BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034B16

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086719.1|  PREDICTED: uncharacterized protein LOC105168359    273   2e-88   Sesamum indicum [beniseed]
emb|CDP13288.1|  unnamed protein product                                262   3e-84   Coffea canephora [robusta coffee]
ref|XP_009606772.1|  PREDICTED: uncharacterized protein LOC104101068    261   5e-84   Nicotiana tomentosiformis
ref|XP_009780030.1|  PREDICTED: uncharacterized protein LOC104229142    260   1e-83   Nicotiana sylvestris
gb|EYU25950.1|  hypothetical protein MIMGU_mgv1a012571mg                260   1e-83   Erythranthe guttata [common monkey flower]
gb|EYU25951.1|  hypothetical protein MIMGU_mgv1a012571mg                260   2e-83   Erythranthe guttata [common monkey flower]
gb|EPS68757.1|  hypothetical protein M569_06012                         258   6e-83   Genlisea aurea
ref|NP_001237795.1|  uncharacterized protein LOC100306628               258   1e-82   Glycine max [soybeans]
ref|XP_006590262.1|  PREDICTED: uncharacterized protein LOC100306...    257   1e-82   Glycine max [soybeans]
gb|KHN44402.1|  hypothetical protein glysoja_014443                     259   2e-82   Glycine soja [wild soybean]
ref|XP_006341763.1|  PREDICTED: uncharacterized protein LOC102591507    254   1e-81   Solanum tuberosum [potatoes]
ref|XP_004239174.1|  PREDICTED: uncharacterized protein LOC101256588    250   5e-80   Solanum lycopersicum
emb|CDY28870.1|  BnaC06g26580D                                          250   5e-80   Brassica napus [oilseed rape]
ref|XP_007163718.1|  hypothetical protein PHAVU_001G258300g             250   9e-80   Phaseolus vulgaris [French bean]
ref|XP_010248828.1|  PREDICTED: uncharacterized protein LOC104591617    249   9e-80   Nelumbo nucifera [Indian lotus]
ref|XP_010415350.1|  PREDICTED: uncharacterized protein LOC104701...    249   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010415348.1|  PREDICTED: uncharacterized protein LOC104701...    249   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_008444407.1|  PREDICTED: uncharacterized protein LOC103487745    249   3e-79   Cucumis melo [Oriental melon]
gb|KJB78038.1|  hypothetical protein B456_012G174200                    249   3e-79   Gossypium raimondii
gb|KJB78040.1|  hypothetical protein B456_012G174200                    249   3e-79   Gossypium raimondii
ref|XP_004142952.1|  PREDICTED: uncharacterized protein LOC101203...    248   3e-79   Cucumis sativus [cucumbers]
ref|XP_004142951.1|  PREDICTED: uncharacterized protein LOC101203...    249   3e-79   Cucumis sativus [cucumbers]
ref|NP_564903.3|  uncharacterized protein                               248   3e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850972.1|  uncharacterized protein                               248   4e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511723.1|  PREDICTED: uncharacterized protein LOC104787...    248   4e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010511722.1|  PREDICTED: uncharacterized protein LOC104787...    248   4e-79   Camelina sativa [gold-of-pleasure]
ref|XP_011457438.1|  PREDICTED: uncharacterized protein LOC101291014    248   7e-79   Fragaria vesca subsp. vesca
ref|XP_010690008.1|  PREDICTED: uncharacterized protein LOC104903638    248   8e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006302772.1|  hypothetical protein CARUB_v10020893mg             248   9e-79   Capsella rubella
ref|XP_006438141.1|  hypothetical protein CICLE_v10032669mg             247   1e-78   Citrus clementina [clementine]
ref|XP_006438139.1|  hypothetical protein CICLE_v10032669mg             247   1e-78   Citrus clementina [clementine]
ref|XP_009105310.1|  PREDICTED: uncharacterized protein LOC103831...    247   1e-78   Brassica rapa
emb|CDX96071.1|  BnaA07g26600D                                          247   2e-78   
emb|CDY07411.1|  BnaA07g24900D                                          246   2e-78   Brassica napus [oilseed rape]
ref|XP_010470686.1|  PREDICTED: uncharacterized protein LOC104750...    247   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010470685.1|  PREDICTED: uncharacterized protein LOC104750...    247   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009105106.1|  PREDICTED: uncharacterized protein LOC103831017    247   2e-78   Brassica rapa
ref|XP_009105311.1|  PREDICTED: uncharacterized protein LOC103831...    246   2e-78   
gb|KDP26738.1|  hypothetical protein JCGZ_17896                         246   3e-78   Jatropha curcas
ref|XP_006484021.1|  PREDICTED: uncharacterized protein LOC102611015    246   4e-78   Citrus sinensis [apfelsine]
gb|KDO82054.1|  hypothetical protein CISIN_1g027148mg                   246   4e-78   Citrus sinensis [apfelsine]
gb|KHG12697.1|  Multidrug resistance pgp-1                              246   5e-78   Gossypium arboreum [tree cotton]
ref|XP_011042325.1|  PREDICTED: uncharacterized protein LOC105138036    246   5e-78   Populus euphratica
ref|XP_002314565.1|  hypothetical protein POPTR_0010s06350g             246   6e-78   Populus trichocarpa [western balsam poplar]
ref|XP_006391234.1|  hypothetical protein EUTSA_v10019020mg             245   2e-77   Eutrema salsugineum [saltwater cress]
ref|XP_002515011.1|  oligopeptidase, putative                           243   4e-77   Ricinus communis
ref|XP_008807203.1|  PREDICTED: uncharacterized protein LOC103719642    243   4e-77   Phoenix dactylifera
ref|XP_010556180.1|  PREDICTED: uncharacterized protein LOC104825...    243   5e-77   Tarenaya hassleriana [spider flower]
ref|XP_010556182.1|  PREDICTED: uncharacterized protein LOC104825...    243   7e-77   Tarenaya hassleriana [spider flower]
ref|NP_001185346.1|  uncharacterized protein                            242   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272215.2|  PREDICTED: uncharacterized protein LOC100256...    238   3e-75   Vitis vinifera
ref|XP_010655080.1|  PREDICTED: uncharacterized protein LOC100256...    238   4e-75   Vitis vinifera
ref|XP_009403641.1|  PREDICTED: uncharacterized protein LOC103987153    238   5e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007044959.1|  Uncharacterized protein TCM_010707                 237   2e-74   
ref|XP_003601843.1|  hypothetical protein MTR_3g086040                  235   6e-74   Medicago truncatula
ref|XP_010930033.1|  PREDICTED: uncharacterized protein LOC105051...    235   9e-74   Elaeis guineensis
emb|CDY01837.1|  BnaC06g28770D                                          249   4e-73   
ref|XP_010930032.1|  PREDICTED: uncharacterized protein LOC105051...    232   1e-72   Elaeis guineensis
ref|XP_007223900.1|  hypothetical protein PRUPE_ppa010899mg             231   2e-72   
ref|XP_008389783.1|  PREDICTED: uncharacterized protein LOC103452079    231   3e-72   
ref|XP_004502335.1|  PREDICTED: uncharacterized protein LOC101493538    231   4e-72   Cicer arietinum [garbanzo]
ref|XP_010025366.1|  PREDICTED: uncharacterized protein LOC104415723    230   6e-72   Eucalyptus grandis [rose gum]
ref|XP_008221980.1|  PREDICTED: uncharacterized protein LOC103321904    226   2e-70   Prunus mume [ume]
ref|XP_006852149.1|  hypothetical protein AMTR_s00049p00073250          227   3e-70   
ref|XP_010100301.1|  hypothetical protein L484_027609                   222   6e-69   
ref|XP_009359285.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    221   1e-68   Pyrus x bretschneideri [bai li]
gb|KDO82056.1|  hypothetical protein CISIN_1g027148mg                   218   8e-68   Citrus sinensis [apfelsine]
gb|KEH35275.1|  plant/F12A21-30 protein, putative                       211   6e-65   Medicago truncatula
gb|AAG28905.1|AC008113_21  F12A21.16                                    225   2e-64   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85479.1|  predicted protein                                      204   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001047344.1|  Os02g0600200                                       202   1e-60   
ref|XP_010235641.1|  PREDICTED: uncharacterized protein LOC104583...    201   2e-60   
gb|EEC73537.1|  hypothetical protein OsI_07935                          201   6e-60   Oryza sativa Indica Group [Indian rice]
ref|XP_004952998.1|  PREDICTED: uncharacterized protein LOC101783...    201   7e-60   
ref|NP_001141155.1|  uncharacterized protein LOC100273241               199   7e-60   Zea mays [maize]
ref|XP_004952999.1|  PREDICTED: uncharacterized protein LOC101783...    199   9e-60   Setaria italica
ref|XP_010235643.1|  PREDICTED: uncharacterized protein LOC104583...    197   6e-59   
ref|XP_006665147.1|  PREDICTED: uncharacterized protein LOC102722271    192   1e-57   
gb|EMT22924.1|  hypothetical protein F775_29812                         193   7e-57   
gb|KDO82053.1|  hypothetical protein CISIN_1g027148mg                   184   2e-54   Citrus sinensis [apfelsine]
ref|XP_002887139.1|  F12A21.16                                          189   2e-51   
gb|KDO82058.1|  hypothetical protein CISIN_1g027148mg                   174   4e-51   Citrus sinensis [apfelsine]
gb|ABK23133.1|  unknown                                                 170   1e-48   Picea sitchensis
emb|CBI27531.3|  unnamed protein product                                166   4e-48   Vitis vinifera
ref|XP_006648812.1|  PREDICTED: uncharacterized protein LOC102699572    154   1e-42   
gb|EAY86575.1|  hypothetical protein OsI_07955                          154   2e-40   Oryza sativa Indica Group [Indian rice]
gb|AFW72182.1|  hypothetical protein ZEAMMB73_079373                    145   1e-39   
ref|XP_001765741.1|  predicted protein                                  143   1e-38   
gb|KHN24102.1|  Small heat shock protein, chloroplastic                 142   5e-37   Glycine soja [wild soybean]
ref|XP_010930034.1|  PREDICTED: uncharacterized protein LOC105051...    125   8e-32   Elaeis guineensis
gb|AFB34514.1|  hypothetical protein CL4511Contig1_02                   110   2e-27   Pinus mugo [mountain pine]
gb|AEW09177.1|  hypothetical protein CL4511Contig1_02                   110   3e-27   Pinus radiata
gb|AFB34513.1|  hypothetical protein CL4511Contig1_02                   107   5e-26   Larix decidua
ref|XP_002983221.1|  hypothetical protein SELMODRAFT_422572             108   2e-25   
ref|XP_002961342.1|  hypothetical protein SELMODRAFT_403146             106   9e-25   
ref|XP_005648734.1|  hypothetical protein COCSUDRAFT_53257            89.0    5e-18   Coccomyxa subellipsoidea C-169
ref|XP_001415572.1|  predicted protein                                72.4    1e-12   Ostreococcus lucimarinus CCE9901
ref|XP_011397511.1|  Uncharacterized protein YhiN                     73.6    9e-12   Auxenochlorella protothecoides
ref|XP_003074445.1|  Metalloendopeptidase family-saccharolysin & ...  70.9    1e-11   Ostreococcus tauri
ref|XP_002507497.1|  hypothetical protein MICPUN_113391               70.9    1e-11   Micromonas commoda
ref|XP_005534863.1|  hypothetical protein CYME_CMJ126C                64.3    2e-09   Cyanidioschyzon merolae strain 10D
ref|XP_003056036.1|  hypothetical protein MICPUCDRAFT_70697           63.5    4e-09   Micromonas pusilla CCMP1545
ref|XP_005852074.1|  hypothetical protein CHLNCDRAFT_133084           62.0    1e-08   Chlorella variabilis
gb|AFW72181.1|  hypothetical protein ZEAMMB73_079373                  58.2    5e-08   
ref|XP_001695603.1|  hypothetical protein CHLREDRAFT_205992           59.3    1e-07   Chlamydomonas reinhardtii
ref|XP_007509245.1|  predicted protein                                55.5    2e-06   Bathycoccus prasinos
ref|XP_005718910.1|  unnamed protein product                          53.5    2e-05   Chondrus crispus [carageen]
ref|XP_002953545.1|  hypothetical protein VOLCADRAFT_121174           53.1    3e-05   Volvox carteri f. nagariensis
ref|XP_002184929.1|  predicted protein                                52.0    5e-05   Phaeodactylum tricornutum CCAP 1055/1



