VKLVWYYNNALGRP
Sbjct  165  KVFFVNSGSEANDTQVKLVWYYNNALGRP  193



>ref|XP_003580544.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial 
[Brachypodium distachyon]
Length=515

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  195  RWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  374
            R  S+  S Q++ST+E GF GH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYD NG KYLD
Sbjct  45   RHFSSAPSPQSNSTEENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDTNGNKYLD  104

Query  375  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  554
            SLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKP+LDLA +LL  FTA KM K
Sbjct  105  SLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPTLDLAGDLLSMFTARKMGK  164

Query  555  AFFTNSGSEANDTXVKLVWYYNNALGRP  638
            AFFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  165  AFFTNSGSEANDSQVKLVWYYNNALGRP  192



>ref|XP_002883348.1| gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59607.1| gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
lyrata subsp. lyrata]
Length=504

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  228  DSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALG  407
            +  +  G  GHDMLAPFTAGWQ+TDL PLVI KSEGSYVYD NGKKYLDSLAGLWCTALG
Sbjct  43   EKLNSAGSKGHDMLAPFTAGWQSTDLDPLVIAKSEGSYVYDANGKKYLDSLAGLWCTALG  102

Query  408  GNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEAN  587
            GNEPRLV AA+KQLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTANKMAKAFFT+ GS+AN
Sbjct  103  GNEPRLVSAAVKQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTANKMAKAFFTSGGSDAN  162

Query  588  DTXVKLVWYYNNALGRP  638
            DT VKLVWYYNNALGRP
Sbjct  163  DTQVKLVWYYNNALGRP  179



>ref|XP_010525162.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Tarenaya hassleriana]
Length=504

 Score =   248 bits (634),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +3

Query  201  SSAQVSVQNDSTDEK----GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  368
            SS   S   +++ EK    G+ GHDMLAPFTAGWQT DL PLVIEKSEGSYVYD +GKKY
Sbjct  32   SSTSRSFSTEASQEKKSPVGYKGHDMLAPFTAGWQTADLDPLVIEKSEGSYVYDNHGKKY  91

Query  369  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  548
            LD+LAGLWCTALGGNEPRLV AA  QL+TLPFYHSFWNRTTKPSLDLAK+LL+TFTA  M
Sbjct  92   LDALAGLWCTALGGNEPRLVAAATAQLDTLPFYHSFWNRTTKPSLDLAKDLLETFTAKNM  151

Query  549  AKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            AKAFFTNSGSEANDT VKLVWYYNNALGRP
Sbjct  152  AKAFFTNSGSEANDTQVKLVWYYNNALGRP  181



>ref|XP_010525163.1| PREDICTED: LOW QUALITY PROTEIN: gamma-aminobutyrate transaminase 
POP2, mitochondrial-like [Tarenaya hassleriana]
Length=504

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 143/194 (74%), Gaps = 16/194 (8%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATN---QVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDST  236
            +A+INRL         N   +  + VK +P               +R+ S + S +  S 
Sbjct  1    MAVINRLFRLARSSQVNFYSRNAASVKFIPGSCT-----------SRFFSTEASQEKQSP  49

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
               G+ GHDMLAPFTAGWQT DL PLVIEKSEGSYVYD +GKKYLD+LAGLWCTALGGNE
Sbjct  50   --VGYKGHDMLAPFTAGWQTADLDPLVIEKSEGSYVYDNHGKKYLDALAGLWCTALGGNE  107

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA  QL+TLPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAKAFFTNSGSEANDT 
Sbjct  108  PRLVAAATAQLDTLPFYHSFWNRTTKPSLDLAKDLLETFTAKKMAKAFFTNSGSEANDTQ  167

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNN LGRP
Sbjct  168  VKLVWYYNNXLGRP  181



>ref|XP_002447091.1| hypothetical protein SORBIDRAFT_06g028440 [Sorghum bicolor]
 gb|EES11419.1| hypothetical protein SORBIDRAFT_06g028440 [Sorghum bicolor]
Length=511

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  234  TDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGN  413
            T+E GF GH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWCTALGG+
Sbjct  54   TEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWCTALGGS  113

Query  414  EPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDT  593
            EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA KM K FFTNSGSEAND+
Sbjct  114  EPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAQEILSIFTARKMGKVFFTNSGSEANDS  173

Query  594  XVKLVWYYNNALGRP  638
             VKLVWYYNNALGRP
Sbjct  174  QVKLVWYYNNALGRP  188



>ref|XP_006406198.1| hypothetical protein EUTSA_v10020531mg [Eutrema salsugineum]
 gb|ESQ47651.1| hypothetical protein EUTSA_v10020531mg [Eutrema salsugineum]
Length=513

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G+ GH MLAPFTAGWQ+ DL PL+I KSEGSYVYDI+GKKYLDSLAGLWCTALGGNEPRL
Sbjct  51   GYKGHSMLAPFTAGWQSADLDPLIIAKSEGSYVYDIHGKKYLDSLAGLWCTALGGNEPRL  110

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA+ QLNTLPFYHSFWN TTKPSLDLAKELLD FTANKM KAFFTNSGSEANDT VKL
Sbjct  111  VSAAVSQLNTLPFYHSFWNFTTKPSLDLAKELLDMFTANKMTKAFFTNSGSEANDTQVKL  170

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  171  VWYYNNALGRP  181



>tpg|DAA59557.1| TPA: putative aminotransferase class III superfamily protein, 
partial [Zea mays]
Length=447

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/125 (92%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGGNEPRLV+AA  
Sbjct  1    MLAPFTAGWQTTDLHPLVIEKSEGSYVYDANGKKYLDSLAGLWCTALGGNEPRLVEAATA  60

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QLN LPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAK FFTNSGSEANDT VKLVWYYNN
Sbjct  61   QLNKLPFYHSFWNRTTKPSLDLAKDLLETFTATKMAKVFFTNSGSEANDTQVKLVWYYNN  120

Query  624  ALGRP  638
            ALGRP
Sbjct  121  ALGRP  125



>ref|XP_003537747.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Glycine max]
Length=513

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            T  S A+ +  ND  + +G+ GH MLAPFTAGWQ++DLHPL+IEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDNSSNDVKNGQGYKGHSMLAPFTAGWQSSDLHPLIIEKSEGSYVYDINGKKYL  101

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAVAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFF NSGSEANDT VKLVWYYNNALGRP
Sbjct  162  KAFFVNSGSEANDTQVKLVWYYNNALGRP  190



>ref|XP_010488236.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial 
[Camelina sativa]
Length=504

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ D+HPL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RL
Sbjct  49   GSKGHDMLAPFTAGWQSADVHPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRL  108

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDT VKL
Sbjct  109  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  168

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  169  VWYYNNALGRP  179



>gb|KDO64364.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
 gb|KDO64365.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
Length=447

 Score =   244 bits (624),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFTAGWQ+TD+HPLVIEKSEGSYVYD+NGKKYLDSLAGLWCTALGG+EPRLV AA  
Sbjct  1    MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA  60

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA+KMAK FFTNSGSEANDT VKLVWYYNN
Sbjct  61   QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNN  120

Query  624  ALGRP  638
            ALGRP
Sbjct  121  ALGRP  125



>gb|KHN09253.1| Putative aminotransferase y4uB [Glycine soja]
Length=536

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            T  S A+ +  ND  + +G+ GH MLAPFTAGWQ++DLHPL+IEKSEGSYVYDINGKKYL
Sbjct  58   TEASLAKDNSSNDVKNGQGYKGHSMLAPFTAGWQSSDLHPLIIEKSEGSYVYDINGKKYL  117

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  118  DALAGLWATSLGGSEPRLVDAAVAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  177

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFF NSGSEANDT VKLVWYYNNALGRP
Sbjct  178  KAFFVNSGSEANDTQVKLVWYYNNALGRP  206



>ref|XP_009145420.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial 
[Brassica rapa]
 emb|CDY10619.1| BnaA05g17430D [Brassica napus]
Length=500

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  207  AQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  386
            +++     S ++ G  GHDMLAPFTAGWQ+ DL PL+I KSEGSYVYD +GKKYLDSLAG
Sbjct  32   SRILTTEASPEKLGSKGHDMLAPFTAGWQSADLDPLIIAKSEGSYVYDDHGKKYLDSLAG  91

Query  387  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFT  566
            LWCTALGGNEPRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAFFT
Sbjct  92   LWCTALGGNEPRLVSAAVGQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTAKKMAKAFFT  151

Query  567  NSGSEANDTXVKLVWYYNNALGRP  638
            NSGSEANDT VKLVWYYNNALGRP
Sbjct  152  NSGSEANDTQVKLVWYYNNALGRP  175



>emb|CDY37389.1| BnaC05g30410D [Brassica napus]
Length=500

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  207  AQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  386
            +++     S ++ G  GHDMLAPFTAGWQ+ DL PL+I KSEGSYVYD +GKKYLDSLAG
Sbjct  32   SRIFTTEASPEKLGSKGHDMLAPFTAGWQSADLDPLIIAKSEGSYVYDDHGKKYLDSLAG  91

Query  387  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFT  566
            LWCTALGGNEPRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAFFT
Sbjct  92   LWCTALGGNEPRLVSAAVGQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTAKKMAKAFFT  151

Query  567  NSGSEANDTXVKLVWYYNNALGRP  638
            NSGSEANDT VKLVWYYNNALGRP
Sbjct  152  NSGSEANDTQVKLVWYYNNALGRP  175



>gb|KJB22727.1| hypothetical protein B456_004G063100 [Gossypium raimondii]
Length=502

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 139/187 (74%), Gaps = 13/187 (7%)
 Frame = +3

Query  78   NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXG  257
            N+ L  TLK    Q+GS++K+  A        I+ +   RW S              F G
Sbjct  4    NKYLRSTLK---TQLGSYIKNAAACKSLLEYPIKGQCEARWCSTNTC----------FKG  50

Query  258  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  437
            H+MLAPFT GWQ+T+++PLVI KSEGSYVYDIN KKYLD+LAGLWCTALGGNEPRLV AA
Sbjct  51   HNMLAPFTPGWQSTEVNPLVIVKSEGSYVYDINEKKYLDTLAGLWCTALGGNEPRLVAAA  110

Query  438  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYY  617
              QLN LPFYHSFWNRTTKPSLDLAKEL +TFTA KMAK FFTNSGSEANDT VKLVWYY
Sbjct  111  TDQLNKLPFYHSFWNRTTKPSLDLAKELTETFTATKMAKVFFTNSGSEANDTQVKLVWYY  170

Query  618  NNALGRP  638
            NNALGRP
Sbjct  171  NNALGRP  177



>ref|XP_010511056.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Camelina sativa]
Length=547

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ D+HPL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RL
Sbjct  92   GSKGHDMLAPFTAGWQSADVHPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRL  151

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDT VKL
Sbjct  152  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  211

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  212  VWYYNNALGRP  222



>ref|XP_006592030.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=480

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  231  STDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGG  410
            S  E  F GH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD+LAGLW T+LGG
Sbjct  22   SFGESMFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWATSLGG  81

Query  411  NEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEAND  590
            +EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM KAFF NSGSEAND
Sbjct  82   SEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMGKAFFVNSGSEAND  141

Query  591  TXVKLVWYYNNALGRP  638
            T VKLVWYYNNALGRP
Sbjct  142  TQVKLVWYYNNALGRP  157



>ref|XP_009109118.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Brassica rapa]
Length=501

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNE RL
Sbjct  46   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEARL  105

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LL  FTANKMAKAFFTNSGSEANDT VKL
Sbjct  106  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAFFTNSGSEANDTQVKL  165

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  166  VWYYNNALGRP  176



>emb|CDY39506.1| BnaA01g24820D [Brassica napus]
Length=506

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNE RL
Sbjct  51   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEARL  110

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LL  FTANKMAKAFFTNSGSEANDT VKL
Sbjct  111  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAFFTNSGSEANDTQVKL  170

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  171  VWYYNNALGRP  181



>ref|XP_008668890.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Zea mays]
 tpg|DAA36030.1| TPA: putative aminotransferase class III superfamily protein 
[Zea mays]
Length=510

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            +E GF GH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWCTALGG+E
Sbjct  54   EENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWCTALGGSE  113

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M K FFTNSGSEAND+ 
Sbjct  114  PRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAQEILSMFTAREMGKVFFTNSGSEANDSQ  173

Query  597  VKLVWYYNNALGRP  638
            VKLVWYYNNALGRP
Sbjct  174  VKLVWYYNNALGRP  187



>gb|ADM13673.1| putative aminotransferase [Capsicum annuum]
Length=459

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 121/130 (93%), Gaps = 1/130 (1%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQ+ D+ PLVIEKSEGSYVYDINGKKYLD+L+GLWCT LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSEGSYVYDINGKKYLDTLSGLWCTTLGGSETRLV  66

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTANKMAK FFTNSGSEANDT VKLV
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVFFTNSGSEANDTQVKLV  126

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  127  WYYNNALGRP  136



>ref|XP_007131572.1| hypothetical protein PHAVU_011G024300g [Phaseolus vulgaris]
 gb|ESW03566.1| hypothetical protein PHAVU_011G024300g [Phaseolus vulgaris]
Length=513

 Score =   244 bits (622),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
            T  S A+    N+  +  GF GH MLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYL
Sbjct  42   TEASLAKDDSANEGKNGPGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTNGKKYL  101

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            D+LAGLW TALGG+E RLVDAAM Q   LPFYHSFWNRTT PSL+LAKELL+ FTA KMA
Sbjct  102  DALAGLWATALGGSESRLVDAAMAQFKKLPFYHSFWNRTTLPSLELAKELLEMFTARKMA  161

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFF NSGSEANDT VKLVWYYNNALGRP
Sbjct  162  KAFFVNSGSEANDTQVKLVWYYNNALGRP  190



