BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034C17

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594051.1|  PREDICTED: formin-binding protein 4 isoform X1     132   2e-31   Nicotiana tomentosiformis
emb|CDP13682.1|  unnamed protein product                              85.1    4e-20   Coffea canephora [robusta coffee]
ref|XP_006474824.1|  PREDICTED: uncharacterized protein LOC102615131  85.9    1e-17   
ref|XP_010675976.1|  PREDICTED: uncharacterized protein LOC104891889  77.4    7e-15   
ref|XP_009594052.1|  PREDICTED: formin-binding protein 4 isoform X2   76.6    2e-12   Nicotiana tomentosiformis
ref|XP_009759139.1|  PREDICTED: formin-binding protein 4 isoform X1   76.6    2e-12   Nicotiana sylvestris
ref|XP_008219444.1|  PREDICTED: uncharacterized protein LOC103319651  70.5    3e-12   
ref|XP_006352638.1|  PREDICTED: formin-binding protein 4-like         72.8    3e-11   Solanum tuberosum [potatoes]
ref|XP_004248291.1|  PREDICTED: formin-binding protein 4 isoform X1   70.9    1e-10   Solanum lycopersicum
gb|EYU27457.1|  hypothetical protein MIMGU_mgv1a017415mg              62.0    2e-09   Erythranthe guttata [common monkey flower]
gb|KFK38659.1|  hypothetical protein AALP_AA3G143500                  66.6    3e-09   Arabis alpina [alpine rockcress]
ref|XP_007208104.1|  hypothetical protein PRUPE_ppa001027mg           66.2    4e-09   
ref|XP_008344741.1|  PREDICTED: uncharacterized protein LOC103407619  63.9    1e-08   
emb|CBI39790.3|  unnamed protein product                              64.7    1e-08   Vitis vinifera
ref|XP_011095580.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  64.3    1e-08   
ref|XP_002532512.1|  conserved hypothetical protein                   62.8    5e-08   Ricinus communis
ref|XP_008384608.1|  PREDICTED: formin-binding protein 4              61.6    1e-07   
ref|XP_008358896.1|  PREDICTED: formin-binding protein 4-like         61.6    1e-07   
ref|XP_011038872.1|  PREDICTED: uncharacterized protein LOC105135...  61.6    1e-07   Populus euphratica
ref|XP_010487073.1|  PREDICTED: formin-binding protein 4-like         61.2    1e-07   Camelina sativa [gold-of-pleasure]
gb|KDP32612.1|  hypothetical protein JCGZ_13162                       60.8    2e-07   Jatropha curcas
ref|NP_001154613.1|  WW domain-containing protein                     60.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43359.1|  BnaA01g29900D                                        60.5    3e-07   Brassica napus [oilseed rape]
dbj|BAB03122.1|  unnamed protein product                              60.5    3e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274244.1|  PREDICTED: uncharacterized protein LOC104609...  59.7    4e-07   Nelumbo nucifera [Indian lotus]
gb|EPS69240.1|  hypothetical protein M569_05528                       55.1    6e-07   Genlisea aurea
ref|XP_006296954.1|  hypothetical protein CARUB_v10012949mg           58.9    8e-07   Capsella rubella
ref|XP_007140124.1|  hypothetical protein PHAVU_008G086000g           58.5    1e-06   Phaseolus vulgaris [French bean]
ref|XP_010465143.1|  PREDICTED: formin-binding protein 4-like iso...  58.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009367261.1|  PREDICTED: formin-binding protein 4 isoform X1   58.2    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_010255737.1|  PREDICTED: formin-binding protein 4-like iso...  57.4    3e-06   Nelumbo nucifera [Indian lotus]
gb|KFK38660.1|  hypothetical protein AALP_AA3G143500                  57.0    4e-06   Arabis alpina [alpine rockcress]
ref|XP_006586154.1|  PREDICTED: uncharacterized protein LOC100791...  56.2    8e-06   Glycine max [soybeans]
ref|XP_010418959.1|  PREDICTED: uncharacterized protein LOC104704597  55.8    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010103959.1|  Formin-binding protein 4                         55.5    1e-05   
ref|XP_004294901.2|  PREDICTED: formin-binding protein 4 isoform X1   55.1    2e-05   Fragaria vesca subsp. vesca
ref|XP_010061424.1|  PREDICTED: uncharacterized protein LOC104449...  54.7    2e-05   Eucalyptus grandis [rose gum]
ref|XP_010928058.1|  PREDICTED: uncharacterized protein LOC105049...  54.7    2e-05   Elaeis guineensis
ref|XP_003600395.1|  hypothetical protein MTR_3g060710                54.7    2e-05   
ref|XP_010061426.1|  PREDICTED: uncharacterized protein LOC104449...  54.7    2e-05   Eucalyptus grandis [rose gum]
ref|XP_009759140.1|  PREDICTED: formin-binding protein 4 isoform X2   54.7    2e-05   Nicotiana sylvestris
ref|XP_009387309.1|  PREDICTED: protein piccolo isoform X1            54.3    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004149420.1|  PREDICTED: uncharacterized protein LOC101219916  53.9    4e-05   Cucumis sativus [cucumbers]
ref|XP_008800273.1|  PREDICTED: uncharacterized protein LOC103714...  53.9    4e-05   Phoenix dactylifera
ref|XP_004167069.1|  PREDICTED: uncharacterized protein LOC101223441  53.9    5e-05   
ref|XP_008463033.1|  PREDICTED: flocculation protein FLO11 isofor...  53.1    7e-05   Cucumis melo [Oriental melon]
ref|XP_007020417.1|  WW domain-containing protein, putative isofo...  53.1    8e-05   
ref|XP_007020416.1|  WW domain-containing protein, putative isofo...  53.1    8e-05   
ref|XP_007020414.1|  WW domain-containing protein, putative isofo...  52.8    9e-05   
ref|XP_006370019.1|  hypothetical protein POPTR_0001s38050g           52.8    9e-05   
ref|XP_002300398.2|  hypothetical protein POPTR_0001s38050g           52.8    9e-05   
ref|XP_007020418.1|  WW domain-containing protein, putative isofo...  52.8    9e-05   
emb|CDY23203.1|  BnaA04g05560D                                        52.4    1e-04   Brassica napus [oilseed rape]
ref|XP_009124730.1|  PREDICTED: formin-binding protein 4 isoform X2   52.4    1e-04   
ref|XP_009124729.1|  PREDICTED: formin-binding protein 4 isoform X1   52.4    1e-04   Brassica rapa
emb|CDY24199.1|  BnaC01g37790D                                        51.6    2e-04   Brassica napus [oilseed rape]
ref|XP_004498164.1|  PREDICTED: uncharacterized protein LOC101511...  50.8    4e-04   Cicer arietinum [garbanzo]
ref|XP_004498163.1|  PREDICTED: uncharacterized protein LOC101511...  50.8    5e-04   
ref|XP_010644625.1|  PREDICTED: uncharacterized protein LOC100249...  50.8    5e-04   Vitis vinifera