>ref|XP_011086719.1| PREDICTED: uncharacterized protein LOC105168359 [Sesamum indicum]
Length=243

 Score =   273 bits (697),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV MS N LVRLP  +       S        + T TA    +++R  RL+VVEAKGKK
Sbjct  1    MEVGMSLNPLVRLPLSSNGRTHEDSLIRHSLFSTKTTTAQKPYQQKRQHRLLVVEAKGKK  60

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPPLPKLEDDGNPKFVIFIR+A+V LWYPLNIVTGGTTAKIMV+AKDNF
Sbjct  61   GMAARQYQRAPPPPLPKLEDDGNPKFVIFIRVANVYLWYPLNIVTGGTTAKIMVSAKDNF  120

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDTLARNLAAVIYRDEKE+QK+A KQFRVLR++TDFRYGYKLVENNNLR AL+ 
Sbjct  121  LGKYIYKDTLARNLAAVIYRDEKEIQKMAMKQFRVLRSATDFRYGYKLVENNNLRAALAA  180

Query  622  TNIIELP  642
             ++IELP
Sbjct  181  NDVIELP  187



>emb|CDP13288.1| unnamed protein product [Coffea canephora]
Length=235

 Score =   262 bits (669),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 156/192 (81%), Gaps = 12/192 (6%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP---RRNPMEDsgsssslirhsissTRTAVPSR-KRQRVGRLMVVEA  249
            ME  MS N L+RLP    RN +EDS    SL         T  P + +R++  RL++VEA
Sbjct  1    MEATMSLNPLIRLPISSSRN-VEDSLVRHSL-------VSTRRPHKGQREKHLRLLIVEA  52

Query  250  KGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            KGKKGMAARQYQR  PPPLPK+EDDGNP+FVIFIRMA+V LWYP+N+VTGGTTAKIMVAA
Sbjct  53   KGKKGMAARQYQRTPPPPLPKIEDDGNPRFVIFIRMANVYLWYPINLVTGGTTAKIMVAA  112

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  609
            KDNFLGKYIYKDTL RNLAAVIYRDEKE+QK+A KQ RVLR+ST+FRYGYKLVENNNLR 
Sbjct  113  KDNFLGKYIYKDTLDRNLAAVIYRDEKEIQKMAMKQHRVLRSSTEFRYGYKLVENNNLRA  172