>ref|XP_006297475.1| hypothetical protein CARUB_v10013496mg [Capsella rubella]
 gb|EOA30373.1| hypothetical protein CARUB_v10013496mg [Capsella rubella]
Length=505

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ D+ PL+I KSEGSYVYD NGKKYLDSLAGLWCTALGGNE RL
Sbjct  50   GSKGHDMLAPFTAGWQSADVDPLIIAKSEGSYVYDDNGKKYLDSLAGLWCTALGGNEERL  109

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QL  LPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDT VKL
Sbjct  110  VSAAVEQLKILPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  169

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  170  VWYYNNALGRP  180



>ref|XP_004505667.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cicer arietinum]
Length=513

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  225  NDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTAL  404
            +D   ++ F GHDMLAPFTAGWQTTDL PL+I+KSEGSYVYDI GKKYLD LAGLWCTAL
Sbjct  53   DDVNPDQRFKGHDMLAPFTAGWQTTDLDPLIIDKSEGSYVYDITGKKYLDPLAGLWCTAL  112

Query  405  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEA  584
            GGNE RL+DAA  QL  LPFYHSFWNRTTKPSLDLAKELL  FTA KMAKAFF NSGSEA
Sbjct  113  GGNEQRLIDAATAQLKKLPFYHSFWNRTTKPSLDLAKELLQFFTARKMAKAFFVNSGSEA  172

Query  585  NDTXVKLVWYYNNALGRP  638
            NDT VK+VWYYNNALGRP
Sbjct  173  NDTQVKIVWYYNNALGRP  190



>ref|XP_010313638.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=448

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEPRLV AA K
Sbjct  1    MLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATK  60

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QLN LPFYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDT VKLVWYYNN
Sbjct  61   QLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  120

Query  624  ALGRP  638
            ALGRP
Sbjct  121  ALGRP  125



>gb|KFK39511.1| hypothetical protein AALP_AA3G253600 [Arabis alpina]
Length=506

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 144/191 (75%), Gaps = 10/191 (5%)
 Frame = +3

Query  66   VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEK  245
            +AMIN L    L R+T QV  H ++     G+    +     +R  + + S Q  ++   
Sbjct  1    MAMINNL--RRLARST-QVNLHSRY-----GASTKCMSGSFTSRIFTTEASPQKQNS--A  50

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DL PL+I KSEG YVYD  G+KYLDSLAGLWCTALGGNEPRL
Sbjct  51   GSKGHDMLAPFTAGWQSADLDPLIIAKSEGCYVYDDQGRKYLDSLAGLWCTALGGNEPRL  110

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFT+ GS+ANDT VKL
Sbjct  111  VSAALNQLNTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTSGGSDANDTQVKL  170

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  171  VWYYNNALGRP  181



>ref|XP_010466490.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Camelina sativa]
Length=504

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = +3

Query  255  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  434
            GHDMLAPFTAGWQ+ D+ PL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RLV A
Sbjct  52   GHDMLAPFTAGWQSADVDPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRLVSA  111

Query  435  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            A++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDT VKLVWY
Sbjct  112  AVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKLVWY  171

Query  615  YNNALGRP  638
            YNNALGRP
Sbjct  172  YNNALGRP  179



>ref|XP_004244777.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Solanum lycopersicum]
Length=458

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 1/131 (1%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            GF GH+MLAPFTAGWQ  D+ PLVIEK+EGSYVYDINGKKYLDSL+GLWCT+LGG+E RL
Sbjct  6    GFMGHNMLAPFTAGWQI-DMGPLVIEKAEGSYVYDINGKKYLDSLSGLWCTSLGGSEARL  64

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            ++AA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAK FFTNSGSEANDT VKL
Sbjct  65   IEAANKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTARKMAKVFFTNSGSEANDTQVKL  124

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  125  VWYYNNALGRP  135



>gb|AAC78480.1| putative aminotransferase [Capsicum chinense]
Length=459

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQ+ D+ PLVIEKSEGSYVYDINGKKYLD+L+GLWC  LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSEGSYVYDINGKKYLDTLSGLWCATLGGSETRLV  66

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTANKMAK FFTNSGSEANDT VK+V
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVFFTNSGSEANDTQVKMV  126

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  127  WYYNNALGRP  136



>gb|AAK52899.1|AF351125_1 gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
thaliana]
Length=504

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  49   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  108

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDT VKL
Sbjct  109  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKL  168

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  169  VWYYNNALGRP  179



>ref|NP_566700.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
 sp|Q94CE5.1|GATP_ARATH RecName: Full=Gamma-aminobutyrate transaminase POP2, mitochondrial; 
Short=AtGABA-T; AltName: Full=Protein HEXENAL RESPONSE 
1; AltName: Full=Protein POLLEN-PISTIL INCOMPATIBILITY 2; 
Short=AtPOP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59430.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AAN13140.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AEE76602.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
Length=504

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  49   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  108

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDT VKL
Sbjct  109  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKL  168

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  169  VWYYNNALGRP  179



>gb|ADG65346.1| putative aminotransferase [Capsicum frutescens]
Length=459

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/130 (86%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQ+ D+ PLVIEKS+GSYVYDINGKKYLD+L+GLWC  LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSKGSYVYDINGKKYLDTLSGLWCATLGGSETRLV  66

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTANKMAK FFTNSGSEANDT VKLV
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVFFTNSGSEANDTQVKLV  126

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  127  WYYNNALGRP  136



>dbj|BAB03068.1| aminotransferase-like protein [Arabidopsis thaliana]
Length=466

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = +3

Query  255  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  434
            GHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRLV A
Sbjct  14   GHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRLVSA  73

Query  435  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            A++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDT VKLVWY
Sbjct  74   AVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKLVWY  133

Query  615  YNNALGRP  638
            YNNALGRP
Sbjct  134  YNNALGRP  141



>ref|NP_001189947.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
 gb|AEE76603.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
Length=513

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  58   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  117

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDT VKL
Sbjct  118  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKL  177

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  178  VWYYNNALGRP  188



>ref|XP_010648197.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Vitis vinifera]
Length=514

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = +3

Query  117  QVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDST---DEKGFXGHDMLAPFTAG  287
            Q G ++ H+         +    +  + SS + S+Q + +   + KGF GHDML+PFT G
Sbjct  15   QAGFYINHVVTARILMKHLHPAPALAKCSSTETSLQKEDSATKNAKGFKGHDMLSPFTTG  74

Query  288  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  467
            WQ+T+L PL+IE+SEG YVYD NG+KYLD+LAGLWCTALGG+EPRL+ AA  QLNTLPFY
Sbjct  75   WQSTNLDPLLIERSEGPYVYDSNGRKYLDALAGLWCTALGGSEPRLIAAATAQLNTLPFY  134

Query  468  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            HSFWN  +KPSLDLAKELL+TFTA KM K FFT+SGSEANDT VKLVWYYNNALGRP
Sbjct  135  HSFWNHASKPSLDLAKELLNTFTATKMGKVFFTSSGSEANDTQVKLVWYYNNALGRP  191



>emb|CBI34103.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = +3

Query  195  RWSSAQVSVQNDST---DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  365
            + SS + S+Q + +   + KGF GHDML+PFT GWQ+T+L PL+IE+SEG YVYD NG+K
Sbjct  12   KCSSTETSLQKEDSATKNAKGFKGHDMLSPFTTGWQSTNLDPLLIERSEGPYVYDSNGRK  71

Query  366  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANK  545
            YLD+LAGLWCTALGG+EPRL+ AA  QLNTLPFYHSFWN  +KPSLDLAKELL+TFTA K
Sbjct  72   YLDALAGLWCTALGGSEPRLIAAATAQLNTLPFYHSFWNHASKPSLDLAKELLNTFTATK  131

Query  546  MAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            M K FFT+SGSEANDT VKLVWYYNNALGRP
Sbjct  132  MGKVFFTSSGSEANDTQVKLVWYYNNALGRP  162



>ref|XP_011467676.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Fragaria vesca subsp. vesca]
Length=448

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFT+G  ++D+HPL+IEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+AA +
Sbjct  1    MLAPFTSGSLSSDVHPLLIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEAATR  60

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KM KAFFTNSGSEANDT VKLVWYYNN
Sbjct  61   QLNTLPFYHSFWNRTTRPSLDLAKDLLETFTATKMGKAFFTNSGSEANDTQVKLVWYYNN  120

Query  624  ALGRP  638
            ALGRP
Sbjct  121  ALGRP  125



>gb|ABF69998.1| gamma-aminobutyrate transaminase, putative [Musa acuminata]
Length=534

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  195  RWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  374
            R  S+   +Q++ST+E+GF GHDMLAPFTAGWQTTDLHPLVI+KSEGSYVYDINGKKYLD
Sbjct  23   RLMSSTAPLQSESTEERGFKGHDMLAPFTAGWQTTDLHPLVIDKSEGSYVYDINGKKYLD  82

Query  375  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  554
            +LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLAKE+L+ FTA KM K
Sbjct  83   ALAGLWCTALGGNEPRLVAAATAQLNKLPFYHSFWNRTTKPSLDLAKEILEIFTARKMGK  142

Query  555  AFFTNSGSEANDTXVK  602
             FFTNSGSEAND+  K
Sbjct  143  VFFTNSGSEANDSQAK  158



>ref|XP_003607298.1| Aminotransferase y4uB [Medicago truncatula]
 gb|AES89495.1| gamma-aminobutyrate transaminase [Medicago truncatula]
Length=513

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  207  AQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  386
            A+ S  +D+   +GF  HDMLAPFTAGWQT +L+PL+IEKSEGSYVYDINGKKYLD+LAG
Sbjct  47   AKDSSTSDAKTGQGFKSHDMLAPFTAGWQTNELNPLIIEKSEGSYVYDINGKKYLDALAG  106

Query  387  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFT  566
            LW TALGG+E RLVDAA  QL  LPFYHSFWNRTT+P+LDLAKELL+ FTA KMAKAFF 
Sbjct  107  LWSTALGGSEQRLVDAATAQLKKLPFYHSFWNRTTRPALDLAKELLELFTARKMAKAFFV  166

Query  567  NSGSEANDTXVKLVWYYNNALGRP  638
            NSGSEANDT VKLVWYY NALG+P
Sbjct  167  NSGSEANDTQVKLVWYYYNALGKP  190



>ref|XP_010680154.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=503

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +3

Query  192  TRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  371
             R+ S+  S+ + +   + + GH MLAPFTAGWQTTD HPLVI+KSEG YV+DI G KYL
Sbjct  32   VRYMSSDASLDSTTESNRSYKGHGMLAPFTAGWQTTDTHPLVIDKSEGCYVFDIQGNKYL  91

Query  372  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  551
            DSLAGLW TALGGNE RL+DAA  QL  LPFYHSFWNRTTK SLDLA+ELL  FTA KMA
Sbjct  92   DSLAGLWSTALGGNESRLIDAATTQLKKLPFYHSFWNRTTKVSLDLAEELLQMFTARKMA  151

Query  552  KAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            KAFF NSGSEANDT VKLVWYYNNALGRP
Sbjct  152  KAFFVNSGSEANDTQVKLVWYYNNALGRP  180



>ref|NP_001053862.1| Os04g0614500 [Oryza sativa Japonica Group]
 sp|Q7XN12.2|GATP2_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|Q01K12.1|GATP2_ORYSI RecName: Full=Probable gamma-aminobutyrate transaminase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 emb|CAE04332.2| OSJNBa0008M17.3 [Oryza sativa Japonica Group]
 dbj|BAF15776.1| Os04g0614500 [Oryza sativa Japonica Group]
 emb|CAH66913.1| OSIGBa0126B18.6 [Oryza sativa Indica Group]
 dbj|BAG94519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  195  RWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  374
            ++S++  S   DST+  GF GH MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD
Sbjct  27   KFSTSGSSPLLDSTEGNGFKGHSMLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLD  86

Query  375  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  554
            +LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K
Sbjct  87   TLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGK  146

Query  555  AFFTNSGSEANDTXVKLVWYYNNALGRP  638
             FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  147  VFFTNSGSEANDSQVKLVWYYNNALGRP  174



>gb|EPS57260.1| hypothetical protein M569_17559, partial [Genlisea aurea]
Length=117

 Score =   220 bits (560),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GHDMLAPFTAGWQT+DL+PLVIE+SEGSYVYD++GKKYLDSLAGLWCTALGG+EPRLV
Sbjct  1    FKGHDMLAPFTAGWQTSDLNPLVIERSEGSYVYDVHGKKYLDSLAGLWCTALGGSEPRLV  60

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            DAA KQLN LPFYHSFWNRTTKPSLDLA ELLD FTANKMAK FFTNSGSEAND+ V
Sbjct  61   DAATKQLNKLPFYHSFWNRTTKPSLDLATELLDLFTANKMAKVFFTNSGSEANDSQV  117



>ref|XP_009145417.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Brassica rapa]
Length=502

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            G  GH MLAPFTAGWQ++DL P++I KSEG YVYD +GKKYLDSLAGLWCTALGG+E RL
Sbjct  48   GPKGHSMLAPFTAGWQSSDLDPMIIAKSEGCYVYDAHGKKYLDSLAGLWCTALGGSEARL  107

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            V AA+ QLNTLPFYHSFWN TTKPSLDLA++LLD FTA  MAKAFFTNSGSEANDT VKL
Sbjct  108  VSAAVSQLNTLPFYHSFWNFTTKPSLDLAQDLLDMFTAKNMAKAFFTNSGSEANDTQVKL  167