>ref|XP_009594051.1| PREDICTED: formin-binding protein 4 isoform X1 [Nicotiana tomentosiformis]
Length=928

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 84/122 (69%), Gaps = 1/122 (1%)
 Frame = +3

Query  315  ILVEIIDFLCTRHVVCSTKDYVFSL*PGCGIGNFQLAISIHQGPATVNIE*LLTFHVLLW  494
            +LVEIID LCTRH+VC+TKDYVF +   CGIGNFQL IS  Q      IE  LT+H L  
Sbjct  1    MLVEIIDLLCTRHLVCTTKDYVFRIVACCGIGNFQLIISYRQPLPQSIIELRLTYHALF-  59

Query  495  RHQRLVEIK*RVFSPLGLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGK  674
               + V I  RVF  LG Q ENPLMLLGQYSDDE+DE SSEG  RA SEDSS+  +DQ K
Sbjct  60   GGIKGVPITRRVFPLLGKQPENPLMLLGQYSDDEVDEESSEGFKRAASEDSSLDREDQEK  119

Query  675  VA  680
             A
Sbjct  120  QA  121



>emb|CDP13682.1| unnamed protein product [Coffea canephora]
Length=957

 Score = 85.1 bits (209),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKERRLAA+SA+ RR+KLDL AEPSGDLGGSS Q  VGGD+ +KN A LPNSPSSSG
Sbjct  1    MGRRKERRLAALSAAGRRLKLDLIAEPSGDLGGSSVQKEVGGDDNTKNHAGLPNSPSSSG  60

Query  254  GFCEFSSKGHLCREDMM  304
            GF +FSSKG +  +DM+
Sbjct  61   GFRQFSSKGLIFVQDML  77


 Score = 40.4 bits (93),  Expect(2) = 4e-20, Method: Composition-based stats.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 4/33 (12%)
 Frame = +1

Query  334  IFFVQDMLFVPQKIMFSVCNQA----VVLGTFN  420
            + FVQDMLFVPQK +FS C QA    V+LG ++
Sbjct  70   LIFVQDMLFVPQKNLFSDCKQAENPLVLLGQYS  102



>ref|XP_006474824.1| PREDICTED: uncharacterized protein LOC102615131 [Citrus sinensis]
Length=105

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 68/104 (65%), Gaps = 1/104 (1%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRK+R LAAMS + RRVKLDL AEPSGDLGGS+  D V  D   K +A LPNSPSSSG
Sbjct  1    MGKRKDRILAAMSNAGRRVKLDLSAEPSGDLGGSAVHDEVEKDTDLKQRAGLPNSPSSSG  60

Query  254  GFCEFSSKGHLCREDMM*PHNIGGNY*FSLYKTCCLFHKRLCFQ  385
            GF +FSSKG LCR DM   H  GG     +    C  ++   F+
Sbjct  61   GFRQFSSKGLLCRVDMSAQHYFGGIVELYVQDMLCCLYQEFIFR  104