Query  610  ALSTTNIIELPR  645
            ALS+ ++IELPR
Sbjct  173  ALSSNDVIELPR  184



>ref|XP_009606772.1| PREDICTED: uncharacterized protein LOC104101068 [Nicotiana tomentosiformis]
Length=231

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 154/191 (81%), Gaps = 9/191 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGR-LMVVEAK  252
            MEVAMS N LVRLP  N    ED       +      +RT    ++RQ  GR L+VVEAK
Sbjct  1    MEVAMSLNPLVRLPLSNSRTHEDFSIVKHSVFS----SRTTTTQKQRQLHGRRLLVVEAK  56

Query  253  GKKG-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            GKKG MAARQYQR APP +PK+EDDGNPKFVIF+RMA+V LWYPLNIVTGGTTAKIMVAA
Sbjct  57   GKKGGMAARQYQRMAPP-IPKIEDDGNPKFVIFVRMANVYLWYPLNIVTGGTTAKIMVAA  115

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  609
            KDNFLGKYIYKDTLARNLAAVIY DEK +QKLA KQ RVL+++T+FRYGYKLVENNNLR 
Sbjct  116  KDNFLGKYIYKDTLARNLAAVIYNDEKNIQKLAMKQHRVLKSATEFRYGYKLVENNNLRA  175

Query  610  ALSTTNIIELP  642
            ALSTT++IELP
Sbjct  176  ALSTTDVIELP  186



>ref|XP_009780030.1| PREDICTED: uncharacterized protein LOC104229142 [Nicotiana sylvestris]
Length=228

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 153/191 (80%), Gaps = 12/191 (6%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQ-RVGRLMVVEAK  252
            MEVAMS N LVRLP  N    ED   S          TR     ++RQ   GRL+VVEAK
Sbjct  1    MEVAMSLNPLVRLPLSNSRTHEDFSHSVFS-------TRRTTQKKQRQLHGGRLLVVEAK  53

Query  253  GKKG-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            GKKG MAARQYQR APP +PK+EDDGNPKFVIF+RMA+V LWYPLNIVTGGTTAKIMVAA
Sbjct  54   GKKGGMAARQYQRMAPP-IPKIEDDGNPKFVIFVRMANVYLWYPLNIVTGGTTAKIMVAA  112

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  609
            KDNFLGKYIYKDTLARNLAAVIY DEK +QKLA KQ RVL+++T+FRYGYKLVENNNLR 
Sbjct  113  KDNFLGKYIYKDTLARNLAAVIYNDEKNIQKLAMKQHRVLKSATEFRYGYKLVENNNLRA  172

Query  610  ALSTTNIIELP  642
            ALSTT++IELP
Sbjct  173  ALSTTDVIELP  183



>gb|EYU25950.1| hypothetical protein MIMGU_mgv1a012571mg [Erythranthe guttata]
Length=246

 Score =   260 bits (665),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 7/194 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR-LMV  240
            MEV MS N LVRLP       R   ED       +  + ++T  A  S   Q  G+ ++V
Sbjct  1    MEVGMSLNQLVRLPLSSKNGGRRTHEDYSLIRHSLFSTKTTTSAARKSIFGQNQGKSVLV  60

Query  241  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  420
            VEAKGKKGMA RQYQR APPPLPKL+DDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIM
Sbjct  61   VEAKGKKGMAERQYQRKAPPPLPKLDDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIM  120

Query  421  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            +AAKDNFLGKYIYKDTLARNLA+VIYRDEKE+QK+A K FRVLR++T+FRYGYK+VENNN
Sbjct  121  LAAKDNFLGKYIYKDTLARNLASVIYRDEKEIQKMAVKTFRVLRSATEFRYGYKIVENNN  180

Query  601  LRTALSTTNIIELP  642
            +R AL+  ++IELP
Sbjct  181  VRAALAANDVIELP  194



>gb|EYU25951.1| hypothetical protein MIMGU_mgv1a012571mg [Erythranthe guttata]
Length=243

 Score =   260 bits (664),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 153/194 (79%), Gaps = 7/194 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR-LMV  240
            MEV MS N LVRLP       R   ED       +  + ++T  A  S   Q  G+ ++V
Sbjct  1    MEVGMSLNQLVRLPLSSKNGGRRTHEDYSLIRHSLFSTKTTTSAARKSIFGQNQGKSVLV  60

Query  241  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  420
            VEAKGKKGMA RQYQR APPPLPKL+DDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIM
Sbjct  61   VEAKGKKGMAERQYQRKAPPPLPKLDDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIM  120

Query  421  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            +AAKDNFLGKYIYKDTLARNLA+VIYRDEKE+QK+A K FRVLR++T+FRYGYK+VENNN
Sbjct  121  LAAKDNFLGKYIYKDTLARNLASVIYRDEKEIQKMAVKTFRVLRSATEFRYGYKIVENNN  180

Query  601  LRTALSTTNIIELP  642
            +R AL+  ++IELP
Sbjct  181  VRAALAANDVIELP  194



>gb|EPS68757.1| hypothetical protein M569_06012, partial [Genlisea aurea]
Length=223

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 148/190 (78%), Gaps = 10/190 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP---RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  252
            MEV MS NS+V LP    R   ED       +      ++ +   +       L+VVEAK
Sbjct  1    MEVGMSLNSVVALPLSSNRRTHEDYSLIRHSLFSGKVGSKKSCQQK-------LVVVEAK  53

Query  253  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  432
            GKKGM  RQYQRNAPPPLPKLEDDGNPKFVIFIRMA+V LWYPLNIV GGTTAKIMVAAK
Sbjct  54   GKKGMLPRQYQRNAPPPLPKLEDDGNPKFVIFIRMANVYLWYPLNIVNGGTTAKIMVAAK  113

Query  433  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  612
            DNFLGKYIYKDTLARNLAAVIY+DEKE++K+A KQFRVLR++TDFRYGYK+VENNNLR A
Sbjct  114  DNFLGKYIYKDTLARNLAAVIYKDEKEIRKMAVKQFRVLRSATDFRYGYKIVENNNLRAA  173

Query  613  LSTTNIIELP  642
            L+  ++IELP
Sbjct  174  LAANDVIELP  183



>ref|NP_001237795.1| uncharacterized protein LOC100306628 [Glycine max]
 gb|ACU14904.1| unknown [Glycine max]
Length=239

 Score =   258 bits (658),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 150/195 (77%), Gaps = 13/195 (7%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRN--------PMEDsgsssslirhsissTRTAVPSRKRQRVGRLM  237
            MEV MS N+LVRLP  N        PM    S  S  +         VP R +     + 
Sbjct  1    MEVGMSLNALVRLPLSNSRFHDDAAPMIIRHSLFSSRKQQQQQQSYKVPQRHQ-----VF  55

Query  238  VVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKI  417
            VVEAKGKKGM +RQ+QRNAPPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKI
Sbjct  56   VVEAKGKKGMMSRQFQRNAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKI  115

Query  418  MVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENN  597
            MVAAKDNFLGKYIYKDTL RNLAAVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN 
Sbjct  116  MVAAKDNFLGKYIYKDTLDRNLAAVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENG  175

Query  598  NLRTALSTTNIIELP  642
            N+R ALSTT++IELP
Sbjct  176  NIRAALSTTDVIELP  190



>ref|XP_006590262.1| PREDICTED: uncharacterized protein LOC100306628 isoform X1 [Glycine 
max]
Length=236