Query  606  VWYYNNALGRP  638
            VWYYNNALGRP
Sbjct  168  VWYYNNALGRP  178



>emb|CDY10622.1| BnaA05g17400D [Brassica napus]
Length=472

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  255  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  434
            GH MLAPFTAGWQ++DL P++I KSEG YVYD +GKKYLDSLAGLWCTALGG+E RLV A
Sbjct  21   GHSMLAPFTAGWQSSDLDPMIIAKSEGCYVYDAHGKKYLDSLAGLWCTALGGSEARLVSA  80

Query  435  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            A+ QLNTLPFYHSFWN TTKPSLDLA++LLD FTA  MAKAFFTNSGSEANDT VKLVWY
Sbjct  81   AVSQLNTLPFYHSFWNFTTKPSLDLAQDLLDMFTAKNMAKAFFTNSGSEANDTQVKLVWY  140

Query  615  YNNALGRP  638
            YNNALGRP
Sbjct  141  YNNALGRP  148



>ref|XP_006351980.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Solanum tuberosum]
Length=459

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            GF GHDMLAPFTA W   D+ PLVI+++EGSYVYD+NGKKYLDSL+GLWCT LGG+EPRL
Sbjct  7    GFKGHDMLAPFTAAWMI-DMGPLVIDRAEGSYVYDVNGKKYLDSLSGLWCTVLGGSEPRL  65

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            ++AA KQLN L FYHSFWNR+TKPSLDLAKEL++ FTANKM K FFTNSGSEANDT VKL
Sbjct  66   IEAANKQLNKLAFYHSFWNRSTKPSLDLAKELINMFTANKMGKVFFTNSGSEANDTQVKL  125

Query  606  VWYYNNALGRP  638
            VWYYNNA+GRP
Sbjct  126  VWYYNNAIGRP  136



>ref|XP_006652818.1| PREDICTED: probable gamma-aminobutyrate transaminase 2, mitochondrial-like 
[Oryza brachyantha]
Length=496

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +3

Query  195  RWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  374
            R  S  ++   DS +E GF GH ML+PFTAGWQ  D HP +IE+SEGSYVYD  G KYLD
Sbjct  26   RQFSTGLAPLPDSPEEAGFKGHSMLSPFTAGWQAKD-HPFIIERSEGSYVYDSKGNKYLD  84

Query  375  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  554
            +LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN TTKP LDLAKEL+  FTA +M K
Sbjct  85   ALAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTTKPPLDLAKELIGMFTAREMGK  144

Query  555  AFFTNSGSEANDTXVKLVWYYNNALGRP  638
             FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  145  VFFTNSGSEANDSQVKLVWYYNNALGRP  172



>ref|XP_008464679.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
2-like [Cucumis melo]
Length=516

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 140/187 (75%), Gaps = 7/187 (4%)
 Frame = +3

Query  99   LKRATN-QVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND------STDEKGFXG  257
            L+  TN ++GS  K + A   S   +I+ +  ++  S + S+Q D      +   + F G
Sbjct  7    LRVITNPKLGSCAKDVAAFRTSGERLIQVQLLSQQYSTEASLQRDDNSTIDTRSGQSFKG  66

Query  258  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  437
            H MLAPFT GWQ  D++PLVIE+SEG+Y+YDINGKKYLDSLAGLW T+LGG+EPRLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIERSEGTYLYDINGKKYLDSLAGLWSTSLGGSEPRLVAAA  126

Query  438  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYY  617
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K FF NSGSEAND+ VKLVWYY
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEIFTARKMGKVFFANSGSEANDSQVKLVWYY  186

Query  618  NNALGRP  638
            NNALGRP
Sbjct  187  NNALGRP  193



>emb|CAD12664.1| viroid RNA-binding protein [Solanum lycopersicum]
Length=476

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 117/131 (89%), Gaps = 1/131 (1%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            GF GHDMLAPFTA W   D+ PLVI+K+EGSYVYD+NGKKYLDSL+GLWC+ LGG+EPRL
Sbjct  16   GFMGHDMLAPFTAAWMI-DMGPLVIDKAEGSYVYDVNGKKYLDSLSGLWCSVLGGSEPRL  74

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            ++AA KQLN L FYHSFWNRTTKPSLDLAKEL++ FTANKM K FFT+SGSEANDT VKL
Sbjct  75   IEAANKQLNKLAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVFFTSSGSEANDTQVKL  134

Query  606  VWYYNNALGRP  638
            VWYYNNA+GRP
Sbjct  135  VWYYNNAIGRP  145



>gb|AFK39370.1| unknown [Lotus japonicus]
Length=447

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 114/125 (91%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFTAGWQT DL PL+IEKSEGSY+YD+NGKKYLD+LAGLW TALGGNEPRLV+AA  
Sbjct  1    MLAPFTAGWQT-DLTPLIIEKSEGSYIYDVNGKKYLDALAGLWSTALGGNEPRLVEAANA  59

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL  LPFYHSFWNRTT+PSLDLAKELL+ FTA KMAKAFF NSGSEANDT VKLVWYYNN
Sbjct  60   QLKKLPFYHSFWNRTTRPSLDLAKELLEMFTARKMAKAFFVNSGSEANDTQVKLVWYYNN  119

Query  624  ALGRP  638
            ALGRP
Sbjct  120  ALGRP  124



>ref|XP_004166491.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
3, chloroplastic-like, partial [Cucumis sativus]
Length=475

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = +3

Query  99   LKRATN-QVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STDEKG----FXG  257
            L+  TN ++GS  K + A+  S   +I+ +  ++  + + S+Q D  ST + G    F G
Sbjct  7    LRVITNPKLGSCAKDVAALRTSGERLIQVQLLSQQYATEASLQRDDNSTTDTGSGQSFKG  66

Query  258  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  437
            H MLAPFT GWQ  D++PLVIEKSEG+Y+YDINGKKYLDSLAGLW T+LGG+E RLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIEKSEGTYLYDINGKKYLDSLAGLWSTSLGGSEARLVAAA  126

Query  438  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYY  617
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K FF NSGSEAND+ VKLVWYY
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEMFTARKMGKVFFANSGSEANDSQVKLVWYY  186

Query  618  NNALGRP  638
            NNALGRP
Sbjct  187  NNALGRP  193



>ref|XP_004145993.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54978.1| hypothetical protein Csa_4G618430 [Cucumis sativus]
Length=516

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = +3

Query  99   LKRATN-QVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQND--STDEKG----FXG  257
            L+  TN ++GS  K + A+  S   +I+ +  ++  + + S+Q D  ST + G    F G
Sbjct  7    LRVITNPKLGSCAKDVAALRTSGERLIQVQLLSQQYATEASLQRDDNSTTDTGSGQSFKG  66

Query  258  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  437
            H MLAPFT GWQ  D++PLVIEKSEG+Y+YDINGKKYLDSLAGLW T+LGG+E RLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIEKSEGTYLYDINGKKYLDSLAGLWSTSLGGSEARLVAAA  126

Query  438  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYY  617
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K FF NSGSEAND+ VKLVWYY
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEMFTARKMGKVFFANSGSEANDSQVKLVWYY  186

Query  618  NNALGRP  638
            NNALGRP
Sbjct  187  NNALGRP  193



>ref|XP_004147774.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cucumis sativus]
 gb|KGN53496.1| hypothetical protein Csa_4G056840 [Cucumis sativus]
Length=510

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  240  EKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  419
            E    GHDMLAPFT+GW++ ++ P+++ +SEGSYVYD NG+KYLD+LAGLWCTALGGNE 
Sbjct  56   EPKVKGHDMLAPFTSGWESNNVGPMIMARSEGSYVYDNNGRKYLDALAGLWCTALGGNES  115

Query  420  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            RLV AA KQLNTLPFYHSFWN TT+PSLDLAKELL+ FTA KM K FFTNSGSEANDT V
Sbjct  116  RLVAAATKQLNTLPFYHSFWNHTTQPSLDLAKELLEMFTARKMGKVFFTNSGSEANDTQV  175

Query  600  KLVWYYNNALGRP  638
            K+VWYYNNALGRP
Sbjct  176  KIVWYYNNALGRP  188



>ref|XP_010093137.1| putative aminotransferase y4uB [Morus notabilis]
 gb|EXB53589.1| putative aminotransferase y4uB [Morus notabilis]
Length=466

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +3

Query  120  VGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDSTDEKGFXGHDMLAPFTAGWQTT  299
            +GS+ K++ A       I +  S  R  S            +GF GHDMLAPFTAGWQ+T
Sbjct  23   LGSYAKYVYASRIPQDQIPQVSSLARHYSTATEAAASDPKSRGFKGHDMLAPFTAGWQST  82

Query  300  DLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFW  479
            DLHPLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRLV AA  QLNTLPFYHSFW
Sbjct  83   DLHPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAATAQLNTLPFYHSFW  142

Query  480  NRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXV  599
            NRTTKPSLDLAK+L++ FTA KM K FFTNSGS+ANDT V
Sbjct  143  NRTTKPSLDLAKDLIEMFTARKMGKVFFTNSGSDANDTQV  182



>ref|NP_001234340.1| gamma aminobutyrate transaminase 2 [Solanum lycopersicum]
 sp|Q84P53.1|GATP2_SOLLC RecName: Full=Gamma aminobutyrate transaminase 2; AltName: Full=Gamma-aminobutyrate 
transaminase isozyme 2; Short=LeGABA-TP2; 
Short=SlGABA-T2 [Solanum lycopersicum]
 gb|AAO92256.1| gamma-aminobutyrate transaminase subunit precursor isozyme 2 
[Solanum lycopersicum]
 dbj|BAG16483.1| gamma aminobutyrate transaminase isoform2 [Solanum lycopersicum]
Length=458

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = +3

Query  246  GFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  425
            GF GHDMLAPFTA W   D+ PLVI+K+EGSYVY +NGKKYLDSL+GLWCT LGG+EPRL
Sbjct  6    GFMGHDMLAPFTAAWMI-DMGPLVIDKAEGSYVYGVNGKKYLDSLSGLWCTVLGGSEPRL  64

Query  426  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKL  605
            ++AA KQLN   FYHSFWNRTTKPSLDLAKEL++ FTANKM K FFT+SGSEANDT VKL
Sbjct  65   IEAASKQLNKSAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVFFTSSGSEANDTQVKL  124

Query  606  VWYYNNALGRP  638
            VWYYNNA+GRP
Sbjct  125  VWYYNNAIGRP  135



>gb|EEC77994.1| hypothetical protein OsI_17384 [Oryza sativa Indica Group]
Length=493

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/130 (78%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GH MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD+LAGLWCTALGG+EPRLV
Sbjct  54   FKGHSMLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLV  113

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
             AA  QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K FFTNSGSEAND+ VKLV
Sbjct  114  KAATDQLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGKVFFTNSGSEANDSQVKLV  173

Query  609  WYYNNALGRP  638
            WYYNNALGRP
Sbjct  174  WYYNNALGRP  183



>ref|NP_001045660.1| Os02g0112900 [Oryza sativa Japonica Group]
 sp|Q6ZH29.1|GATP4_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 4; Short=OsGABA-T 
[Oryza sativa Japonica Group]
 dbj|BAD07632.1| putative 4-aminobutyrate aminotransferase [Oryza sativa Japonica 
Group]
 dbj|BAF07574.1| Os02g0112900 [Oryza sativa Japonica Group]
Length=483

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  195  RWSSAQVSVQ---NDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  365
            ++SS   S Q   +DS +E G   H MLAPFTA WQT    PLVIE+SEG YVYD+NG K
Sbjct  9    QYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCYVYDVNGTK  68

Query  366  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANK  545
            YLD+LAGL  TALGG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +
Sbjct  69   YLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTARE  128

Query  546  MAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            M K FFTNSGSEAND+ VK+VWYYNNALGRP
Sbjct  129  MGKVFFTNSGSEANDSQVKIVWYYNNALGRP  159



>gb|AAK11219.1|AF324485_1 aminotransferase-like protein [Oryza sativa]
Length=483

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 119/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  195  RWSSAQVSVQ---NDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  365
            ++SS   S Q   +DS +E G   H MLAPFTA WQT    PLVIE+SEG YVYD+NG K
Sbjct  9    QYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCYVYDVNGTK  68

Query  366  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANK  545
            YLD+LAGL  TALGG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +
Sbjct  69   YLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTARE  128

Query  546  MAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            M K FFTNSGSEAND+ VK+VWYYNNALGRP
Sbjct  129  MGKVFFTNSGSEANDSQVKIVWYYNNALGRP  159



>gb|EEE61675.1| hypothetical protein OsJ_16144 [Oryza sativa Japonica Group]
Length=435

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD+LAGLWCTALGG+EPRLV AA  
Sbjct  1    MLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATD  60

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K FFTNSGSEAND+ VKLVWYYNN
Sbjct  61   QLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGKVFFTNSGSEANDSQVKLVWYYNN  120

Query  624  ALGRP  638
            ALGRP
Sbjct  121  ALGRP  125



>ref|XP_008451902.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
1, mitochondrial-like [Cucumis melo]
Length=447

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            MLAPFT+GW++ ++ P++I +SEG YVYD NG+KYLD+LAGLWCTALGGNE RLV AA K
Sbjct  1    MLAPFTSGWESNNVDPVIIARSEGPYVYDNNGRKYLDALAGLWCTALGGNESRLVAAATK  60

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QLNTLPFYHSFWN TT+PSLDLAK+LL+ FTA KM K FFTNSGSEANDT VK+VWYYNN
Sbjct  61   QLNTLPFYHSFWNHTTQPSLDLAKKLLEMFTARKMGKVFFTNSGSEANDTQVKIVWYYNN  120

Query  624  ALGRP  638
            ALGRP
Sbjct  121  ALGRP  125



>gb|EMS61591.1| putative aminotransferase y4uB [Triticum urartu]
Length=542

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 111/168 (66%), Gaps = 44/168 (26%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            F GH MLAPFTAGWQ+ D+HPL      GSYVYDING KYLDSLAGLWCTALGG+EPRLV
Sbjct  51   FKGHGMLAPFTAGWQSNDVHPL------GSYVYDINGNKYLDSLAGLWCTALGGSEPRLV  104