>ref|XP_010675976.1| PREDICTED: uncharacterized protein LOC104891889 [Beta vulgaris 
subsp. vulgaris]
Length=122

 Score = 77.4 bits (189),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 58/76 (76%), Gaps = 2/76 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA   + RRVKLDLFAEPSGDLGGSS +D  G D  SK   ELPNSPSSSG
Sbjct  1    MGKRKERRLAAKIGAGRRVKLDLFAEPSGDLGGSSAKDEDGKDVDSKLDQELPNSPSSSG  60

Query  254  GFCEFSSKGHLCREDM  301
            GF  FSSKG  CRE M
Sbjct  61   GFRRFSSKG-FCREGM  75


 Score = 30.4 bits (67),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 3/42 (7%)
 Frame = +1

Query  328  LLIFFVQDMLFVPQKIMFSVCNQAVVLGTFNWPSVYIKALPQ  453
            + +F ++++ F P K +FS C  AVVLGTF        ALPQ
Sbjct  84   IWVFDIRNIAF-PSKYLFSECRVAVVLGTFT--GEINPALPQ  122



>ref|XP_009594052.1| PREDICTED: formin-binding protein 4 isoform X2 [Nicotiana tomentosiformis]
Length=912

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKER+LAA SA+ RRVKLDLFAEPSGDLGGSS QDGVGG+E SK  AELPNSPSSSG
Sbjct  1    MGRRKERKLAAKSAAGRRVKLDLFAEPSGDLGGSSIQDGVGGEEESKIHAELPNSPSSSG  60


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +3

Query  543  GLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVA  680
            G Q ENPLMLLGQYSDDE+DE SSEG  RA SEDSS+  +DQ K A
Sbjct  60   GKQPENPLMLLGQYSDDEVDEESSEGFKRAASEDSSLDREDQEKQA  105



>ref|XP_009759139.1| PREDICTED: formin-binding protein 4 isoform X1 [Nicotiana sylvestris]
Length=907

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKER+LAA SA+ RRVKLDLFAEPSGDLGGSS QDGVGG+E SK  AELPNSPSSSG
Sbjct  1    MGRRKERKLAAKSAAGRRVKLDLFAEPSGDLGGSSVQDGVGGEEESKIHAELPNSPSSSG  60


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +3

Query  543  GLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVA  680
            G Q ENPLMLLGQYSDDE+DE SSEG  RA SEDSS+ HDDQ K A
Sbjct  60   GKQPENPLMLLGQYSDDEVDEESSEGLNRAASEDSSLDHDDQEKQA  105



>ref|XP_008219444.1| PREDICTED: uncharacterized protein LOC103319651 [Prunus mume]
Length=95

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +2

Query  131  VKLDLFAEPSGDLGGSSQ-DGVGGDEASKNQAELPNSPSSSGGFCEFSSKGHL  286
            VKLDLFAEPSGDLGGS++ D +GGD  SK  A LPNSPSSSGGF +FSSK  L
Sbjct  43   VKLDLFAEPSGDLGGSAEHDELGGDMKSKGHAGLPNSPSSSGGFRQFSSKRTL  95



>ref|XP_006352638.1| PREDICTED: formin-binding protein 4-like [Solanum tuberosum]
Length=907

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKER+LAA  A+ RRVKLDLFAEPSGDLGGSS QD VGG+E SK  AELPNSPSSSG
Sbjct  1    MGRRKERKLAAKGAAGRRVKLDLFAEPSGDLGGSSVQDEVGGEEDSKIHAELPNSPSSSG  60


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  543  GLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGK  674
            G + ENPLMLLGQYSDDE+DE S EG  RA SEDSS+ H+D+GK
Sbjct  60   GQEPENPLMLLGQYSDDEVDEESVEGLKRAASEDSSLDHEDKGK  103



>ref|XP_004248291.1| PREDICTED: formin-binding protein 4 isoform X1 [Solanum lycopersicum]
Length=888

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKER+LAA  A+ RRVKLDLFAEP GDLGGSS QD VGG+E SK  AELPNSPSSSG
Sbjct  1    MGRRKERKLAAKGAAGRRVKLDLFAEPPGDLGGSSVQDEVGGEEESKIHAELPNSPSSSG  60


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  543  GLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGK  674
            G + ENPLMLLGQYSDDE+DE S E   RA SEDSS+ H+D+GK
Sbjct  60   GQEPENPLMLLGQYSDDEVDEESVEVLKRAASEDSSLDHEDKGK  103



>gb|EYU27457.1| hypothetical protein MIMGU_mgv1a017415mg [Erythranthe guttata]
Length=76

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 57/78 (73%), Gaps = 4/78 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKERR+AA       VKLDLFAEPSGDLGGSS Q+ VGGD  S   A+ P+SPSSSG
Sbjct  1    MGRRKERRIAAAGGRR--VKLDLFAEPSGDLGGSSGQEQVGGDGDSITDAKSPSSPSSSG  58