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 150/195 (77%), Gaps = 13/195 (7%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRN--------PMEDsgsssslirhsissTRTAVPSRKRQRVGRLM  237
            MEV MS N+LVRLP  N        PM    S  S  +         VP R +     + 
Sbjct  1    MEVGMSLNALVRLPLSNSRFHDDAAPMIIRHSLFSSRKQQQQQQSYKVPQRHQ-----VF  55

Query  238  VVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKI  417
            VVEAKGKKGM +RQ+QRNAPPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKI
Sbjct  56   VVEAKGKKGMMSRQFQRNAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKI  115

Query  418  MVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENN  597
            MVAAKDNFLGKYIYKDTL RNLAAVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN 
Sbjct  116  MVAAKDNFLGKYIYKDTLDRNLAAVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENG  175

Query  598  NLRTALSTTNIIELP  642
            N+R ALSTT++IELP
Sbjct  176  NIRAALSTTDVIELP  190



>gb|KHN44402.1| hypothetical protein glysoja_014443 [Glycine soja]
Length=279

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 151/188 (80%), Gaps = 1/188 (1%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP-MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGK  258
            MEV MS N+LVRLP  N    D  +   +     SS +    S K  +  ++ VVEAKGK
Sbjct  1    MEVGMSLNALVRLPLSNSRFHDDAAPMIIRHSLFSSRKQQQQSYKVPQRHQVFVVEAKGK  60

Query  259  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  438
            KGM +RQ+QRNAPPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDN
Sbjct  61   KGMMSRQFQRNAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDN  120

Query  439  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  618
            FLGKYIYKDTL RNLAAVIYRDEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+R ALS
Sbjct  121  FLGKYIYKDTLDRNLAAVIYRDEKEVQKSAFKQYRVLRTATDFRYGYKLVENGNIRAALS  180

Query  619  TTNIIELP  642
            TT++IELP
Sbjct  181  TTDVIELP  188



>ref|XP_006341763.1| PREDICTED: uncharacterized protein LOC102591507 [Solanum tuberosum]
Length=230

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 153/188 (81%), Gaps = 9/188 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEVAMS N LVRLP  N       S        ++ RT   ++KR    +L+VVEAKG+K
Sbjct  1    MEVAMSLNPLVRLPLSNSRNHEDFSLLKHSVVSTTRRT---TQKR----KLLVVEAKGRK  53

Query  262  G-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  438
            G MAARQYQR APP +PK+EDDGNPKFVIFIRMA+V LWYPLNIVTGGTTAKIMVAAKDN
Sbjct  54   GGMAARQYQRMAPP-MPKIEDDGNPKFVIFIRMANVYLWYPLNIVTGGTTAKIMVAAKDN  112

Query  439  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  618
            FLGKYIYKDTLARNLAAVIY DEKE+QKLA KQ RVL+++T+FRYGYKLVENNNLR ALS
Sbjct  113  FLGKYIYKDTLARNLAAVIYNDEKEIQKLAMKQHRVLKSATEFRYGYKLVENNNLRAALS  172

Query  619  TTNIIELP  642
            T+++IELP
Sbjct  173  TSDVIELP  180



>ref|XP_004239174.1| PREDICTED: uncharacterized protein LOC101256588 [Solanum lycopersicum]
Length=226

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 153/190 (81%), Gaps = 13/190 (7%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR--LMVVEAKG  255
            MEVAMS N LVRLP  N         S      S  + +V S   +R+ +  L+VVEAKG
Sbjct  1    MEVAMSLNPLVRLPLSN---------SRTHEEFSVLKHSVVSTTNRRIQKRKLLVVEAKG  51

Query  256  KKG-MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  432
            +KG MAARQYQR APP +PK+EDDGNPKFVIFIRMA+V LWYPLNI+TGGTTAKIMVAAK
Sbjct  52   RKGGMAARQYQRMAPP-MPKIEDDGNPKFVIFIRMANVYLWYPLNIITGGTTAKIMVAAK  110

Query  433  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  612
            DNFLGKYIYKDTLARNLAAVIY DEKE++KLA KQ RVL+++T+FRYGYKLVENNNLR A
Sbjct  111  DNFLGKYIYKDTLARNLAAVIYNDEKEIKKLAMKQHRVLKSATEFRYGYKLVENNNLRAA  170

Query  613  LSTTNIIELP  642
            LST+++IELP
Sbjct  171  LSTSDVIELP  180



>emb|CDY28870.1| BnaC06g26580D [Brassica napus]
Length=227

 Score =   250 bits (639),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 153/187 (82%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ ++RT  P R+  + G + VVEAKGKK
Sbjct  1    MEVSMSLNALARLPLKN--TGRLEEVGLARHSLFTSRT--PCRESAKRGMVFVVEAKGKK  56

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  622  TNIIELP  642
            +++IELP
Sbjct  176  SDVIELP  182



>ref|XP_007163718.1| hypothetical protein PHAVU_001G258300g [Phaseolus vulgaris]
 gb|ESW35712.1| hypothetical protein PHAVU_001G258300g [Phaseolus vulgaris]
Length=234

 Score =   250 bits (638),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 151/193 (78%), Gaps = 14/193 (7%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVG------RLMVV  243
            MEV MS N+L+RLP  N        S  + +     R ++ S +RQ          + VV
Sbjct  1    MEVGMSLNALLRLPPTN--------SRFLHNDDVPVRHSLVSNRRQHRSLKAPPRHVFVV  52

Query  244  EAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMV  423
            EAKGKKGM +RQ+QR+APPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMV
Sbjct  53   EAKGKKGMMSRQFQRSAPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMV  112

Query  424  AAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNL  603
            AAKDNFLGKYIYKDTL RNLAAVIY+DEKE+QK A KQ+RVLR +TDFRYGYKLVEN N+
Sbjct  113  AAKDNFLGKYIYKDTLDRNLAAVIYKDEKEVQKSAFKQYRVLRTATDFRYGYKLVENTNI  172

Query  604  RTALSTTNIIELP  642
            R ALST+++IELP
Sbjct  173  RAALSTSDVIELP  185



>ref|XP_010248828.1| PREDICTED: uncharacterized protein LOC104591617 [Nelumbo nucifera]
Length=223

 Score =   249 bits (637),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 149/186 (80%), Gaps = 10/186 (5%)
 Frame = +1

Query  94   MSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGM  267
            MS N+LVRLP  N    ED     SL              RK+Q   R++VV+AKGKKGM
Sbjct  1    MSLNALVRLPLSNSRSHEDLLVKHSLFSTGT--------GRKQQHRQRVLVVQAKGKKGM  52

Query  268  AARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLG  447
             ARQ+QR  PP LPK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFLG
Sbjct  53   LARQFQRPPPPSLPKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFLG  112

Query  448  KYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN  627
            KYIYKDT+ARNLAAVIYRDEKE+QK A +Q+RVLR++TDFRYGYKLVEN+N+R A+STT+
Sbjct  113  KYIYKDTIARNLAAVIYRDEKEIQKTAFRQYRVLRSTTDFRYGYKLVENSNVRAAISTTD  172

Query  628  IIELPR  645
            +IELPR
Sbjct  173  VIELPR  178



>ref|XP_010415350.1| PREDICTED: uncharacterized protein LOC104701376 isoform X2 [Camelina 
sativa]
Length=230