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDT-----  593
             AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA+KM KAFFTNSGSEAND+     
Sbjct  105  KAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMGKAFFTNSGSEANDSHMLCS  164

Query  594  ---------------------------------XVKLVWYYNNALGRP  638
                                              VKLVWYYNNALGRP
Sbjct  165  LRRVATIDTIYVALTVIRHSHLQRITKNCFTLCYVKLVWYYNNALGRP  212



>ref|XP_002978448.1| hypothetical protein SELMODRAFT_177017 [Selaginella moellendorffii]
 gb|EFJ20434.1| hypothetical protein SELMODRAFT_177017 [Selaginella moellendorffii]
Length=463

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  222  QNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  401
            ++ + DE     H+ML+PFTAGWQ   + PL+IEKSEG YVYD NG KYLD+LAGLW  A
Sbjct  3    KDAAKDEALEQRHNMLSPFTAGWQMVKVEPLIIEKSEGIYVYDTNGNKYLDALAGLWNNA  62

Query  402  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSE  581
            LGGNEPRLV+AA KQL+ LP+YHSFWNRTT  +L+LAKEL++ FT  KM++  FTNSGSE
Sbjct  63   LGGNEPRLVEAAKKQLDVLPYYHSFWNRTTPVTLELAKELVEMFTQVKMSRVLFTNSGSE  122

Query  582  ANDTXVKLVWYYNNALGRP  638
            +ND+ V+LVWYY NA+G+P
Sbjct  123  SNDSQVRLVWYYYNAIGKP  141



>ref|XP_002970285.1| hypothetical protein SELMODRAFT_270846 [Selaginella moellendorffii]
 gb|EFJ28415.1| hypothetical protein SELMODRAFT_270846 [Selaginella moellendorffii]
Length=463

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  222  QNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  401
            ++ + DE     H+ML+PFTAGWQ   + PL+IEKSEG YVYD NG KYLD+LAGLW  A
Sbjct  3    KDAAKDEALEQRHNMLSPFTAGWQMVKVEPLIIEKSEGIYVYDTNGNKYLDALAGLWNNA  62

Query  402  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSE  581
            LGGNEPRLV+AA KQL+ LP+YHSFWNRTT  +L+LAKEL++ FT  KM++  FTNSGSE
Sbjct  63   LGGNEPRLVEAAKKQLDVLPYYHSFWNRTTPVTLELAKELVEMFTQVKMSRVLFTNSGSE  122

Query  582  ANDTXVKLVWYYNNALGRP  638
            +ND+ V+LVWYY NA+G+P
Sbjct  123  SNDSQVRLVWYYYNAIGKP  141



>ref|XP_001783174.1| predicted protein [Physcomitrella patens]
 gb|EDQ52005.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  258  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  437
            H MLAPFTAGWQ     PLVIE+ EG YV+D  G KYLD+LAGLWCTALG +E RLV AA
Sbjct  44   HSMLAPFTAGWQMKAGTPLVIERGEGVYVWDNKGNKYLDALAGLWCTALGFSEKRLVAAA  103

Query  438  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYY  617
             KQL+TLPFYH+FWNRT++P+LDLA EL   FTA++M+K FF NSGSEANDT VKLVWYY
Sbjct  104  EKQLSTLPFYHNFWNRTSQPTLDLASELSKLFTASEMSKVFFCNSGSEANDTQVKLVWYY  163

Query  618  NNALGRP  638
            NNA+GRP
Sbjct  164  NNAIGRP  170



>ref|XP_008662070.1| PREDICTED: aminotransferase y4uB isoform X1 [Zea mays]
Length=442

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +3

Query  330  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  509
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  15   QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDL  74

Query  510  AKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            A+E+L  FTA +M K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  75   AQEILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  117



>gb|EMT06765.1| Putative aminotransferase y4uB [Aegilops tauschii]
Length=499

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 108/153 (71%), Gaps = 29/153 (19%)
 Frame = +3

Query  243  KGFXGHDMLAPFTAGWQTTDLHPLVIEKSE-----------------------------G  335
            + F GH MLAPFTAGWQ+TD+HPLVI++SE                             G
Sbjct  54   EAFKGHGMLAPFTAGWQSTDVHPLVIDRSEVLGLNAHLSINCSDFNLKVLSYTLQLILQG  113

Query  336  SYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAK  515
            +YVYDINGKKY+D+LAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA 
Sbjct  114  AYVYDINGKKYIDALAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAN  173

Query  516  ELLDTFTANKMAKAFFTNSGSEANDTXVKLVWY  614
            ++L+ FTA +M K FF NSGSEAND+ +  + Y
Sbjct  174  DVLNMFTAREMGKVFFANSGSEANDSQLCNIIY  206



>gb|EMT11453.1| Putative aminotransferase y4uB [Aegilops tauschii]
Length=516

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 99/123 (80%), Gaps = 6/123 (5%)
 Frame = +3

Query  288  WQTTDLH------PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQL  449
            W  TDL        +++    GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA  QL
Sbjct  72   WLLTDLRLRLSNSSIILHAMVGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATDQL  131

Query  450  NTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNAL  629
            N LPFYHSFWNRTTKP+LDLA +LL  FTA+KM KAFFTNSGSEAND+ VKLVWYYNNAL
Sbjct  132  NKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMGKAFFTNSGSEANDSHVKLVWYYNNAL  191

Query  630  GRP  638
            GRP
Sbjct  192  GRP  194



>ref|XP_001762156.1| predicted protein [Physcomitrella patens]
 gb|EDQ72948.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = +3

Query  249  FXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  428
            + GH MLAPFT+G Q  +  PL+I K EG YV+D NGKKYLD+LAGLWC ++G +E RL+
Sbjct  2    YHGHSMLAPFTSGSQQMETEPLIIAKGEGVYVWDRNGKKYLDALAGLWCASMGFSEKRLM  61

Query  429  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLV  608
            +AA  Q+  LPFYHSFWNRT++P LDLAKEL+D F   KM K FF N+GSEANDT VKL 
Sbjct  62   NAAWNQMTQLPFYHSFWNRTSQPPLDLAKELIDIFKPVKMGKVFFCNTGSEANDTQVKLA  121

Query  609  WYYNNALGR  635
            WYYNNALGR
Sbjct  122  WYYNNALGR  130



>ref|XP_004173032.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like, 
partial [Cucumis sativus]
Length=422

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 90/100 (90%), Gaps = 0/100 (0%)
 Frame = +3

Query  339  YVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKE  518
            YVYD NG+KYLD+LAGLWCTALGGNE RLV AA KQLNTLPFYHSFWN TT+PSLDLAKE
Sbjct  1    YVYDNNGRKYLDALAGLWCTALGGNESRLVAAATKQLNTLPFYHSFWNHTTQPSLDLAKE  60

Query  519  LLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            LL+ FTA KM K FFTNSGSEANDT VK+VWYYNNALGRP
Sbjct  61   LLEMFTARKMGKVFFTNSGSEANDTQVKIVWYYNNALGRP  100



>gb|EEC77996.1| hypothetical protein OsI_17386 [Oryza sativa Indica Group]
Length=2239

 Score =   178 bits (452),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  330   EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  509
             +GSYVYD  G KYLD+LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN T KP LDL
Sbjct  1887  QGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTAKPPLDL  1946

Query  510   AKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             A+EL+  FTA +M K FFTNSGSEAND+ VKLVWYYNNALGRP
Sbjct  1947  AEELISMFTAKEMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  1989



>ref|XP_008652184.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=124

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  330  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  509
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  2    QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDL  61

Query  510  AKELLDTFTANKMAKAFFTNSGSEANDT  593
            A+E+L  FTA +M K FFTNSGSEAND+
Sbjct  62   AQEILSMFTAREMGKVFFTNSGSEANDS  89



>ref|XP_008652185.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=120

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +3

Query  330  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  509
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  2    QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDL  61

Query  510  AKELLDTFTANKMAKAFFTNSGSEANDT  593
            A+E+L  FTA +M K FFTNSGSEAND+
Sbjct  62   AQEILSMFTAREMGKVFFTNSGSEANDS  89



>gb|EMS53048.1| putative aminotransferase y4uB [Triticum urartu]
Length=574

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 115/181 (64%), Gaps = 12/181 (7%)
 Frame = +3

Query  57   RXAVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirxrsPTRWSSAQVSVQNDST  236
            R +++   RL   T+     +  S VK++ +    HG      +  R  S++ S+Q DST
Sbjct  129  RDSLSFSYRLPIETVDVGEKEAESLVKYVASAGSWHGLHSFSEASARGFSSEPSLQADST  188

Query  237  DEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  416
            +E G              +     P +I   +G+YVYDINGKKY+D+LAGLWCTALGGNE
Sbjct  189  EEIG----------DCNLKVLSYTPQLI--LQGAYVYDINGKKYIDALAGLWCTALGGNE  236

Query  417  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTX  596
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M K FF NSGSEAND+ 
Sbjct  237  PRLVKAATEQLNKLPFYHSFWNRTTKPSLDLANDVLNMFTAREMGKVFFANSGSEANDSQ  296

Query  597  V  599
            +
Sbjct  297  I  297



>ref|WP_041862975.1| aminotransferase [Bordetella petrii]
Length=454

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         P+VIE+ EG YVYD  G++YL+ +AGLW  A+G  E RLV+AA +Q
Sbjct  16   LHPYTNAVVHQRTGPIVIERGEGVYVYDDQGRRYLEGMAGLWSVAVGFGEQRLVEAATRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++  P+++LA+ L+  +T  +MAKAFFTNSGSEANDT +KLVWYYNNA
Sbjct  76   LQKLPYYHTFTHKSHAPAIELAERLIG-YTEGRMAKAFFTNSGSEANDTVIKLVWYYNNA  134

Query  627  LGRP  638
            LGRP
Sbjct  135  LGRP  138



>emb|CAP43438.1| putative aminotransferase [Bordetella petrii]
Length=456

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         P+VIE+ EG YVYD  G++YL+ +AGLW  A+G  E RLV+AA +Q
Sbjct  18   LHPYTNAVVHQRTGPIVIERGEGVYVYDDQGRRYLEGMAGLWSVAVGFGEQRLVEAATRQ  77

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++  P+++LA+ L+  +T  +MAKAFFTNSGSEANDT +KLVWYYNNA
Sbjct  78   LQKLPYYHTFTHKSHAPAIELAERLIG-YTEGRMAKAFFTNSGSEANDTVIKLVWYYNNA  136

Query  627  LGRP  638
            LGRP
Sbjct  137  LGRP  140



>ref|WP_013742690.1| aminotransferase [Pusillimonas sp. T7-7]
 gb|AEC20154.1| aminotransferase [Pusillimonas sp. T7-7]
Length=453

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +   + P +IE+ EG YVYD  G+KY++ +AGLW  A+G NE RLVDAA +Q
Sbjct  16   LHPYTNAIKHRQVGPRIIERGEGIYVYDDQGRKYIEGMAGLWSVAVGFNEQRLVDAAQRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F ++T  PS++LA+ L+   T  +M+ AFFTNSGSEANDT +K+VWYYNNA
Sbjct  76   MQKLPFYHTFTHKTHTPSIELAERLVQA-TQGQMSTAFFTNSGSEANDTVIKMVWYYNNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_044433671.1| aminotransferase [Skermanella aerolata]
 gb|KJB92497.1| aminotransferase [Skermanella aerolata KACC 11604]
Length=464

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      D+ PLVIE+ EG +V+D +GK Y++ +AGLWCT+LG  E RLV+AA +Q
Sbjct  18   LHPYTNLKTHEDVGPLVIERGEGVHVFDDSGKAYIEGMAGLWCTSLGFGEERLVEAATRQ  77

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LPFYH+F ++   P +DLA+ L+       M+K FFTNSGSEANDT VKLVWYYNNA
Sbjct  78   LRKLPFYHAFTHKAHDPGIDLAEALIK-IAPVPMSKVFFTNSGSEANDTVVKLVWYYNNA  136

Query  627  LGRP  638
            LGRP
Sbjct  137  LGRP  140



>ref|WP_026641250.1| aminotransferase [Bordetella petrii]
Length=455

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         P+VI++ EG YVYD  G++YL+++AGLW  A+G  E RLVDAA +Q
Sbjct  16   LHPYTNAVVHQRTGPVVIDRGEGIYVYDDQGRQYLEAMAGLWSVAVGFGEQRLVDAATRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YH+F +++  P+++LA+ L+  +T  +MAKAFFTNSGSEANDT +KLVWYYNNA
Sbjct  76   MQKLPYYHTFTHKSHTPAIELAERLIG-YTDGRMAKAFFTNSGSEANDTVIKLVWYYNNA  134

Query  627  LGRP  638
            LGRP
Sbjct  135  LGRP  138



>ref|XP_011468608.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=288

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  405  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEA  584
            GGNE RLV+AA +QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KMAK FFTNSGSEA
Sbjct  52   GGNELRLVEAATRQLNTLPFYHSFWNRTTRPSLDLAKDLLETFTARKMAKVFFTNSGSEA  111

Query  585  NDTXVKLVWYYNNALGRP  638
            NDT VKLVWYYNNAL RP
Sbjct  112  NDTQVKLVWYYNNALARP  129



>ref|WP_018897972.1| aminotransferase [Rhizobium sp. 2MFCol3.1]
Length=458

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +  ++ P+VIEK EG YVYD +G +Y++ LAGLW  A+G NEPRLVDAA +Q
Sbjct  18   LHPYTDARRHEEIGPMVIEKGEGIYVYDADGNRYIEGLAGLWSVAVGFNEPRLVDAAAQQ  77