Query  254  GFCE-FSSKGHLCREDMM  304
            GFC+ F  +  LCRE MM
Sbjct  59   GFCQIFLQRTALCREGMM  76



>gb|KFK38659.1| hypothetical protein AALP_AA3G143500 [Arabis alpina]
Length=927

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 64/112 (57%), Gaps = 21/112 (19%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR AA +   R VKLDLFAEPSGDLGGS  +DGV  +E   N  ELPNSPSSSG
Sbjct  1    MGKRKERRFAANNTGRR-VKLDLFAEPSGDLGGSEVRDGVEKEEKETN--ELPNSPSSSG  57

Query  254  GFCEFS---SKGHLCREDMM*PHNIGGNY*FSLYKTCCLFHKRLCFQSVTRL  400
            GF   S   +K H C +  M              +  CL+   L  +++T L
Sbjct  58   GFHSISYLVAKLHKCFDIFM--------------RFVCLWLFWLAMRNLTAL  95



>ref|XP_007208104.1| hypothetical protein PRUPE_ppa001027mg [Prunus persica]
 gb|EMJ09303.1| hypothetical protein PRUPE_ppa001027mg [Prunus persica]
Length=930

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQ-DGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA + + RRVKLDLFAEPSGDLGGS++ D +GGD  SK  A LPNSPSSSG
Sbjct  1    MGKRKERRLAAKTNAGRRVKLDLFAEPSGDLGGSAEHDELGGDMKSKGHAGLPNSPSSSG  60



>ref|XP_008344741.1| PREDICTED: uncharacterized protein LOC103407619 [Malus domestica]
Length=334

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQ-DGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA + + RRVKLDLFAEPSGD+GGS++ D  G D  SKN A +PNSPSSSG
Sbjct  1    MGKRKERRLAAKTNAGRRVKLDLFAEPSGDVGGSAEHDEHGEDTKSKNHAGVPNSPSSSG  60



>emb|CBI39790.3| unnamed protein product [Vitis vinifera]
Length=820

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKERRLAA+SAS RRVKLDLFAEPSGDLGGSS +D VGGD  SK +A  PNSPSSSG
Sbjct  1    MGRRKERRLAAISASGRRVKLDLFAEPSGDLGGSSVRDEVGGDLDSKRRAASPNSPSSSG  60

Query  254  GFCEFSSKGHLCREDM  301
            GF +FSSKG LC EDM
Sbjct  61   GFRQFSSKG-LCIEDM  75



>ref|XP_011095580.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105174988 
[Sesamum indicum]
Length=950

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 2/60 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKERRLAA+SA+ RRVKLDLFAEPSGDLGGSS Q+ VGGD A K  AELP+SP+SSG
Sbjct  1    MGRRKERRLAAISAAGRRVKLDLFAEPSGDLGGSSAQEEVGGDGA-KTHAELPSSPTSSG  59



>ref|XP_002532512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29864.1| conserved hypothetical protein [Ricinus communis]
Length=964

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDG-VGGDEASKNQAELPNSPSSS  250
            MGKRKERRLAA+S + RRVKLDLFAEPSGDLGGSS +G VG D     +AELPNSPSSS
Sbjct  1    MGKRKERRLAALSNAGRRVKLDLFAEPSGDLGGSSVNGEVGEDIDPTKRAELPNSPSSS  59



>ref|XP_008384608.1| PREDICTED: formin-binding protein 4 [Malus domestica]
Length=935

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEA-SKNQAELPNSPSSSG  253
            MGKRKERRLAA +++ RRVKLDLFAEPSGDLGGS+     GDE  SK  A LPNSPSSSG
Sbjct  1    MGKRKERRLAAKTSAGRRVKLDLFAEPSGDLGGSAGHDEHGDETKSKGHAGLPNSPSSSG  60



>ref|XP_008358896.1| PREDICTED: formin-binding protein 4-like [Malus domestica]
Length=935

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEA-SKNQAELPNSPSSSG  253
            MGKRKERRLAA +++ RRVKLDLFAEPSGDLGGS+     GDE  SK  A LPNSPSSSG
Sbjct  1    MGKRKERRLAAKTSAGRRVKLDLFAEPSGDLGGSAGHDEHGDETKSKGHAGLPNSPSSSG  60



>ref|XP_011038872.1| PREDICTED: uncharacterized protein LOC105135610 isoform X1 [Populus 
euphratica]
Length=976

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+S + RR KLDLFAEPSGDLGGS   +GVG D     +AELPNSPSSSG
Sbjct  1    MGKRKERRLAALSNAGRRTKLDLFAEPSGDLGGSYVNNGVGEDIDPSQRAELPNSPSSSG  60



>ref|XP_010487073.1| PREDICTED: formin-binding protein 4-like [Camelina sativa]
Length=903

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR AAM+++ RRVKLDLFAEPSGDLGGS  +DGV  ++      ELPNSPSSSG
Sbjct  1    MGKRKERRFAAMNSTGRRVKLDLFAEPSGDLGGSDVRDGVEREQQQTEPNELPNSPSSSG  60