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N            RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGSARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_010415348.1| PREDICTED: uncharacterized protein LOC104701376 isoform X1 [Camelina 
sativa]
Length=231

 Score =   249 bits (636),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N            RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGSARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_008444407.1| PREDICTED: uncharacterized protein LOC103487745 [Cucumis melo]
Length=231

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/189 (70%), Positives = 146/189 (77%), Gaps = 9/189 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            M+VAMS N+LVRLP  N    ED     SL        RT        R  R  VVEAKG
Sbjct  1    MDVAMSLNALVRLPLSNSKLHEDGLVRHSLFS-----ARTMHKPEHTYR--RAFVVEAKG  53

Query  256  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            KKGM +R  QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKD
Sbjct  54   KKGMQSRLSQRPGPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKD  113

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            NFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+AL
Sbjct  114  NFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSAL  173

Query  616  STTNIIELP  642
            STT++IELP
Sbjct  174  STTDVIELP  182



>gb|KJB78038.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
 gb|KJB78039.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
Length=237

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 157/194 (81%), Gaps = 8/194 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP-------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMV  240
            MEV MS N+LVRLP          P+ D     SL+    +  R    +R+RQ  G ++V
Sbjct  1    MEVGMSLNALVRLPLSSTSRAHHEPV-DGLVKHSLLSSRTTPLRLPQQTRRRQHGGGMLV  59

Query  241  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  420
            VEAKGKKGMAARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIM
Sbjct  60   VEAKGKKGMAARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIM  119

Query  421  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            VAAKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N
Sbjct  120  VAAKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGN  179

Query  601  LRTALSTTNIIELP  642
            +++ALST ++IELP
Sbjct  180  VKSALSTNDVIELP  193



>gb|KJB78040.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
 gb|KJB78041.1| hypothetical protein B456_012G174200 [Gossypium raimondii]
Length=241

 Score =   249 bits (636),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 157/194 (81%), Gaps = 8/194 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP-------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMV  240
            MEV MS N+LVRLP          P+ D     SL+    +  R    +R+RQ  G ++V
Sbjct  1    MEVGMSLNALVRLPLSSTSRAHHEPV-DGLVKHSLLSSRTTPLRLPQQTRRRQHGGGMLV  59

Query  241  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  420
            VEAKGKKGMAARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIM
Sbjct  60   VEAKGKKGMAARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIM  119

Query  421  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            VAAKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N
Sbjct  120  VAAKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGN  179

Query  601  LRTALSTTNIIELP  642
            +++ALST ++IELP
Sbjct  180  VKSALSTNDVIELP  193



>ref|XP_004142952.1| PREDICTED: uncharacterized protein LOC101203734 isoform 2 [Cucumis 
sativus]
 ref|XP_004159564.1| PREDICTED: uncharacterized protein LOC101226204 isoform 2 [Cucumis 
sativus]
Length=228

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 148/189 (78%), Gaps = 9/189 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            MEVAMS N+LVRLP  N   +ED     SL        RT        R  R ++VEAKG
Sbjct  1    MEVAMSLNALVRLPLSNSKLLEDGVVRHSLFS-----ARTMHKPHHTYR--RPLLVEAKG  53

Query  256  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            KKGM +R  QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKD
Sbjct  54   KKGMQSRLSQRPGPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKD  113

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            NF+GKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+AL
Sbjct  114  NFVGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSAL  173

Query  616  STTNIIELP  642
            STT++IELP
Sbjct  174  STTDVIELP  182



>ref|XP_004142951.1| PREDICTED: uncharacterized protein LOC101203734 isoform 1 [Cucumis 
sativus]
 ref|XP_004159563.1| PREDICTED: uncharacterized protein LOC101226204 isoform 1 [Cucumis 
sativus]
 gb|KGN62348.1| hypothetical protein Csa_2G350310 [Cucumis sativus]
Length=231

 Score =   249 bits (635),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 148/189 (78%), Gaps = 9/189 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            MEVAMS N+LVRLP  N   +ED     SL        RT        R  R ++VEAKG
Sbjct  1    MEVAMSLNALVRLPLSNSKLLEDGVVRHSLFS-----ARTMHKPHHTYR--RPLLVEAKG  53

Query  256  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            KKGM +R  QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++ GGTTAKIMVAAKD
Sbjct  54   KKGMQSRLSQRPGPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLINGGTTAKIMVAAKD  113

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            NF+GKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVLR +T+FRYGYKLVEN NLR+AL
Sbjct  114  NFVGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLRTATEFRYGYKLVENGNLRSAL  173

Query  616  STTNIIELP  642
            STT++IELP
Sbjct  174  STTDVIELP  182



>ref|NP_564903.3| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8LDL0.1|HHL1_ARATH RecName: Full=Protein HHL1, chloroplastic; AltName: Full=Hypersensitive 
to high light 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM63154.1| unknown [Arabidopsis thaliana]
 dbj|BAH19661.1| AT1G67700 [Arabidopsis thaliana]
 gb|AEE34684.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=231

 Score =   248 bits (634),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|NP_850972.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK91348.1| At1g67700/F12A21_30 [Arabidopsis thaliana]
 gb|AAM51570.1| At1g67700/F12A21_30 [Arabidopsis thaliana]
 gb|AEE34683.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=230

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_010511723.1| PREDICTED: uncharacterized protein LOC104787786 isoform X2 [Camelina 
sativa]
Length=230

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEGGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_010511722.1| PREDICTED: uncharacterized protein LOC104787786 isoform X1 [Camelina 
sativa]
Length=231

 Score =   248 bits (634),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 152/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEGGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_011457438.1| PREDICTED: uncharacterized protein LOC101291014 [Fragaria vesca 
subsp. vesca]
Length=230

 Score =   248 bits (632),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 6/188 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAV-PSRKRQRVGRLMVVEAKGK  258
            MEV MS N++VRLP  +              +  +T+ A  PS      G+ +VVEAKGK
Sbjct  1    MEVGMSLNAVVRLPLSSSRTHEDGLVRHSLVTSKTTQKACKPSH-----GQTLVVEAKGK  55

Query  259  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  438
            KGM  RQ+QR  PPP+PK+EDDGNP+FV+FIRMA+V LWYPL++++GGTTAKIM+AAKDN
Sbjct  56   KGMQDRQFQRRQPPPMPKIEDDGNPRFVVFIRMANVYLWYPLSVISGGTTAKIMLAAKDN  115

Query  439  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  618
            FLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++T+FRYGYK+VEN N+R AL+
Sbjct  116  FLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKIVENGNMRAALA  175

Query  619  TTNIIELP  642
            T+++IELP
Sbjct  176  TSDVIELP  183



>ref|XP_010690008.1| PREDICTED: uncharacterized protein LOC104903638 [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   248 bits (632),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS NSL+RLP ++        +S+IRHS+ STR   P    Q++    VVEAKGKK
Sbjct  1    MEVSMSLNSLIRLPMKSKSRTVDEYTSIIRHSLHSTRPKFPKNLHQKLQ--FVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GM  RQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPLN+VTGGTTAKIMVAAKDN 
Sbjct  59   GMMTRQFQRPGPPPLPKIEDDGNPRFVIFIRMANVYLWYPLNLVTGGTTAKIMVAAKDNI  118