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YH+F ++  +PS+ LA++L++  T + + + F+T+SGSEANDT VK++WY NNA
Sbjct  78   MAKLPYYHTFSHKAHEPSIRLAEKLVE-MTPDNLTRVFYTSSGSEANDTVVKMIWYMNNA  136

Query  627  LGRP  638
            LGRP
Sbjct  137  LGRP  140



>ref|WP_028355511.1| aminotransferase [Bordetella petrii]
Length=455

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            P+VI++ EG YVYD  G++YL+++AGLW  A+G  E RL DAA +QL  LP+YH+F +++
Sbjct  30   PIVIDRGEGVYVYDDQGQRYLEAMAGLWSVAVGFGEQRLADAAARQLQKLPYYHTFTHKS  89

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
              P+++LA+ L+  +T  +MAKAFFTNSGSEANDT VKLVWYYNNAL RP
Sbjct  90   HAPAIELAERLIG-YTGGRMAKAFFTNSGSEANDTVVKLVWYYNNALDRP  138



>ref|WP_034191978.1| aminotransferase [Burkholderia cenocepacia]
 gb|KEA55089.1| aminotransferase [Burkholderia cenocepacia]
Length=456

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   +  D+ P+VIE+ EG YVYD  G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGFSEQRLADAADR  71

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYH+F +++++PS+ LA++L+       M+K FF NSGSEANDT VKL+WYYNN
Sbjct  72   QMRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVFFANSGSEANDTAVKLIWYYNN  130

Query  624  ALGRP  638
            ALGRP
Sbjct  131  ALGRP  135



>ref|WP_025516482.1| aminotransferase [Bordetella trematum]
Length=455

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 100/142 (70%), Gaps = 8/142 (6%)
 Frame = +3

Query  219  VQNDSTDEKGFXGHDM---LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGL  389
            + N S D++    HD+   L  +T G +  ++ P ++ + EG YVYD  G +YL+ +AGL
Sbjct  1    MSNLSQDQQ----HDIQYQLHSYTNGVKHAEVGPRIMARGEGIYVYDDKGNRYLEGMAGL  56

Query  390  WCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTN  569
            W  A+G  EPRLVDAA +QL  LP+YH+F +++    ++LA+ L+D +T  +MA+AFFTN
Sbjct  57   WSVAVGFGEPRLVDAATRQLQELPYYHTFTHKSHPAVIELAQRLID-YTEGRMARAFFTN  115

Query  570  SGSEANDTXVKLVWYYNNALGR  635
            SGSEANDT VKLVWYY+NALGR
Sbjct  116  SGSEANDTVVKLVWYYHNALGR  137



>ref|WP_039371201.1| aminotransferase [Mumia flava]
 gb|KHL08170.1| aminotransferase [Mumia flava]
Length=456

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   +  D+ P+VIE+ EG YVYD  G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGFSESRLADAADR  71

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYH+F +++++PS+ LA++L+       M+K FF NSGSEANDT +KL+WYYNN
Sbjct  72   QMRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVFFANSGSEANDTAMKLIWYYNN  130

Query  624  ALGRP  638
            ALGRP
Sbjct  131  ALGRP  135



>ref|WP_042300360.1| aminotransferase [Burkholderia kururiensis]
Length=456

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      D+ P+VI++ EG YVYD  GK+Y+++L+GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHRDVGPMVIDRGEGVYVYDTEGKRYIEALSGLFCASLGFSEQRLADAADRQ  72

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WYYNNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYYNNA  131

Query  627  LGRP  638
            +GRP
Sbjct  132  IGRP  135



>ref|WP_017775036.1| aminotransferase [Burkholderia kururiensis]
Length=456

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      D+ P+VI++ EG YVYD  GK+Y+++L+GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHRDVGPMVIDRGEGVYVYDTEGKRYIEALSGLFCASLGFSEQRLADAADRQ  72

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WYYNNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYYNNA  131

Query  627  LGRP  638
            +GRP
Sbjct  132  IGRP  135



>ref|WP_024509951.1| aminotransferase [Bradyrhizobium sp. ARR65]
Length=460

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            PL++E+ EG YVYD NGK+Y++ LAGLW  A+G +E RL +AAMKQ+  LPFYH F++++
Sbjct  30   PLIMERGEGIYVYDTNGKQYIEGLAGLWSVAVGFSEKRLAEAAMKQMEKLPFYHIFFSKS  89

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             +PS+ L+ +L++     ++++ F+TNSGSEANDT +KLVWY NNALGRP
Sbjct  90   HEPSIRLSDKLIEMAADPRLSRVFYTNSGSEANDTVIKLVWYMNNALGRP  139



>ref|WP_031360219.1| aminotransferase [Burkholderia sordidicola]
Length=458

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ P+VI++ EG YVYD  G +Y++ L GL+C +LG +E RL DAA +Q
Sbjct  16   LHPYTNLSAHREVGPMVIDRGEGVYVYDTEGNRYIEGLGGLFCASLGFSESRLADAADRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+D      M+K FF NSGSEANDT +KL+WYYNNA
Sbjct  76   MRKLPFYHAFGHKSSEPSIRLAEKLID-MAPVPMSKVFFANSGSEANDTAIKLIWYYNNA  134

Query  627  LGRP  638
            LGRP
Sbjct  135  LGRP  138



>ref|WP_023048105.1| MULTISPECIES: aminotransferase [Pseudomonas]
 gb|ERT17847.1| aminotransferase [Pseudomonas putida SJ3]
 gb|AHC35732.1| aminotransferase [Pseudomonas sp. TKP]
 gb|ETK14138.1| aminotransferase [Pseudomonas sp. FH1]
 gb|EZN87292.1| hypothetical protein AJ67_04667 [Pseudomonas aeruginosa 3580]
 gb|EZN88306.1| hypothetical protein AJ68_04436 [Pseudomonas aeruginosa 3581]
 gb|AIG01262.1| aminotransferase [Pseudomonas fluorescens]
 gb|AIN58561.1| aminotransferase [Pseudomonas mosselii SJ10]
 gb|AJG14397.1| aminotransferase [Pseudomonas plecoglossicida]
Length=455

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      +L PL+IE+ EG YVYD  GK Y++++AGLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTNARLHQELGPLIIERGEGIYVYDDQGKGYIEAMAGLWSAALGFSNQRLIKAAEQQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
             NTLPFYH F +++ +PS++LA++L++      M+K FFTNSGSEANDT VK+VWY NNA
Sbjct  77   FNTLPFYHLFSHKSHRPSIELAEKLIE-MAPVPMSKVFFTNSGSEANDTVVKMVWYLNNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGKP  139



>ref|WP_024810724.1| aminotransferase [Oceanicola sp. HL-35]
Length=461

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +  +  P+VI++ EG +VYD NGKKY+++L+GLW  A+G NE RL DAAM Q
Sbjct  18   LHPYTDARKHEEQGPIVIDRGEGIHVYDSNGKKYIEALSGLWSVAVGFNEQRLCDAAMAQ  77

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YH+F +++ +PS+ LA++L++  T   + + F+T+SGSEANDT VK+VW+YNNA
Sbjct  78   MQKLPYYHTFAHKSHEPSIRLAEKLVE-MTPEHLTRVFYTSSGSEANDTVVKMVWFYNNA  136

Query  627  LGRP  638
            LGRP
Sbjct  137  LGRP  140



>ref|WP_012417867.1| aminotransferase [Bordetella avium]
 emb|CAJ49815.1| gamma-aminobutyrate transaminase [Bordetella avium 197N]
Length=457

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 90/123 (73%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T G +   + P ++ + EG YVYD  GK+YL+ +AGLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNGVKHAQVGPRIMTRGEGIYVYDDQGKRYLEGMAGLWSVAVGFGEPRLVDAATRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YH+F +++    ++LA+ L+  +T  +MA+A+FTNSGSEANDT VKLVWYYNNA
Sbjct  76   MQELPYYHTFTHKSHPSVIELAERLIG-YTDGRMARAYFTNSGSEANDTVVKLVWYYNNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_012367259.1| aminotransferase [Burkholderia ambifaria]
 gb|ACB69025.1| aminotransferase class-III [Burkholderia ambifaria MC40-6]
Length=456

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T      ++ P+VIE+ EG YVYD +G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSLHREVGPMVIERGEGVYVYDTDGNRYIEALSGLFCASLGFSESRLADAADR  71

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYH+F +++++P + LA++L+ +     M+K FF NSGSEANDT VKL+WYYNN
Sbjct  72   QMRRLPFYHAFGHKSSEPVILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYYNN  130

Query  624  ALGRP  638
            ALGRP
Sbjct  131  ALGRP  135



>ref|WP_018898134.1| hypothetical protein [Rhizobium sp. 2MFCol3.1]
Length=457

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T         PLVIE+ EG +VYD  GK+Y+++LAGLW  A+G +EPRLVDAA +
Sbjct  17   VLHPYTNARAHEKSGPLVIERGEGIHVYDTAGKQYIEALAGLWSVAVGFDEPRLVDAAAR  76

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LP+YH F ++  +PS+ LA++L++   AN + + FFT+SGSEANDT VK+VWY NN
Sbjct  77   QMAKLPYYHIFSHKAHEPSVRLAEKLVEMTPAN-LTRVFFTSSGSEANDTVVKMVWYMNN  135

Query  624  ALGRP  638
            ALGRP
Sbjct  136  ALGRP  140



>ref|WP_035541932.1| aminotransferase [Burkholderia sp. UYPR1.413]
Length=456

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ P+VIE+ EG YVYD  GK+YL+ L GL+C +LG +E RL DAA  Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGKRYLEGLGGLFCASLGFSEHRLADAADGQ  72

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSIRLAEKLI-SIAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  627  LGRP  638
            +GRP
Sbjct  132  IGRP  135



>ref|WP_028466856.1| aminotransferase [Nisaea denitrificans]
Length=462

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T      +  P++IE+ EG YVYD  GKKY++ +AGLW T+LG N  RL  AAMK
Sbjct  16   VLHPYTNFEAHEEKGPMIIERGEGIYVYDDAGKKYIEGMAGLWSTSLGFNSERLKQAAMK  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q +TLP+YH+F ++   PS+DLA++L+       M+K FF NSGSEANDT +K++WYYNN
Sbjct  76   QFDTLPYYHTFAHKAHLPSIDLAEKLISKMPV-PMSKVFFNNSGSEANDTAIKIIWYYNN  134

Query  624  ALGR  635
            ALGR
Sbjct  135  ALGR  138



>ref|WP_043683550.1| aminotransferase [Castellaniella defragrans]
 emb|CDM25042.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Castellaniella 
defragrans 65Phen]
Length=454

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   Q   + P ++++  G +VYD  GK+Y++ ++GLW  A+G +EPRL   A +Q
Sbjct  16   LHAYTNAVQHQGIGPCIMDRGHGIHVYDTGGKEYIEGMSGLWSVAVGFSEPRLAQVAYEQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++  PS++LA++L+   T  +MA+AFFTNSGSEANDT VK+VWYYNNA
Sbjct  76   MQRLPFYHTFSHKSNVPSIELAEKLIG-LTGGRMAQAFFTNSGSEANDTIVKMVWYYNNA  134

Query  627  LGRP  638
            LGRP
Sbjct  135  LGRP  138



>ref|WP_029014519.1| aminotransferase [Niveispirillum irakense]
Length=462

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            PL+I   +G  V D +GK+Y++ +AGLWCT+LG +EPRLV+AA++Q+ TLPFYH+F +++
Sbjct  31   PLIIASGKGVTVTDESGKEYIEGVAGLWCTSLGFDEPRLVEAAIRQMRTLPFYHAFAHKS  90

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             +P++DLA++L+       M+K FF  SGSEANDT VKLVWYYNNALGRP
Sbjct  91   HEPAIDLAEQLI-ALAPVPMSKVFFACSGSEANDTAVKLVWYYNNALGRP  139



>ref|WP_037458242.1| aminotransferase [Skermanella stibiiresistens]
 gb|EWY37755.1| aminotransferase [Skermanella stibiiresistens SB22]
Length=462

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +  ++ P++I++ EG YVYD +GK+Y++++AGLW  A+G  E RLVDAA +Q
Sbjct  18   LHPYTNARRHEEVGPIIIDRGEGVYVYDDSGKQYIEAMAGLWSVAVGFGEKRLVDAAARQ  77

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YH+F  +  +PS+ LA+ L+     N +++ FFTNSGSEANDT VK+VWYYNNA
Sbjct  78   MAKLPYYHTFSGKAHEPSILLAERLVK-MAPNGLSRVFFTNSGSEANDTVVKMVWYYNNA  136

Query  627  LGRP  638
            +G+P
Sbjct  137  IGKP  140



>ref|WP_012566210.1| aminotransferase [Rhodospirillum centenum]
 gb|ACI98421.1| aminotransferase, class III [Rhodospirillum centenum SW]
Length=467

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T       + P+VI    G  V D  G++Y++ +AGLWCT+LG +EPRLV+AA++
Sbjct  20   LLHPYTNLKAHESVGPMVITGGRGVTVVDDAGREYIEGVAGLWCTSLGFDEPRLVEAAVR  79

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL TLPFYH+F +++ +P ++LA++L+       M+KAFF  SGSEANDT VKLVWYYNN
Sbjct  80   QLRTLPFYHAFAHKSHEPGIELAEKLV-ALAPVPMSKAFFACSGSEANDTAVKLVWYYNN  138

Query  624  ALGRP  638
            ALGRP
Sbjct  139  ALGRP  143



>ref|WP_037454523.1| aminotransferase [Skermanella stibiiresistens]
 gb|EWY39385.1| aminotransferase [Skermanella stibiiresistens SB22]
Length=463