Query  254  GFCE  265
               E
Sbjct  61   QKTE  64



>gb|KDP32612.1| hypothetical protein JCGZ_13162 [Jatropha curcas]
Length=951

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsass-rrVKLDLFAEPSGDLGGSSQDG-VGGDEASKNQAELPNSPSSS  250
            MGKRKERR  A  +++ RRVKLDLFAEPSGDLGGSS +G VGGD    N+A LP SPSSS
Sbjct  1    MGKRKERRRLAALSNAGRRVKLDLFAEPSGDLGGSSVNGDVGGDMYPTNRAGLPTSPSSS  60

Query  251  G  253
            G
Sbjct  61   G  61



>ref|NP_001154613.1| WW domain-containing protein [Arabidopsis thaliana]
 gb|AEE75318.1| WW domain-containing protein [Arabidopsis thaliana]
Length=892

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR AAM+++ RRVKLDLFAEPSGDLGGS  +DGV  ++   N  ELPNSPSSSG
Sbjct  1    MGKRKERRYAAMNSTGRRVKLDLFAEPSGDLGGSDVRDGVEREQTELN--ELPNSPSSSG  58

Query  254  GFCE  265
               E
Sbjct  59   QKTE  62



>emb|CDY43359.1| BnaA01g29900D [Brassica napus]
Length=901

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEASKNQAELPNSPSSSGG  256
            MGKRKERR AA + S R VKLDLFAEPSGDLGGS     G ++      ELP SPSSSGG
Sbjct  1    MGKRKERRFAANNTSRR-VKLDLFAEPSGDLGGSDVRSDGDEKEQTEPNELPKSPSSSGG  59

Query  257  FCEFSS  274
            F + SS
Sbjct  60   FHQLSS  65



>dbj|BAB03122.1| unnamed protein product [Arabidopsis thaliana]
Length=907

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR AAM+++ RRVKLDLFAEPSGDLGGS  +DGV  ++   N  ELPNSPSSSG
Sbjct  1    MGKRKERRYAAMNSTGRRVKLDLFAEPSGDLGGSDVRDGVEREQTELN--ELPNSPSSSG  58

Query  254  GFCE  265
               E
Sbjct  59   QKTE  62



>ref|XP_010274244.1| PREDICTED: uncharacterized protein LOC104609583 isoform X1 [Nelumbo 
nucifera]
Length=1011

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+SA+ RRVKLDLFAEPSGDLGGSS  D VGGD     +  +PNSPS+SG
Sbjct  1    MGKRKERRLAALSAAGRRVKLDLFAEPSGDLGGSSAHDQVGGDLDQSYRDGVPNSPSTSG  60



>gb|EPS69240.1| hypothetical protein M569_05528, partial [Genlisea aurea]
Length=67

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MG+RKERRLAAMSA+ RRVK+DL  EPSGDLGGSS Q+ VGGD   K  AE  +  +SSG
Sbjct  1    MGRRKERRLAAMSAAGRRVKVDLSTEPSGDLGGSSAQEDVGGDGDLKTPAEFQSPETSSG  60

Query  254  GFCEFSS  274
            GF + SS
Sbjct  61   GFRQISS  67



>ref|XP_006296954.1| hypothetical protein CARUB_v10012949mg [Capsella rubella]
 gb|EOA29852.1| hypothetical protein CARUB_v10012949mg [Capsella rubella]
Length=883

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR A+MS++ RRVKLDLFAEPSGDLGGS  +DGV  ++   N  ELPNSPSSSG
Sbjct  1    MGKRKERRFASMSSTGRRVKLDLFAEPSGDLGGSDMRDGVEREKREPN--ELPNSPSSSG  58

Query  254  GFCE  265
               E
Sbjct  59   QKTE  62



>ref|XP_007140124.1| hypothetical protein PHAVU_008G086000g [Phaseolus vulgaris]
 gb|ESW12118.1| hypothetical protein PHAVU_008G086000g [Phaseolus vulgaris]
Length=934

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDG-VGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+S + RR+KLDLFAEPSG+LGGS+  G  GGD  S+++  LPNSPSSSG
Sbjct  1    MGKRKERRLAALSNTGRRLKLDLFAEPSGELGGSTLHGDAGGDTDSQHRDGLPNSPSSSG  60



>ref|XP_010465143.1| PREDICTED: formin-binding protein 4-like isoform X1 [Camelina 
sativa]
Length=889

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR AAM+++ RRVKLDLFAEPSGDLGGS  +DGV   E      ELPNSPSSSG
Sbjct  1    MGKRKERRFAAMNSTGRRVKLDLFAEPSGDLGGSDVRDGVKR-EVQTEPNELPNSPSSSG  59

Query  254  GFCE  265
               E
Sbjct  60   QKTE  63



>ref|XP_009367261.1| PREDICTED: formin-binding protein 4 isoform X1 [Pyrus x bretschneideri]
Length=934