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARNLAAV+Y+DEK L K+A+KQFR LR +TDFRYGYKLVEN ++RTAL+ 
Sbjct  119  LGKYIYKDTIARNLAAVVYQDEKGLIKIAQKQFRTLRTATDFRYGYKLVENADVRTALTP  178

Query  622  TNIIELP  642
             ++IELP
Sbjct  179  KDVIELP  185



>ref|XP_006302772.1| hypothetical protein CARUB_v10020893mg [Capsella rubella]
 gb|EOA35670.1| hypothetical protein CARUB_v10020893mg [Capsella rubella]
Length=231

 Score =   248 bits (632),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+     VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMAFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_006438141.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51381.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
Length=227

 Score =   247 bits (631),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  273
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+GM A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGMQA  57

Query  274  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  453
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  454  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  633
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  634  ELP  642
            ELP
Sbjct  178  ELP  180



>ref|XP_006438139.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 ref|XP_006438140.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51379.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
 gb|ESR51380.1| hypothetical protein CICLE_v10032669mg [Citrus clementina]
Length=226

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  273
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+GM A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGMQA  57

Query  274  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  453
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  454  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  633
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  634  ELP  642
            ELP
Sbjct  178  ELP  180



>ref|XP_009105310.1| PREDICTED: uncharacterized protein LOC103831192 isoform X1 [Brassica 
rapa]
Length=231

 Score =   247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ ++RT    R ++R  + +VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRLEEFGLARHSLFTSRTPCLERAQRR--KALVVEAKGKK  56

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  622  TNIIELP  642
            +++IELP
Sbjct  176  SDVIELP  182



>emb|CDX96071.1| BnaA07g26600D [Brassica napus]
Length=228

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ ++RT    R ++R  + +VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRLEEFGLARHSLFTSRTPCLERAQRR--KALVVEAKGKK  56

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  622  TNIIELP  642
            +++IELP
Sbjct  176  SDVIELP  182



>emb|CDY07411.1| BnaA07g24900D [Brassica napus]
Length=227

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 152/187 (81%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ ++RT  P R+  +   + VVEAKGKK
Sbjct  1    MEVSMSLNALARLPLKN--TGRLEEVGLARHSLFTSRT--PCRESTKRRMVFVVEAKGKK  56

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  622  TNIIELP  642
            +++IELP
Sbjct  176  SDVIELP  182



>ref|XP_010470686.1| PREDICTED: uncharacterized protein LOC104750573 isoform X2 [Camelina 
sativa]
Length=230

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q    + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRFEEVGLARHSLFSSRTACRETAVQPRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_010470685.1| PREDICTED: uncharacterized protein LOC104750573 isoform X1 [Camelina 
sativa]
Length=231

 Score =   247 bits (630),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q    + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRFEEVGLARHSLFSSRTACRETAVQPRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+E+DGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEEDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR++TDFRYGYKLVEN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRSATDFRYGYKLVENGNMRAALST  177

Query  622  TNIIELP  642
            +++IELP
Sbjct  178  SDVIELP  184



>ref|XP_009105106.1| PREDICTED: uncharacterized protein LOC103831017 [Brassica rapa]
Length=249

 Score =   247 bits (631),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 153/189 (81%), Gaps = 5/189 (3%)
 Frame = +1

Query  76   QKMEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            + MEV+MS N+L RLP +N          L RHS+ ++RT  P R+  +   + VVEAKG
Sbjct  21   RSMEVSMSLNALARLPLKN--TGRLEEVGLARHSLFTSRT--PCRESTKRRMVFVVEAKG  76

Query  256  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            KKGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKD
Sbjct  77   KKGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKD  135

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            N LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R AL
Sbjct  136  NLLGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAAL  195

Query  616  STTNIIELP  642
            ST+++IELP
Sbjct  196  STSDVIELP  204



>ref|XP_009105311.1| PREDICTED: uncharacterized protein LOC103831192 isoform X2 [Brassica 
rapa]
Length=228

 Score =   246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 153/187 (82%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ ++RT    R ++R  + +VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKN--TGRLEEFGLARHSLFTSRTPCLERAQRR--KALVVEAKGKK  56

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  57   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALST  175

Query  622  TNIIELP  642
            +++IELP
Sbjct  176  SDVIELP  182



>gb|KDP26738.1| hypothetical protein JCGZ_17896 [Jatropha curcas]
Length=226

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 152/187 (81%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV +S N+LVRLP  N          L++HS+ ++RT   S+ R+    L+VV AKGK+
Sbjct  1    MEVGLSLNALVRLPLSN--SSRTHEDVLVKHSLFTSRTGQKSQHRKT---LLVVNAKGKR  55

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GM ARQ+QR   P LPK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKI VAAKDNF
Sbjct  56   GMQARQFQRPPAPSLPKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKITVAAKDNF  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++T+FRYGYKLVEN N+R ALST
Sbjct  116  LGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATEFRYGYKLVENGNMRAALST  175

Query  622  TNIIELP  642
            +++IELP
Sbjct  176  SDVIELP  182



>ref|XP_006484021.1| PREDICTED: uncharacterized protein LOC102611015 [Citrus sinensis]
 gb|KDO82052.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=227

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  273
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  274  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  453
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  454  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  633
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  634  ELP  642
            ELP
Sbjct  178  ELP  180



>gb|KDO82054.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
 gb|KDO82055.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=226

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 151/183 (83%), Gaps = 3/183 (2%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  273
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  274  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  453
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  454  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  633
            IYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGNLRAALSTSDVI  177

Query  634  ELP  642
            ELP
Sbjct  178  ELP  180



>gb|KHG12697.1| Multidrug resistance pgp-1 [Gossypium arboreum]
Length=237

 Score =   246 bits (627),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 156/194 (80%), Gaps = 8/194 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP-------RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMV  240
            MEV MS N+LVRLP          P+ D     SL     ++ R    +R+++  G ++V
Sbjct  1    MEVGMSLNALVRLPLSSTSRAHHEPV-DGLVKHSLFSSRTTTLRLPQQTRRQKHGGGMLV  59

Query  241  VEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIM  420
            VEAKGKKGMAARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V+LWYPL+++TGGTTAKIM
Sbjct  60   VEAKGKKGMAARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVNLWYPLSLITGGTTAKIM  119

Query  421  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            VAAKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLVEN N
Sbjct  120  VAAKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLVENGN  179

Query  601  LRTALSTTNIIELP  642
            ++ ALST ++IELP
Sbjct  180  VKAALSTNDVIELP  193



>ref|XP_011042325.1| PREDICTED: uncharacterized protein LOC105138036 [Populus euphratica]
Length=237

 Score =   246 bits (627),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTR--TAVPSRKRQRVGR-LMVVEAK  252
            MEV MS N+LVRLP    M        L++HS+ STR  TA  S K+Q  G  L+VV+AK
Sbjct  1    MEVGMSLNALVRLPSSRTMSPHEDGGGLVKHSLFSTRKSTAQTSPKKQGQGHMLLVVKAK  60

Query  253  GKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            GKKG+  RQ+QR  P P LPK+EDDGNPKF+IFIR A+V LWYPL+++TGGTTAKIMVAA
Sbjct  61   GKKGIQTRQFQRPPPTPSLPKIEDDGNPKFLIFIRAANVYLWYPLSLITGGTTAKIMVAA  120

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  609
            KDNFLGKYIYKDTLARNLAAVIY+DEKE+QK A KQ RVLR++T+FRYGYKLVEN NLR 
Sbjct  121  KDNFLGKYIYKDTLARNLAAVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNLRA  180