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T       + PLVIE+  G +V+D +GK Y++ +AGLWCT+LG  E RLV+AA +Q
Sbjct  17   LHPYTNLKTHETVGPLVIERGSGVHVFDDSGKSYIEGMAGLWCTSLGFGEERLVEAAARQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYHSF ++   P +DLA+ L+       M+K FFT+SGSEANDT VKLVWY+NNA
Sbjct  77   MRKLPFYHSFGHKAHDPGIDLAEALIG-MAPVPMSKVFFTSSGSEANDTVVKLVWYHNNA  135

Query  627  LGRP  638
            LGRP
Sbjct  136  LGRP  139



>ref|WP_032964494.1| aminotransferase [Bordetella hinzii]
 gb|KCB21262.1| aminotransferase, class III [Bordetella hinzii OH87 BAL007II]
 gb|KCB33411.1| aminotransferase, class III [Bordetella hinzii CA90 BAL1384]
 gb|KCB43826.1| aminotransferase, class III [Bordetella hinzii 5132]
Length=457

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +   + P ++ + EG YVYD  G +YL+ ++GLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAVKHAQVGPRIMTRGEGIYVYDDKGNRYLEGMSGLWSVAVGFGEPRLVDAAARQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++    ++L++ L+D +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSQRLID-YTEGRMARAFFTNSGSEANDTVVKLVWYYNNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_029579725.1| aminotransferase [Bordetella hinzii]
 gb|KCB26803.1| aminotransferase, class III [Bordetella hinzii L60]
 gb|KCB49113.1| aminotransferase, class III [Bordetella hinzii 1277]
 gb|KCB49784.1| aminotransferase, class III [Bordetella hinzii 4161]
Length=457

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +   + P ++ + EG YVYD  G +YL+ ++GLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAVKHAQVGPRIMTRGEGIYVYDDKGNRYLEGMSGLWSVAVGFGEPRLVDAAARQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++    ++L++ L+D +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSQRLID-YTEGRMARAFFTNSGSEANDTVVKLVWYYNNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_034802113.1| aminotransferase [Ensifer adhaerens]
Length=451

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 90/127 (71%), Gaps = 1/127 (1%)
 Frame = +3

Query  258  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  437
              ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA
Sbjct  4    QSLVHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAA  63

Query  438  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYY  617
             +QL T+PFYHSF +++T+P + LA++LL+      M+K FF  SGSEANDT +KLVWYY
Sbjct  64   TRQLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVFFAGSGSEANDTAIKLVWYY  122

Query  618  NNALGRP  638
            NNA+GRP
Sbjct  123  NNAVGRP  129



>ref|WP_026987379.1| aminotransferase [Fodinicurvata fenggangensis]
Length=462

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +  +  PL+++  +G +VYD  GK+Y++ + GLWC ALG  E RLV AA +Q
Sbjct  17   LHPYTNARRHEESGPLIVDHGKGVHVYDDQGKEYIEGMGGLWCVALGFGEERLVKAATEQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YHSF  ++ +PS++L++ LLD     ++ K F+ NSGSEANDT VKLVWYYNNA
Sbjct  77   MQRLPYYHSFAQKSHEPSIELSERLLD-MAPGELGKVFYANSGSEANDTVVKLVWYYNNA  135

Query  627  LGRP  638
            LGRP
Sbjct  136  LGRP  139



>ref|WP_043683574.1| aminotransferase [Castellaniella defragrans]
 emb|CDM25054.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Castellaniella 
defragrans 65Phen]
Length=453

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            P ++ +  G +VYD  GK+Y++ ++GLW  A+G +EPRL +AA +Q+  LPFYH+F  ++
Sbjct  30   PCIMARGNGIHVYDTEGKEYIEGMSGLWSVAVGFSEPRLAEAARRQMECLPFYHTFSQKS  89

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
              PS++LA++L+   T  +MA+AFFTNSGSEANDT VK+VWYYNNALGRP
Sbjct  90   NVPSIELAEKLIG-LTGGRMAQAFFTNSGSEANDTIVKMVWYYNNALGRP  138



>gb|KDP71648.1| aminotransferase [Ensifer adhaerens]
Length=461

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL T+PFYHSF +++T+P + LA++LL+      M+K FF  SGSEANDT +KLVWYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVFFAGSGSEANDTAIKLVWYYNN  134

Query  624  ALGRP  638
            A+GRP
Sbjct  135  AVGRP  139



>ref|WP_007733279.1| aminotransferase [Burkholderia sp. BT03]
 gb|EUC19086.1| Adenosylmethionine--8-amino-7-oxononanoate transaminase [Burkholderia 
sp. BT03]
Length=456

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ P+VIE+ EG YVYD  G +YL+ L GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGNRYLEGLGGLFCASLGFSETRLADAADRQ  72

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  627  LGRP  638
            +GRP
Sbjct  132  IGRP  135



>ref|WP_009770733.1| aminotransferase [Burkholderia terrae]
 gb|EIM94330.1| aminotransferase [Burkholderia terrae BS001]
Length=456

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ P+VIE+ EG YVYD  G +YL+ L GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGNRYLEGLGGLFCASLGFSETRLADAADRQ  72

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  627  LGRP  638
            +GRP
Sbjct  132  IGRP  135



>ref|WP_005014723.1| aminotransferase [Bordetella holmesii]
 gb|EMD70840.1| aminotransferase [Bordetella holmesii F627]
 gb|EMD74973.1| aminotransferase [Bordetella holmesii H558]
 gb|EWM45293.1| aminotransferase class-III family protein [Bordetella holmesii 
70147]
 gb|EWM48268.1| aminotransferase class-III family protein [Bordetella holmesii 
41130]
 gb|EXF90232.1| aminotransferase class-III family protein [Bordetella holmesii 
30539]
 gb|EXX94595.1| aminotransferase class-III family protein [Bordetella holmesii 
1058]
 gb|AHV94739.1| aminotransferase class-III family protein [Bordetella holmesii 
ATCC 51541]
 gb|KAK82596.1| aminotransferase, class III [Bordetella holmesii CDC-H572-BH]
 gb|KAK83239.1| aminotransferase, class III [Bordetella holmesii CDC-H809-BH]
 gb|KAK85369.1| aminotransferase, class III [Bordetella holmseii H620]
 gb|KAK90974.1| aminotransferase, class III [Bordetella holmesii CDC-H635-BH]
 gb|KAK95337.1| aminotransferase, class III [Bordetella holmesii CDC-H585-BH]
 gb|KCV03716.1| aminotransferase, class III [Bordetella holmesii CDC-H629-BH]
 gb|KCV04775.1| aminotransferase, class III [Bordetella holmesii CDC-H719-BH]
 gb|KCV09448.1| aminotransferase, class III [Bordetella holmesii 04P3421]
 gb|KCV12082.1| aminotransferase, class III [Bordetella holmesii CDC-H785-BH]
 gb|KCV18319.1| aminotransferase, class III [Bordetella holmesii CDC-H643-BH]
 gb|AIT24727.1| aminotransferase class-III family protein [Bordetella holmesii 
44057]
Length=457

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +   + P +I + EG YVYD  G +YL+ +AGLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAIKHAQVGPRIITRGEGIYVYDDKGNRYLEGMAGLWSVAVGFGEPRLVDAATRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++    ++L++ L+  +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSERLIG-YTEGRMAQAFFTNSGSEANDTVVKLVWYYNNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_041798615.1| aminotransferase [Rhodopseudomonas palustris]
Length=459

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +  P+T   Q   + P+VIE+ EG +VYD NG++YL++LAGLW  A+G  EPRLV+AA K
Sbjct  14   LFHPYTNPRQHEQVGPVVIERGEGVFVYDTNGQRYLEALAGLWSVAVGFGEPRLVEAAAK  73

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q++ LPFYH F +++  P + LA +L       +++   F+NSGSEAND+ VKLVW+YNN
Sbjct  74   QMSMLPFYHLFAHKSHSPGIRLADKLC-AMAPGQLSHVLFSNSGSEANDSVVKLVWFYNN  132

Query  624  ALGRP  638
            +LGRP
Sbjct  133  SLGRP  137



>ref|WP_035988183.1| aminotransferase [Burkholderia caribensis]
 gb|ETY81482.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Burkholderia 
caribensis MBA4]
Length=456

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ P+VIE+ EG YVYD  G +YL+ L GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGNRYLEGLGGLFCASLGFSETRLADAADRQ  72

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F +++++PS+ LA++L+       M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  627  LGRP  638
            +GRP
Sbjct  132  IGRP  135



>ref|WP_040121086.1| aminotransferase [Sinorhizobium meliloti]
 gb|AIM03675.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            ++ P+T      +  P VI   +G YV D +GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDHGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL T+PFYHSF +++T+P + LA++LL T     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-TIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  624  ALGRP  638
            ALGRP
Sbjct  135  ALGRP  139



>gb|ABD06201.1| aminotransferase [Rhodopseudomonas palustris HaA2]
Length=463

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +  P+T   Q   + P+VIE+ EG +VYD NG++YL++LAGLW  A+G  EPRLV+AA K
Sbjct  18   LFHPYTNPRQHEQVGPVVIERGEGVFVYDTNGQRYLEALAGLWSVAVGFGEPRLVEAAAK  77

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q++ LPFYH F +++  P + LA +L       +++   F+NSGSEAND+ VKLVW+YNN
Sbjct  78   QMSMLPFYHLFAHKSHSPGIRLADKLC-AMAPGQLSHVLFSNSGSEANDSVVKLVWFYNN  136

Query  624  ALGRP  638
            +LGRP
Sbjct  137  SLGRP  141



>ref|WP_025165321.1| aminotransferase [Pseudomonas taeanensis]
 gb|KFX70067.1| aminotransferase [Pseudomonas taeanensis MS-3]
Length=455

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ PL+IE+ EG YVYD  GK Y++++AGLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTNARLHQEVGPLIIERGEGIYVYDDQGKGYIEAMAGLWSAALGFSNQRLIKAAEQQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            LNTLPFYH F +++ +PS++LA++L++      M+K FFTNSGSEANDT VK+VWY NNA
Sbjct  77   LNTLPFYHLFSHKSHRPSIELAEKLIE-MAPVPMSKVFFTNSGSEANDTVVKMVWYLNNA  135

Query  627  LGRP  638
             G P
Sbjct  136  RGLP  139



>ref|WP_044033419.1| aminotransferase [Roseobacter denitrificans]
Length=454

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            P+VIE+ EG YV+D  GK+Y++ +AGLW  A+G NE RLVDAA  Q+  LP+YHSF +++
Sbjct  31   PMVIERGEGVYVFDNQGKRYIEGMAGLWSVAVGFNESRLVDAAQNQMRALPYYHSFSHKS  90

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
              P++DLA+ L+D     +M+K FFTNSGSEANDT +K++WY +NALG+P
Sbjct  91   HGPAIDLAERLID-MAPVQMSKVFFTNSGSEANDTILKMIWYRSNALGKP  139



>gb|ABG31913.1| aminotransferase [Roseobacter denitrificans OCh 114]
Length=452

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 85/110 (77%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            P+VIE+ EG YV+D  GK+Y++ +AGLW  A+G NE RLVDAA  Q+  LP+YHSF +++
Sbjct  29   PMVIERGEGVYVFDNQGKRYIEGMAGLWSVAVGFNESRLVDAAQNQMRALPYYHSFSHKS  88

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
              P++DLA+ L+D     +M+K FFTNSGSEANDT +K++WY +NALG+P
Sbjct  89   HGPAIDLAERLID-MAPVQMSKVFFTNSGSEANDTILKMIWYRSNALGKP  137



>gb|EWM49408.1| aminotransferase class-III family protein [Bordetella holmesii 
35009]
Length=515

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +   + P +I + EG YVYD  G +YL+ +AGLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAIKHAQVGPRIITRGEGIYVYDDKGNRYLEGMAGLWSVAVGFGEPRLVDAATRQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++    ++L++ L+  +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSERLIG-YTEGRMAQAFFTNSGSEANDTVVKLVWYYNNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_018430650.1| hypothetical protein [Hoeflea sp. 108]
Length=460

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +  ++ P+V+++ EG YV+D  G +Y++ LAGLW  A+G  E RLV AA KQ
Sbjct  16   LHPYTNAVRHAEIGPIVMDRGEGIYVFDDQGNRYIEGLAGLWSVAVGFGEKRLVAAATKQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L+ LP+YH+F +++  PS++LA++L +      ++  FFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LDKLPYYHTFAHKSHMPSIELAEKLAE-MAPEGLSHVFFTNSGSEANDTIVKLVWYYNNA  134

Query  627  LGRP  638
            LGRP
Sbjct  135  LGRP  138



>ref|WP_028793896.1| aminotransferase [Thalassobaculum salexigens]
Length=460

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T      +  P++I K +G YVYD  GK+YL+++AGLWC +LG NE RLV AA K
Sbjct  16   VLHPYTNARAHEENGPMIITKGDGVYVYDDGGKQYLEAMAGLWCASLGFNENRLVKAATK  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL TLP+YH+F ++   P +DLA++L++      M+K FF  SGSEANDT +KLVWYYNN
Sbjct  76   QLETLPYYHTFAHKAHLPGIDLAEKLIN-LAPVPMSKVFFAGSGSEANDTAMKLVWYYNN  134

Query  624  ALGR  635
            A GR
Sbjct  135  ARGR  138



>ref|WP_043209568.1| aminotransferase [Bordetella hinzii]
 gb|KCB38207.1| aminotransferase, class III [Bordetella hinzii 8-296-03]
Length=457

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +   + P ++ + EG YVYD  G +YL+ ++GLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAVKHAQVGPRIMTRGEGIYVYDDKGNRYLEGMSGLWSVAVGFGEPRLVDAAARQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LP+YH+F +++    ++L++ L+D +T  +MA+AFFTNSGSEANDT VKLVWYY+NA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSQRLID-YTEGRMARAFFTNSGSEANDTVVKLVWYYSNA  134