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEA-SKNQAELPNSPSSS  250
            MGKR ERRLAA +++ RRVKLDLFAEPSGDLGGS+     GDE  SK  A LPNSPSSS
Sbjct  1    MGKRNERRLAAKTSAGRRVKLDLFAEPSGDLGGSAGHDEHGDETKSKGHAGLPNSPSSS  59



>ref|XP_010255737.1| PREDICTED: formin-binding protein 4-like isoform X1 [Nelumbo 
nucifera]
Length=1009

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+SA+ RRVKLDLFAEPSGDLGGSS  D VGGD        +PNSPS+S 
Sbjct  1    MGKRKERRLAALSAAGRRVKLDLFAEPSGDLGGSSAHDEVGGDLDQSYCDGVPNSPSTSA  60

Query  254  GFCE  265
               E
Sbjct  61   QHQE  64



>gb|KFK38660.1| hypothetical protein AALP_AA3G143500 [Arabis alpina]
Length=883

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 45/60 (75%), Gaps = 4/60 (7%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERR AA +   R VKLDLFAEPSGDLGGS  +DGV  +E   N  ELPNSPSSSG
Sbjct  1    MGKRKERRFAANNTGRR-VKLDLFAEPSGDLGGSEVRDGVEKEEKETN--ELPNSPSSSG  57



>ref|XP_006586154.1| PREDICTED: uncharacterized protein LOC100791890 isoform X1 [Glycine 
max]
Length=930

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsass-rrVKLDLFAEPSGDLGGSSQDG-VGGDEASKNQAELPNSPSSS  250
            MGKRKERR  A  +++ RRVKLDLFAEPSG+LGGS+  G  GGD  S+++  LPNSPSSS
Sbjct  1    MGKRKERRRLAAISNAGRRVKLDLFAEPSGELGGSTLQGDAGGDTDSQHRDGLPNSPSSS  60

Query  251  G  253
            G
Sbjct  61   G  61



>ref|XP_010418959.1| PREDICTED: uncharacterized protein LOC104704597 [Camelina sativa]
Length=793

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 50/64 (78%), Gaps = 2/64 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRK RR AAM+++ RRVKLDLFAEPSGDLGGS  +DGV  ++ ++   ELPNSPSSSG
Sbjct  1    MGKRKVRRFAAMNSTGRRVKLDLFAEPSGDLGGSDVRDGVEREQQTEPN-ELPNSPSSSG  59

Query  254  GFCE  265
               E
Sbjct  60   QKTE  63



>ref|XP_010103959.1| Formin-binding protein 4 [Morus notabilis]
 gb|EXB97662.1| Formin-binding protein 4 [Morus notabilis]
Length=996

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = +2

Query  131  VKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSGGFCEFSS  274
            VKLDLFAEPSGDLGGSS  D VG D   K++A LPNSPSSS   C  SS
Sbjct  8    VKLDLFAEPSGDLGGSSAHDEVGVDTDLKHRAGLPNSPSSS--VCLLSS  54



>ref|XP_004294901.2| PREDICTED: formin-binding protein 4 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=896

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsass-rrVKLDLFAEPSG-DLGGSSQ-DGVGGDEASKNQAELPNSPSS  247
            MG RKERR  A  +SS RRVKLDLFAEPSG DLGGS++ +GVGG+  SK ++ LPNSPSS
Sbjct  1    MGNRKERRRLAAMSSSGRRVKLDLFAEPSGGDLGGSAEHEGVGGEVHSKAESGLPNSPSS  60

Query  248  SG  253
            SG
Sbjct  61   SG  62



>ref|XP_010061424.1| PREDICTED: uncharacterized protein LOC104449101 isoform X1 [Eucalyptus 
grandis]
Length=929

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKR+ERR AA S + RRVKLDLFAEPSGDLG SS QD V GD  S +   LPN  SSSG
Sbjct  1    MGKRRERRKAAQSNAGRRVKLDLFAEPSGDLGISSGQDEVEGDVDSTHHDGLPNPASSSG  60



>ref|XP_010928058.1| PREDICTED: uncharacterized protein LOC105049946 isoform X1 [Elaeis 
guineensis]
Length=969

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  534  SPLGLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQ  668
            SP G +QENPL+LLGQYSDDELDE +S+ P  A  E SSV  D Q
Sbjct  57   SPSGQKQENPLLLLGQYSDDELDEEASKQPKHAVEESSSVNMDGQ  101



>ref|XP_003600395.1| hypothetical protein MTR_3g060710 [Medicago truncatula]
Length=625

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDG-VGGDEASKNQAELPNSPSSS  250
            MG RKERR AA S + RRVKLDLFAEPSG+LGGS   G  GGD  S+    LPNSPSSS
Sbjct  1    MGNRKERRRAAHSNAGRRVKLDLFAEPSGELGGSPIHGDAGGDANSQQHDGLPNSPSSS  59