Query  610  ALSTTNIIELP  642
            ALS T++IELP
Sbjct  181  ALSITDVIELP  191



>ref|XP_002314565.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 ref|XP_006378275.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 gb|ABK95743.1| unknown [Populus trichocarpa]
 gb|EEF00736.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
 gb|ERP56072.1| hypothetical protein POPTR_0010s06350g [Populus trichocarpa]
Length=237

 Score =   246 bits (627),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 8/193 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTR--TAVPSRKRQRVGR-LMVVEAK  252
            MEV MS N+LVRLP    M        L++H++ STR  TA  S K+Q  G  L+VV+AK
Sbjct  1    MEVGMSLNALVRLPSSRTMLLHEDGGGLLKHTLFSTRKSTAQTSPKKQGQGHMLLVVKAK  60

Query  253  GKKGMAARQYQRNAPPP---LPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMV  423
            GKKGM  RQ+QR  PPP   LPK+EDDGNPKF+IFIR+A+V LWYPL+++TGGTTAKIMV
Sbjct  61   GKKGMQTRQFQR--PPPTLSLPKIEDDGNPKFLIFIRVANVYLWYPLSLITGGTTAKIMV  118

Query  424  AAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNL  603
            AAKDNFLGKYIYKDTLARNLAAVIY+DEKE+QK A KQ RVLR++T+FRYGYKLVEN NL
Sbjct  119  AAKDNFLGKYIYKDTLARNLAAVIYKDEKEIQKTAFKQHRVLRSATEFRYGYKLVENGNL  178

Query  604  RTALSTTNIIELP  642
            R ALS T++IELP
Sbjct  179  RAALSITDVIELP  191



>ref|XP_006391234.1| hypothetical protein EUTSA_v10019020mg [Eutrema salsugineum]
 gb|ESQ28520.1| hypothetical protein EUTSA_v10019020mg [Eutrema salsugineum]
Length=259

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 153/190 (81%), Gaps = 9/190 (5%)
 Frame = +1

Query  79   KMEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  252
            KMEV+MS N+L RLP +N   +E++G +   +  S ++ R +V  R       + VVEAK
Sbjct  28   KMEVSMSLNALARLPLKNTGRLEEAGLARHSLFTSRTACRESVQRRM------VFVVEAK  81

Query  253  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  432
            GKKGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAK
Sbjct  82   GKKGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAK  140

Query  433  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  612
            DN LGKYIYKDT+ARN+AAVIY+DEKE+QK A KQ RVLR + +FRYGYKLVEN N+R A
Sbjct  141  DNLLGKYIYKDTIARNIAAVIYKDEKEIQKTAIKQHRVLRTAKEFRYGYKLVENGNMRAA  200

Query  613  LSTTNIIELP  642
            LST+++IELP
Sbjct  201  LSTSDVIELP  210



>ref|XP_002515011.1| oligopeptidase, putative [Ricinus communis]
 gb|EEF47565.1| oligopeptidase, putative [Ricinus communis]
Length=233

 Score =   243 bits (620),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV +S N+LVRLP  N          + +H++ STRT V  +K  +   L+VV+AKGK+
Sbjct  1    MEVGLSLNALVRLPLSNSSR-IHHEDGVAKHTLFSTRT-VTLQKSLKKQTLLVVKAKGKR  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GM +RQ+QR   P LPK+EDDGNPKF+IFIRMA+V LWYPL++VTGGTTAKIMVAAKDNF
Sbjct  59   GMQSRQFQRPPAPSLPKIEDDGNPKFLIFIRMANVYLWYPLSLVTGGTTAKIMVAAKDNF  118

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYK+TL RNLAAVIYRDEKE+QK A KQFRVLR++T+FRYGYKLVEN N+R ALST
Sbjct  119  LGKYIYKNTLDRNLAAVIYRDEKEIQKTAFKQFRVLRSATEFRYGYKLVENGNVRAALST  178

Query  622  TNIIELP  642
            T++IELP
Sbjct  179  TDVIELP  185



>ref|XP_008807203.1| PREDICTED: uncharacterized protein LOC103719642 [Phoenix dactylifera]
Length=235

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 145/187 (78%), Gaps = 1/187 (1%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEVAMS   L RLP  N  +     + +   S    R     R+ ++  +LMVVEAKGKK
Sbjct  1    MEVAMSVRGLARLPLSNS-KVIAHENGVFLGSPLPLRNPTSRRQSEKKRQLMVVEAKGKK  59

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GM  RQ+QR  PP LPK+EDDGNP+FVIFIR  +V LWYPL+++TGGTTAKIMVAAKDNF
Sbjct  60   GMMGRQFQRPPPPALPKIEDDGNPRFVIFIRTTNVYLWYPLSLITGGTTAKIMVAAKDNF  119

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARNLAAVIYRDEKE+QK A KQ+RVLR++T FRYGYKLVENNNLR ALST
Sbjct  120  LGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLVENNNLRAALST  179

Query  622  TNIIELP  642
             ++IELP
Sbjct  180  NDVIELP  186



>ref|XP_010556180.1| PREDICTED: uncharacterized protein LOC104825532 isoform X1 [Tarenaya 
hassleriana]
Length=234

 Score =   243 bits (620),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 10/192 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissT---RTAVPSRKRQRVGRLMVVE  246
            MEV MS N+LV+LP RN   +ED G        +   T    +A P R+R      +VVE
Sbjct  1    MEVGMSLNALVQLPLRNSGRLEDGGGFVKHHCLAGWRTGFRDSAAPRRRRG-----LVVE  55

Query  247  AKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVA  426
            AKGKKGMAARQYQR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVA
Sbjct  56   AKGKKGMAARQYQRPPPPPLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVA  115

Query  427  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  606
            AKDN LGKYIYKDT+ARNLAAVIY+DEKE+QK A KQFRVLR +T+FRYGYKLVEN N+R
Sbjct  116  AKDNLLGKYIYKDTIARNLAAVIYKDEKEIQKTAFKQFRVLRNATEFRYGYKLVENGNVR  175

Query  607  TALSTTNIIELP  642
             AL+TT++IELP
Sbjct  176  AALTTTDVIELP  187



>ref|XP_010556182.1| PREDICTED: uncharacterized protein LOC104825532 isoform X2 [Tarenaya 
hassleriana]
Length=233

 Score =   243 bits (619),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 10/192 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissT---RTAVPSRKRQRVGRLMVVE  246
            MEV MS N+LV+LP RN   +ED G        +   T    +A P R+R      +VVE
Sbjct  1    MEVGMSLNALVQLPLRNSGRLEDGGGFVKHHCLAGWRTGFRDSAAPRRRRG-----LVVE  55

Query  247  AKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVA  426
            AKGKKGMAARQYQR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVA
Sbjct  56   AKGKKGMAARQYQRPPPPPLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVA  115

Query  427  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  606
            AKDN LGKYIYKDT+ARNLAAVIY+DEKE+QK A KQFRVLR +T+FRYGYKLVEN N+R
Sbjct  116  AKDNLLGKYIYKDTIARNLAAVIYKDEKEIQKTAFKQFRVLRNATEFRYGYKLVENGNVR  175

Query  607  TALSTTNIIELP  642
             AL+TT++IELP
Sbjct  176  AALTTTDVIELP  187



>ref|NP_001185346.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34685.1| uncharacterized protein AT1G67700 [Arabidopsis thaliana]
Length=229