Query  627  LGR  635
            LGR
Sbjct  135  LGR  137



>ref|WP_020949918.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Paracoccus 
aminophilus]
 gb|AGT08280.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Paracoccus 
aminophilus JCM 7686]
Length=459

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T   +   + P+V+E+ EG YVYD  G +Y++ LAGLW   +G  E RLV+AA KQ
Sbjct  16   LHPYTNAIRHESVGPIVMERGEGIYVYDDQGNRYIEGLAGLWSVGVGFGEKRLVEAARKQ  75

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L+ LPFYH+F +++  P+++LA +L +  T   +   FFTNSGSE NDT +K+VWYYNNA
Sbjct  76   LDALPFYHTFAHKSNGPAIELAAKLAE-ITPEGLNHVFFTNSGSEGNDTVIKIVWYYNNA  134

Query  627  LGRP  638
            LGRP
Sbjct  135  LGRP  138



>ref|WP_039191434.1| aminotransferase [Aureimonas altamirensis]
 gb|KHJ54651.1| aminotransferase [Aureimonas altamirensis]
Length=462

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P T   +  +  P+VI++ EG YV+D  GK+Y++++AGLW  A+G  E R+ DAA  
Sbjct  17   ILHPVTNARRHEETGPIVIDRGEGIYVFDDQGKQYIEAMAGLWSVAVGFGEKRIADAAYA  76

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL  LP+YH+F ++T +PS+DLA+ L+   T   + + FFTNSGSEANDT VKL+WYYNN
Sbjct  77   QLQKLPYYHTFSHKTNEPSVDLAETLVK-MTPASVNRVFFTNSGSEANDTVVKLIWYYNN  135

Query  624  ALGRP  638
            A GRP
Sbjct  136  ARGRP  140



>ref|WP_029742660.1| aminotransferase [Ensifer sp. JGI 0001011-A08]
Length=461

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LIHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL T+PFYHSF +++T+P + LA++LL+      M+K F   SGSEANDT +KLVWYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVFLAGSGSEANDTAIKLVWYYNN  134

Query  624  ALGRP  638
            A+GRP
Sbjct  135  AVGRP  139



>ref|WP_023663383.1| aminotransferase [Pseudomonas taiwanensis]
 gb|ESW36345.1| aminotransferase [Pseudomonas taiwanensis SJ9]
Length=459

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      D+ PL+I++ EG YV+D+ GK+Y+++++GLW  ALG +  RLV AA +Q
Sbjct  17   LHPYTDARLHQDVGPLIIDRGEGVYVFDVEGKRYIEAMSGLWSVALGFSNERLVKAAEQQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   MRKLPFYHIFTHKGHGPSIELAEKLIE-IAPVPMSKVFFTNSGSEANDTVVKMIWYRNNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGKP  139



>ref|WP_018904326.1| aminotransferase [Variovorax paradoxus]
Length=455

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            P+VI K EG YVYD  G KYL+++AGL+C +LG +  RL DAA +Q+  LPFYHSF ++ 
Sbjct  30   PMVITKGEGVYVYDDKGNKYLEAMAGLFCASLGFSNSRLADAADRQMRQLPFYHSFGHKA  89

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             +PS+ LA++LL       M+K FF NSGSEANDT VKLVWYYNNA+GRP
Sbjct  90   NEPSIRLAEKLL-AMAPVPMSKVFFANSGSEANDTAVKLVWYYNNAVGRP  138



>ref|WP_041710497.1| aminotransferase [Advenella kashmirensis]
Length=456

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +3

Query  216  SVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  395
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  4    SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  59

Query  396  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  575
             A+G +E RLVDAAM+Q+ TLPFYH F ++T + ++  AK L+D      M+K FFTNSG
Sbjct  60   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHEAAVRFAKTLID-LAPVPMSKVFFTNSG  118

Query  576  SEANDTXVKLVWYYNNALGRP  638
            SEANDT +KL+WY +NALG+P
Sbjct  119  SEANDTVMKLLWYRSNALGQP  139



>ref|WP_028003714.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            ++ P+T      +  P VI   +G YV D +GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDDGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL  +PFYHSF +++T+P + LA++LL T     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKAMPFYHSFAHKSTEPGIRLAEKLL-TIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  624  ALGRP  638
            ALGRP
Sbjct  135  ALGRP  139



>ref|WP_017128138.1| hypothetical protein [Pseudomonas gingeri]
Length=456

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ PL+IE+ EG +V+D +GK Y++++AGLW  ALG +  RLV AA KQ
Sbjct  17   LHPYTNARAHQEVGPLIIERGEGVFVFDEDGKPYIEAMAGLWSAALGFSNKRLVAAAEKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            ++TLPFYH F +++  PS+ LA++L+D      M+K FFTNSGSEANDT +KLVWY NNA
Sbjct  77   MSTLPFYHLFGHKSHSPSIQLAEKLID-MAPVPMSKVFFTNSGSEANDTVIKLVWYLNNA  135

Query  627  LGRP  638
             G+P
Sbjct  136  QGKP  139



>ref|WP_018010394.1| aminotransferase [Sinorhizobium medicae]
Length=461

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AAM+
Sbjct  16   LVHPYTNLAVHQETGPHVISGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  624  ALGRP  638
            ALGRP
Sbjct  135  ALGRP  139



>gb|AFK64419.1| aminotransferase [Advenella kashmirensis WT001]
Length=514

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +3

Query  216  SVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  395
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  62   SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  117

Query  396  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  575
             A+G +E RLVDAAM+Q+ TLPFYH F ++T + ++  AK L+D      M+K FFTNSG
Sbjct  118  VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHEAAVRFAKTLID-LAPVPMSKVFFTNSG  176

Query  576  SEANDTXVKLVWYYNNALGRP  638
            SEANDT +KL+WY +NALG+P
Sbjct  177  SEANDTVMKLLWYRSNALGQP  197



>ref|WP_025374662.1| aminotransferase [Advenella mimigardefordensis]
 gb|AHG65965.1| aminotransferase [Advenella mimigardefordensis DPN7]
Length=456

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 92/141 (65%), Gaps = 5/141 (4%)
 Frame = +3

Query  216  SVQNDSTDEKGFXGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  395
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  4    SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  59

Query  396  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  575
             A+G +E RLVDAAM+Q+ TLPFYH F ++T   ++  AK L+D      M+K FFTNSG
Sbjct  60   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHDAAVRFAKTLID-LAPVPMSKVFFTNSG  118

Query  576  SEANDTXVKLVWYYNNALGRP  638
            SEANDT +KLVWY +NALG P
Sbjct  119  SEANDTVMKLVWYRSNALGLP  139



>ref|WP_011969374.1| aminotransferase [Sinorhizobium medicae]
 ref|YP_001312484.1| aminotransferase [Sinorhizobium medicae WSM419]
 gb|ABR62551.1| aminotransferase class-III [Sinorhizobium medicae WSM419]
Length=461

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AAM+
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  624  ALGRP  638
            ALGRP
Sbjct  135  ALGRP  139



>dbj|GAK69890.1| putative aminotransferase [Rhizobium rubi NBRC 13261]
Length=460

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +3

Query  309  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  488
            PLVIE+ EG  VYD  GK+Y++ LAGLW  A+G +EPRL +AA KQ+  LP+YH+F +++
Sbjct  31   PLVIERGEGIRVYDDRGKEYIEGLAGLWSVAVGFSEPRLAEAAYKQMLKLPYYHTFSSKS  90

Query  489  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             +PS+ LA++L++   AN + +AFFT+SGSEANDT VK+VWY NNALGRP
Sbjct  91   HEPSIRLAEKLVEMTPAN-ITRAFFTSSGSEANDTIVKMVWYMNNALGRP  139



>ref|WP_026616781.1| aminotransferase [Ensifer sp. TW10]
Length=460

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   Q     PLVI K EG Y+ D +G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISKGEGIYIIDSDGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYHSF  ++ + +++LA++L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAEQLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  624  ALGRP  638
            A+G+P
Sbjct  135  AIGKP  139



>ref|WP_038761742.1| aminotransferase [Burkholderia pseudomallei]
Length=459

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = +3

Query  276  FTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNT  455
            +T   Q     PLVI++ EG YV+D  G++Y++++AGLW  A+G NEPRLV AA +Q+  
Sbjct  24   YTDAAQNVKTGPLVIDRGEGVYVFDNQGRRYIEAMAGLWSAAVGFNEPRLVRAATRQMEK  83

Query  456  LPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGR  635
            LPFYH+F +++  P +DLA++L+ +     M+K FFTNSGSEANDT +KL+WY +NALG+
Sbjct  84   LPFYHTFSHKSHGPLVDLAEKLV-SMAPVPMSKVFFTNSGSEANDTALKLIWYRSNALGQ  142

Query  636  P  638
            P
Sbjct  143  P  143



>ref|WP_008069788.1| aminotransferase [Pseudomonas sp. GM79]
 gb|EJN25472.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Pseudomonas 
sp. GM79]
Length=460

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ PLVIE+ EG YVYD  GK+Y+++++GLW  ALG N  RL+ AA KQ
Sbjct  17   LHPYTDARMHEEIGPLVIERGEGIYVYDDQGKQYIEAMSGLWSAALGFNNERLIKAAEKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L TLPFYH+F ++T   S+ LA EL+       M+K FFTNSGSEANDT VKL+WY NNA
Sbjct  77   LRTLPFYHTFNHKTHASSVLLADELI-RLAPVPMSKVFFTNSGSEANDTIVKLIWYRNNA  135

Query  627  LGR  635
            +G+
Sbjct  136  IGK  138



>ref|WP_027517565.1| aminotransferase [Bradyrhizobium sp. WSM1417]
Length=460

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+   +   M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALSPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_027569703.1| aminotransferase [Bradyrhizobium sp. URHA0013]
Length=460

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+   +   M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALSPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_007591914.1| aminotransferase [Bradyrhizobium sp. WSM1253]
 gb|EIG56562.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. WSM1253]
Length=460

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_025035884.1| aminotransferase [Bradyrhizobium sp. DOA9]
 dbj|GAJ34911.1| probable aminotransferase Y4UB [Bradyrhizobium sp. DOA9]
Length=460

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAYKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_008129949.1| aminotransferase [Bradyrhizobium sp. YR681]
 gb|EJN16031.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. YR681]
Length=460

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_007609403.1| aminotransferase [Bradyrhizobium sp. WSM471]
 gb|EHR02897.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. WSM471]
Length=460

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_042133140.1| aminotransferase [Pseudomonas oryzihabitans]
Length=458

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      D  P++IE+ EG +VYD  GK+Y+++++GLW  ALG N  RL+DAA  Q
Sbjct  17   LHPYTNARLHQDTGPMIIERGEGVHVYDTQGKQYIEAMSGLWSVALGFNNQRLIDAATAQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   LQQLPFYHLFSHKAHAPSIELAEKLIE-IAPVPMSKVFFTNSGSEANDTVVKMLWYRNNA  135

Query  627  LGR  635
            LG+
Sbjct  136  LGK  138



>ref|WP_036350477.1| aminotransferase [Microvirga sp. BSC39]
 gb|KFG69342.1| aminotransferase [Microvirga sp. BSC39]
Length=462

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P T   +  ++ P+VI++ EG YVYD  G +YL++LAGLW  A+G  E RLV+AA +
Sbjct  16   VLHPVTNARKHEEIGPIVIDRGEGIYVYDDQGNRYLEALAGLWSVAVGFGEKRLVEAAAR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LP+YH+F ++T +PS+ LA+ L+   T +++ +AFFTNSGSEAND+ +K+VWYYNN
Sbjct  76   QMAKLPYYHTFSHKTNEPSVLLAERLV-RMTPDRLKRAFFTNSGSEANDSVIKMVWYYNN  134

Query  624  ALG  632
            A G
Sbjct  135  ARG  137



>ref|WP_018456285.1| aminotransferase [Bradyrhizobium sp. WSM4349]
Length=460

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_027542945.1| aminotransferase [Bradyrhizobium sp. WSM2254]
Length=460

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_028055523.1| aminotransferase [Sinorhizobium meliloti]
Length=463

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PL++++ EG YVYDING++Y++S AGLW  A+G +EPRLV+AA KQ
Sbjct  20   LHPYTNARLHETKGPLIMDRGEGIYVYDINGRQYIESFAGLWSVAIGFSEPRLVEAATKQ  79

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F + + +P++ LA++L++  +  ++ +  FTNSGSEANDT VK+VWY NNA
Sbjct  80   MQKLPFYHTFNHMSHEPNIRLAEKLVE-ISPEQITRVSFTNSGSEANDTVVKMVWYVNNA  138

Query  627  LGRP  638
             G+P
Sbjct  139  RGKP  142



>ref|WP_027283997.1| aminotransferase [Rubritepida flocculans]
Length=463

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T         PLVI + EG  V+D  GK Y++++AGLWC ALG +  RLV+AA +
Sbjct  16   VLHPYTDARAHQKNGPLVITRGEGVRVFDEQGKGYIETVAGLWCAALGFHNERLVEAAAR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYH F  RT +P ++LA+ LL+      M+K FF NSGSEAND+ VK++WY+NN
Sbjct  76   QMRQLPFYHGFTGRTHEPQVELAEMLLER-APVPMSKVFFANSGSEANDSAVKMIWYFNN  134