>ref|XP_010061426.1| PREDICTED: uncharacterized protein LOC104449101 isoform X3 [Eucalyptus 
grandis]
Length=858

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKR+ERR AA S + RRVKLDLFAEPSGDLG SS QD V GD  S +   LPN  SSSG
Sbjct  1    MGKRRERRKAAQSNAGRRVKLDLFAEPSGDLGISSGQDEVEGDVDSTHHDGLPNPASSSG  60



>ref|XP_009759140.1| PREDICTED: formin-binding protein 4 isoform X2 [Nicotiana sylvestris]
Length=840

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  567  MLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVA  680
            MLLGQYSDDE+DE SSEG  RA SEDSS+ HDDQ K A
Sbjct  1    MLLGQYSDDEVDEESSEGLNRAASEDSSLDHDDQEKQA  38



>ref|XP_009387309.1| PREDICTED: protein piccolo isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=893

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 2/60 (3%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKR+ERRLAAM A+SRRVKLDLF EPSG++ G+S  D VGGD   K+  E+P+SPSSSG
Sbjct  1    MGKRRERRLAAMMAASRRVKLDLFTEPSGEMVGNSLHDEVGGD-LDKDHHEVPSSPSSSG  59



>ref|XP_004149420.1| PREDICTED: uncharacterized protein LOC101219916 [Cucumis sativus]
Length=943

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKR+ERRLAA+S   RRVKLDLFAEPSGDL GS   + VGGD  ++   +LP S SSSG
Sbjct  1    MGKRRERRLAALSNVGRRVKLDLFAEPSGDLDGSDGHEDVGGDIDTRQTTKLPKSASSSG  60



>ref|XP_008800273.1| PREDICTED: uncharacterized protein LOC103714695 isoform X1 [Phoenix 
dactylifera]
Length=971

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  534  SPLGLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQ  668
            SP G +QENPL+LLGQYSDDELDE  SE    A  E SSV  DDQ
Sbjct  57   SPSGQKQENPLLLLGQYSDDELDEEVSEQLKHAVEESSSVNMDDQ  101


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAAM A+SRRVKLDL AEPSG++ GSS  D VGG+    +QA +P SPS SG
Sbjct  1    MGKRKERRLAAMMAASRRVKLDLCAEPSGEMVGSSLHDEVGGELDKDHQAGVPTSPSPSG  60



>ref|XP_004167069.1| PREDICTED: uncharacterized protein LOC101223441 [Cucumis sativus]
Length=943

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKR+ERRLAA+S   RRVKLDLFAEPSGDL GS   + VGGD  ++   +LP S SSSG
Sbjct  1    MGKRRERRLAALSNVGRRVKLDLFAEPSGDLDGSDGHEEVGGDIDTRQTTKLPKSASSSG  60



>ref|XP_008463033.1| PREDICTED: flocculation protein FLO11 isoform X1 [Cucumis melo]
Length=943

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKR+ERRLAA+S   RRVKLDLFAEPSGDL GS   + VGGD  ++   +LP S SSSG
Sbjct  1    MGKRRERRLAALSNVGRRVKLDLFAEPSGDLDGSDGHEEVGGDIDTRQTIKLPKSASSSG  60



>ref|XP_007020417.1| WW domain-containing protein, putative isoform 7 [Theobroma cacao]
 gb|EOY11942.1| WW domain-containing protein, putative isoform 7 [Theobroma cacao]
Length=902

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+S + RRVKLDLFAEPS DLGGSS  + V G+   K+ A LPNSPSSSG
Sbjct  1    MGKRKERRLAALSNAGRRVKLDLFAEPSEDLGGSSVHEEVDGE--PKHGAGLPNSPSSSG  58



>ref|XP_007020416.1| WW domain-containing protein, putative isoform 6, partial [Theobroma 
cacao]
 gb|EOY11941.1| WW domain-containing protein, putative isoform 6, partial [Theobroma 
cacao]
Length=887

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+S + RRVKLDLFAEPS DLGGSS  + V G+   K+ A LPNSPSSSG
Sbjct  1    MGKRKERRLAALSNAGRRVKLDLFAEPSEDLGGSSVHEEVDGE--PKHGAGLPNSPSSSG  58



>ref|XP_007020414.1| WW domain-containing protein, putative isoform 4 [Theobroma cacao]
 gb|EOY11939.1| WW domain-containing protein, putative isoform 4 [Theobroma cacao]
Length=831

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+S + RRVKLDLFAEPS DLGGSS  + V G+   K+ A LPNSPSSSG
Sbjct  1    MGKRKERRLAALSNAGRRVKLDLFAEPSEDLGGSSVHEEVDGE--PKHGAGLPNSPSSSG  58



>ref|XP_006370019.1| hypothetical protein POPTR_0001s38050g [Populus trichocarpa]
 gb|ERP66588.1| hypothetical protein POPTR_0001s38050g [Populus trichocarpa]
Length=839