Query  624  ALGRP  638
            ALGRP
Sbjct  135  ALGRP  139



>ref|WP_022729947.1| aminotransferase [Fodinicurvata sediminis]
Length=462

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +  +  PL+++  +G +VYD  GK Y++ + GLWC ALG  E RLV AA +Q
Sbjct  17   LHAYTNARRHEETGPLIVDHGKGVHVYDDQGKDYIEGMGGLWCVALGFGEERLVKAATEQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LP+YHSF  ++ +PS++L++ LLD      ++K F+ NSGSEANDT VKLVWYYNNA
Sbjct  77   MQRLPYYHSFAQKSHEPSIELSERLLD-MAPGDLSKVFYANSGSEANDTVVKLVWYYNNA  135

Query  627  LGRP  638
            LGRP
Sbjct  136  LGRP  139



>gb|EJZ32369.1| aminotransferase [Bradyrhizobium sp. CCGE-LA001]
Length=458

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  15   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  74

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  75   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  133

Query  627  LGRP  638
            LG+P
Sbjct  134  LGQP  137



>ref|WP_036349682.1| aminotransferase [Microvirga lupini]
Length=462

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 90/125 (72%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P T      ++ P+VI++ EG YVYD  G +Y+++LAGLW  A+G  E RL DAA +
Sbjct  16   VLHPVTNARNHEEIGPVVIDRGEGIYVYDDQGNRYIEALAGLWSVAVGFGEKRLADAATR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LP+YH+F ++T +PS+ LA+ L+   T +++ +AFFTNSGSEAND+ +K+VWYYNN
Sbjct  76   QMAKLPYYHTFSHKTNEPSVLLAERLV-KMTPDRLKRAFFTNSGSEANDSVIKMVWYYNN  134

Query  624  ALGRP  638
            A G P
Sbjct  135  ARGLP  139



>emb|CCF21345.1| Uncharacterized aminotransferase y4uB [Rhizobium sp.]
Length=452

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  312  LVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTT  491
            LVI++ EG YVYD NGK+Y+++++GLW  A+G  E RLVDAA++Q++ LP+YH+F  RT 
Sbjct  32   LVIDRGEGVYVYDNNGKRYIEAMSGLWSVAVGFGEQRLVDAAVRQMSILPYYHTFTGRTH  91

Query  492  KPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             PS+DLA++L+       M+K +FTNSGSEANDT +K+VWY +NALG+P
Sbjct  92   GPSVDLAEKLIQ-MAPVPMSKVYFTNSGSEANDTAMKIVWYRSNALGKP  139



>ref|WP_036022740.1| aminotransferase [Bradyrhizobium yuanmingense]
Length=460

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_036000540.1| aminotransferase [Bradyrhizobium yuanmingense]
Length=460

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_034858533.1| aminotransferase [Ensifer sojae]
Length=461

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   Q     PLVI K EG Y+ D  G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISKGEGIYIIDSEGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYHSF  ++ + +++LA+ L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAERLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  624  ALGRP  638
            A+G+P
Sbjct  135  AIGKP  139



>ref|WP_018317519.1| aminotransferase [Bradyrhizobium sp. WSM2793]
Length=460

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_016494812.1| putative aminotransferase [Pseudomonas resinovorans]
 dbj|BAN50684.1| putative aminotransferase [Pseudomonas resinovorans NBRC 106553]
Length=463

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ PL+IE+ EG YV+D  GK+YL++++GLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTDARLHQEIGPLIIERGEGVYVFDDQGKRYLEAMSGLWSVALGFSNERLIKAAEQQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LPFYH F ++   PS++LA +L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   LRKLPFYHLFSHKAHAPSIELADKLIE-LAPVPMSKVFFTNSGSEANDTVVKMIWYRNNA  135

Query  627  LGRP  638
            +G+P
Sbjct  136  IGKP  139



>ref|WP_023628464.1| aminotransferase [Pseudomonas mosselii]
 gb|AIN61261.1| aminotransferase [Pseudomonas mosselii SJ10]
Length=459

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ PL+I++ EG YVYD  GK+Y+++++GLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTDARLHQEVGPLIIDRGEGVYVYDDRGKRYIEAMSGLWSVALGFSNERLIKAAEQQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VKL+WY NNA
Sbjct  77   LRKLPFYHIFTHKAHAPSIELAEKLVE-LAPVPMSKVFFTNSGSEANDTVVKLIWYRNNA  135

Query  627  LGRP  638
            +G+P
Sbjct  136  IGKP  139



>ref|WP_023002240.1| MULTISPECIES: aminotransferase [Labrenzia]
 gb|ERP88844.1| aminotransferase [Labrenzia sp. C1B10]
 gb|ERP99209.1| aminotransferase [Labrenzia sp. C1B70]
Length=450

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 85/109 (78%), Gaps = 1/109 (1%)
 Frame = +3

Query  312  LVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTT  491
            LVIEK EG YV DINGK+Y++ +AGLW  A+G  E RLVDAA +Q+  LP+YH+F  ++ 
Sbjct  32   LVIEKGEGIYVEDINGKRYIEGMAGLWSVAVGFGEKRLVDAAARQMEKLPYYHTFTYKSH  91

Query  492  KPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
             PS++LA++L++      M+KA+FTNSGSEANDT +KL+WY +NALG+P
Sbjct  92   GPSIELAEKLVE-MAPVPMSKAYFTNSGSEANDTAIKLIWYRSNALGQP  139



>ref|WP_035675727.1| aminotransferase [Bradyrhizobium liaoningense]
Length=460

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDATGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_037395619.1| aminotransferase [Sinorhizobium fredii]
Length=461

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   Q     PLVI + EG Y+ D +G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISRGEGIYIVDSDGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYHSF  ++ + +++LA+ L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAERLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  624  ALGRP  638
            A+G+P
Sbjct  135  AIGKP  139



>ref|WP_036995912.1| aminotransferase [Pseudomonas sp. P482]
 gb|KDN99130.1| aminotransferase class-III family protein [Pseudomonas sp. P482]
Length=457

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L PFT         PL+IE+ EG +VYD   K+Y+++++GLW  ALG +  RL++AA KQ
Sbjct  14   LHPFTDARLHEADGPLIIERGEGVHVYDNQNKRYIEAMSGLWSVALGFSNQRLIEAAEKQ  73

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L TLPFYH F ++  +PS++LA++L++      M+K FFTNSGSEANDT VKL+WY NNA
Sbjct  74   LRTLPFYHVFSSKAHRPSIELAEKLVE-MAPVPMSKVFFTNSGSEANDTVVKLLWYRNNA  132

Query  627  LGRP  638
            LG+P
Sbjct  133  LGKP  136



>ref|WP_033067194.1| aminotransferase [Thalassospira australica]
Length=456

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (71%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         P +I   +G YV D  G K ++ +AGLWC +LG +E RLVDAA KQ
Sbjct  19   LHPYTNHAAHEKTGPHIITGGDGIYVTDDQGHKLIEGMAGLWCASLGFSEKRLVDAATKQ  78

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            LNTLP+YH+F +R+T P++DLA++LL+   A  M+K FF NSGSEA D+ VK+VWYY+NA
Sbjct  79   LNTLPYYHTFASRSTNPAIDLAEKLLEIVPA-PMSKVFFANSGSEATDSAVKMVWYYHNA  137

Query  627  LGRP  638
            +G+P
Sbjct  138  IGQP  141



>ref|WP_037434041.1| aminotransferase [Sinorhizobium fredii]
Length=461

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   Q     PLVI + EG Y+ D +G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISRGEGIYIVDSDGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYHSF  ++ + +++LA+ L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAERLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  624  ALGRP  638
            A+G+P
Sbjct  135  AIGKP  139



>ref|WP_042778065.1| aminotransferase [Sinorhizobium fredii]
Length=461

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 88/125 (70%), Gaps = 1/125 (1%)
 Frame = +3

Query  264  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  443
            +L P+T   Q     PLVI + EG Y+ D +G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISRGEGIYIIDSDGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  444  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNN  623
            Q+  LPFYHSF  ++ + +++LA+ L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAERLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  624  ALGRP  638
            A+G+P
Sbjct  135  AIGKP  139



>gb|EGD57468.1| aminotransferase [Novosphingobium nitrogenifigens DSM 19370]
Length=465

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +3

Query  303  LHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWN  482
            + P++I++ EG YVYD  G+ Y++++AGLW  ALG +E RLV+AA  Q+  LPFYHSF +
Sbjct  34   IGPMIIDRGEGVYVYDNEGRPYIEAMAGLWSVALGFSEERLVEAAATQMRRLPFYHSFTH  93

Query  483  RTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            ++  P +DLA++L+ T     M+KAFFTNSGSEANDT +K+VWY +NALG+P
Sbjct  94   KSHGPMIDLAEKLV-TMCPGNMSKAFFTNSGSEANDTAMKMVWYRSNALGKP  144



>ref|WP_036500215.1| aminotransferase [Novosphingobium nitrogenifigens]
Length=461

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +3

Query  303  LHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWN  482
            + P++I++ EG YVYD  G+ Y++++AGLW  ALG +E RLV+AA  Q+  LPFYHSF +
Sbjct  30   IGPMIIDRGEGVYVYDNEGRPYIEAMAGLWSVALGFSEERLVEAAATQMRRLPFYHSFTH  89

Query  483  RTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            ++  P +DLA++L+ T     M+KAFFTNSGSEANDT +K+VWY +NALG+P
Sbjct  90   KSHGPMIDLAEKLV-TMCPGNMSKAFFTNSGSEANDTAMKMVWYRSNALGKP  140



>ref|WP_036993733.1| aminotransferase, partial [Pseudomonas pseudoalcaligenes]
Length=453

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 89/124 (72%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T      ++ PL+IE+ EG YV+D  GK+Y+++++GLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTDARVHQEVGPLIIERGEGVYVFDDQGKRYVEAMSGLWSVALGFSNERLIKAAEQQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            L  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   LRKLPFYHLFSHKAHSPSIELAEKLIE-IAPVPMSKVFFTNSGSEANDTVVKMIWYRNNA  135

Query  627  LGRP  638
            +G+P
Sbjct  136  IGKP  139



>ref|WP_027557626.1| MULTISPECIES: aminotransferase [Bradyrhizobium]
Length=460

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAAGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_035715448.1| aminotransferase [Bradyrhizobium sp. CCBAU 43298]
Length=460

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAAGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVTMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_035675507.1| aminotransferase [Azospirillum brasilense]
Length=466

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = +3

Query  297  TDLH------PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTL  458
            T+LH      PL+IE+ EG  V+D +GK+Y++ LA LWC +LG  E RLV+AA +Q+  L
Sbjct  31   TNLHAHETQGPLIIERGEGVRVFDDSGKEYIEGLASLWCVSLGWGEERLVEAATRQMRKL  90

Query  459  PFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            P YH F +++ +P +DLA+ L+       M+K FF NSGSEANDT VKLVWYYNNALGRP
Sbjct  91   PTYHVFGHKSHEPGIDLAERLIK-LAPVPMSKVFFANSGSEANDTAVKLVWYYNNALGRP  149



>ref|WP_019171585.1| aminotransferase [Pseudaminobacter salicylatoxidans]
Length=456

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 91/124 (73%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L  +T   +  +  PL+IEK EG YV D +GK+Y++++AGLW  A+G +E RLVDAA KQ
Sbjct  17   LHAYTNARRHQEAGPLIIEKGEGIYVEDNSGKRYIEAMAGLWSVAVGFSEQRLVDAATKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            ++ LP+YHSF ++   P +DLA++L+       M+KAFFTNSGSEANDT +K++WY +NA
Sbjct  77   MSKLPYYHSFTHKAHSPLIDLAEKLVQ-MAPVPMSKAFFTNSGSEANDTAMKMIWYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_014239351.1| aminotransferase [Azospirillum brasilense]
 emb|CCC97045.1| putative aminotransferase [Azospirillum brasilense Sp245]
Length=471

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 7/120 (6%)
 Frame = +3

Query  297  TDLH------PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTL  458
            T+LH      PL+IE+ EG  V+D +GK+Y++ LA LWC +LG  E RLV+AA +Q+  L
Sbjct  36   TNLHAHETQGPLIIERGEGVRVFDDSGKEYIEGLASLWCVSLGWGEERLVEAATRQMRKL  95

Query  459  PFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGRP  638
            P YH F +++ +P +DLA+ L+       M+K FF NSGSEANDT VKLVWYYNNALGRP
Sbjct  96   PTYHVFGHKSHEPGIDLAERLIK-LAPVPMSKVFFANSGSEANDTAVKLVWYYNNALGRP  154



>ref|WP_027551405.1| aminotransferase [Bradyrhizobium sp. Cp5.3]
Length=460

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA +Q
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDATGKRYFEAMAGLWSVGLGFNEKRLVEAAYRQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



>ref|WP_026226723.1| aminotransferase [Hoeflea sp. 108]
Length=456

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 91/121 (75%), Gaps = 1/121 (1%)
 Frame = +3

Query  276  FTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNT  455
            +T   +  ++ PL+IEK +G YV DI+GK+Y+++++GLW   +G +E RLVDAA +Q+  
Sbjct  20   YTNARRHQEVGPLIIEKGDGIYVEDISGKRYIEAMSGLWSVGVGFSEQRLVDAATRQMAK  79

Query  456  LPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNALGR  635
            LPFYH+F ++   P +DLA++L+ T     M+KAFFTNSGSEANDT +K++WY +NALG+
Sbjct  80   LPFYHNFTHKGHSPVIDLAEKLV-TMAPVPMSKAFFTNSGSEANDTAMKMIWYRSNALGQ  138

Query  636  P  638
            P
Sbjct  139  P  139



>ref|WP_028181072.1| aminotransferase [Bradyrhizobium japonicum]
Length=460

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  267  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  446
            L P+T         PLVIE+ EG YV+D  GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARTHQQAGPLVIERGEGPYVFDAMGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  447  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTXVKLVWYYNNA  626
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  627  LGRP  638
            LG+P
Sbjct  136  LGQP  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125