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAEL  229
            MGKRKERRLAA+S + RR+KLDLFAEPSGDLGGSS  +GVGGD     +AEL
Sbjct  1    MGKRKERRLAAVSNAGRRIKLDLFAEPSGDLGGSSVNNGVGGDIDPSQRAEL  52



>ref|XP_002300398.2| hypothetical protein POPTR_0001s38050g [Populus trichocarpa]
 gb|EEE85203.2| hypothetical protein POPTR_0001s38050g [Populus trichocarpa]
Length=987

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAEL  229
            MGKRKERRLAA+S + RR+KLDLFAEPSGDLGGSS  +GVGGD     +AEL
Sbjct  1    MGKRKERRLAAVSNAGRRIKLDLFAEPSGDLGGSSVNNGVGGDIDPSQRAEL  52



>ref|XP_007020418.1| WW domain-containing protein, putative isoform 8 [Theobroma cacao]
 gb|EOY11943.1| WW domain-containing protein, putative isoform 8 [Theobroma cacao]
Length=907

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 48/60 (80%), Gaps = 3/60 (5%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQAELPNSPSSSG  253
            MGKRKERRLAA+S + RRVKLDLFAEPS DLGGSS  + V G+   K+ A LPNSPSSSG
Sbjct  1    MGKRKERRLAALSNAGRRVKLDLFAEPSEDLGGSSVHEEVDGE--PKHGAGLPNSPSSSG  58



>emb|CDY23203.1| BnaA04g05560D [Brassica napus]
Length=376

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEASKNQAELPNSPSSSGG  256
            MGKRKERR AA + S R VKLDLFAEPSGDLGGS     G ++      ELP SPSSSG 
Sbjct  1    MGKRKERRFAANNTSRR-VKLDLFAEPSGDLGGSDVRSDGDEKEQTEPNELPKSPSSSGQ  59

Query  257  FCE  265
              E
Sbjct  60   KTE  62



>ref|XP_009124730.1| PREDICTED: formin-binding protein 4 isoform X2 [Brassica rapa]
Length=874

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEASKNQAELPNSPSSSGG  256
            MGKRKERR AA + S R VKLDLFAEPSGDLGGS     G ++      ELP SPSSSG 
Sbjct  1    MGKRKERRFAANNTSRR-VKLDLFAEPSGDLGGSDVRSDGDEKEQTEPNELPKSPSSSGQ  59

Query  257  FCE  265
              E
Sbjct  60   KTE  62



>ref|XP_009124729.1| PREDICTED: formin-binding protein 4 isoform X1 [Brassica rapa]
Length=881

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEASKNQAELPNSPSSSGG  256
            MGKRKERR AA + S R VKLDLFAEPSGDLGGS     G ++      ELP SPSSSG 
Sbjct  1    MGKRKERRFAANNTSRR-VKLDLFAEPSGDLGGSDVRSDGDEKEQTEPNELPKSPSSSGQ  59

Query  257  FCE  265
              E
Sbjct  60   KTE  62



>emb|CDY24199.1| BnaC01g37790D [Brassica napus]
Length=886

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSSQDGVGGDEASKNQAELPNSPSSSGG  256
            MGKRKERR AA ++S R VKLDLFAEPSGDLGGS     G ++      ELP SPSSSG 
Sbjct  1    MGKRKERRFAANNSSRR-VKLDLFAEPSGDLGGSDVRCDGDEKEQTEPNELPKSPSSSGQ  59

Query  257  FCE  265
              E
Sbjct  60   KTE  62



>ref|XP_004498164.1| PREDICTED: uncharacterized protein LOC101511978 isoform X2 [Cicer 
arietinum]
Length=881

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 5/47 (11%)
 Frame = +3

Query  540  LGLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVA  680
            +G Q +NPL+LLGQYSDDE+DEGSS+GP      D+ V + ++  VA
Sbjct  25   IGQQSQNPLLLLGQYSDDEVDEGSSKGP-----NDTKVHNHEEANVA  66



>ref|XP_004498163.1| PREDICTED: uncharacterized protein LOC101511978 isoform X1 [Cicer 
arietinum]
Length=915

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 5/47 (11%)
 Frame = +3

Query  540  LGLQQENPLMLLGQYSDDELDEGSSEGPIRAGSEDSSVAHDDQGKVA  680
            +G Q +NPL+LLGQYSDDE+DEGSS+GP      D+ V + ++  VA
Sbjct  25   IGQQSQNPLLLLGQYSDDEVDEGSSKGP-----NDTKVHNHEEANVA  66



>ref|XP_010644625.1| PREDICTED: uncharacterized protein LOC100249836 isoform X1 [Vitis 
vinifera]
Length=981

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = +2

Query  77   MGKRKErrlaamsassrrVKLDLFAEPSGDLGGSS-QDGVGGDEASKNQ  220
            MG+RKERRLAA+SAS RRVKLDLFAEPSGDLGGSS +D VGGD  SK +
Sbjct  1    MGRRKERRLAAISASGRRVKLDLFAEPSGDLGGSSVRDEVGGDLDSKRR  49



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700