 Score =   242 bits (618),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV+MS N+L RLP +N          L RHS+ S+RTA      Q+   + VVEAKGKK
Sbjct  1    MEVSMSLNALTRLPLKNT--GRFEEVGLARHSLFSSRTACRETAVQQRRMVFVVEAKGKK  58

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN 
Sbjct  59   GMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDNL  117

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKL EN N+R ALST
Sbjct  118  LGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKL-ENGNMRAALST  176

Query  622  TNIIELP  642
            +++IELP
Sbjct  177  SDVIELP  183



>ref|XP_002272215.2| PREDICTED: uncharacterized protein LOC100256260 isoform X1 [Vitis 
vinifera]
Length=229

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 153/186 (82%), Gaps = 9/186 (5%)
 Frame = +1

Query  88   VAMSFNS-LVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKG  264
            V +S N+ LVR P  N      S    I+HSI STRT   S+K+    R +VVEAKGK+G
Sbjct  4    VGLSLNAALVRTPLSN---SRASEDGFIKHSIFSTRTVPKSQKK----RALVVEAKGKRG  56

Query  265  MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFL  444
            M  RQ+QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFL
Sbjct  57   MQGRQFQRQ-PPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFL  115

Query  445  GKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT  624
            GKYIY+DT+ARNLAAVIY+DEKE+QK A +Q+RVLR++ +FRYGYKLVENNN+R+ALSTT
Sbjct  116  GKYIYRDTIARNLAAVIYKDEKEIQKTAFRQYRVLRSAKEFRYGYKLVENNNVRSALSTT  175

Query  625  NIIELP  642
            ++IELP
Sbjct  176  DVIELP  181



>ref|XP_010655080.1| PREDICTED: uncharacterized protein LOC100256260 isoform X2 [Vitis 
vinifera]
Length=226

 Score =   238 bits (607),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 153/186 (82%), Gaps = 9/186 (5%)
 Frame = +1

Query  88   VAMSFNS-LVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKG  264
            V +S N+ LVR P  N      S    I+HSI STRT   S+K+    R +VVEAKGK+G
Sbjct  4    VGLSLNAALVRTPLSN---SRASEDGFIKHSIFSTRTVPKSQKK----RALVVEAKGKRG  56

Query  265  MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFL  444
            M  RQ+QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+++TGGTTAKIMVAAKDNFL
Sbjct  57   MQGRQFQRQ-PPPLPKIEDDGNPKFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKDNFL  115

Query  445  GKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTT  624
            GKYIY+DT+ARNLAAVIY+DEKE+QK A +Q+RVLR++ +FRYGYKLVENNN+R+ALSTT
Sbjct  116  GKYIYRDTIARNLAAVIYKDEKEIQKTAFRQYRVLRSAKEFRYGYKLVENNNVRSALSTT  175

Query  625  NIIELP  642
            ++IELP
Sbjct  176  DVIELP  181



>ref|XP_009403641.1| PREDICTED: uncharacterized protein LOC103987153 [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   238 bits (607),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGR-LMVVEAKGKKGM-  267
            MS  SLVRLP  NP        +      S   +     KRQ+  R L+VVEAKGK+GM 
Sbjct  1    MSMGSLVRLPTCNPKGALLQEDARFFLRGSPLASVTTGNKRQQRRRNLLVVEAKGKRGMM  60

Query  268  AARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLG  447
            A RQ QR  PP LPK+EDDGNP+FV+FIR ++V LWYPL+I++GGTTAKIMVAAKDNFLG
Sbjct  61   AGRQSQRPPPPRLPKIEDDGNPRFVVFIRTSNVYLWYPLSIISGGTTAKIMVAAKDNFLG  120

Query  448  KYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN  627
            KYIYKDT+ARN+AAVIYRDEKE+QK A KQ+RVLR++T FRYGYKLVENNNLR A+ST+N
Sbjct  121  KYIYKDTIARNIAAVIYRDEKEIQKTAVKQYRVLRSATSFRYGYKLVENNNLRAAISTSN  180

Query  628  IIELP  642
            +IELP
Sbjct  181  VIELP  185



>ref|XP_007044959.1| Uncharacterized protein TCM_010707 [Theobroma cacao]
 gb|EOY00791.1| Uncharacterized protein TCM_010707 [Theobroma cacao]
Length=258

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 154/209 (74%), Gaps = 22/209 (11%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP----RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEA  249
            MEV MS N+LVRLP     R   E           S  +T     S++RQ+ G ++VVEA
Sbjct  1    MEVGMSLNALVRLPLSSTSRTHHESLDGLVKHSLFSSRTTTWQQQSQRRQQRGGMLVVEA  60

Query  250  KGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            KGKKGMAARQ+QR  PPP+PK+EDDGNP+FVIFIRMA V+LWYPL+++TGGTTAKIMVAA
Sbjct  61   KGKKGMAARQFQRPPPPPMPKIEDDGNPRFVIFIRMAGVNLWYPLSLITGGTTAKIMVAA  120

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV-------  588
            KDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++TDFRYGYKLV       
Sbjct  121  KDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATDFRYGYKLVMMEKFAN  180

Query  589  -----------ENNNLRTALSTTNIIELP  642
                       EN N+R+ALST ++IELP
Sbjct  181  SFSEFCVLNIQENGNVRSALSTNDVIELP  209



>ref|XP_003601843.1| hypothetical protein MTR_3g086040 [Medicago truncatula]
 gb|AES72094.1| plant/F12A21-30 protein, putative [Medicago truncatula]
 gb|AFK48802.1| unknown [Medicago truncatula]
Length=227

 Score =   235 bits (599),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 146/187 (78%), Gaps = 5/187 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV MS N+L+  P  +      SS        S  R    ++++ +   ++VVEAK KK
Sbjct  1    MEVGMSLNALLHPPLSS-----SSSRFHNDSLFSMPRQFPRTQRQHQHHHVLVVEAKSKK  55

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GM +RQYQR  PPPLPK+EDDGNPKFV+FIRMA+V LWYPL+IV+GGTTAKIMVAAKDNF
Sbjct  56   GMMSRQYQRQPPPPLPKIEDDGNPKFVVFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNF  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALST  621
            LGK+IYKDTL RNLAAVIYRDEKE+QK A KQ RVL+++T+FRYGYKLVEN N++ ALST
Sbjct  116  LGKFIYKDTLDRNLAAVIYRDEKEIQKSAFKQHRVLKSATEFRYGYKLVENGNVKAALST  175

Query  622  TNIIELP  642
            +++I+LP
Sbjct  176  SDVIQLP  182



>ref|XP_010930033.1| PREDICTED: uncharacterized protein LOC105051352 isoform X2 [Elaeis 
guineensis]
Length=235

 Score =   235 bits (599),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 147/190 (77%), Gaps = 7/190 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP---MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  252
            MEVAMS  +L RLP  N      ++G          S T   V  +KRQ    LMVVEAK
Sbjct  1    MEVAMSVRALARLPLSNSKVTAHENGVFLGSPLPLRSQTSRRVSEKKRQ----LMVVEAK  56

Query  253  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  432
            GK+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIR   V LWYPL++VTGGTTAKIMVAAK
Sbjct  57   GKRGMMARQFQRPPPPPLPKIEDDGNPRFVIFIRTTKVYLWYPLSVVTGGTTAKIMVAAK  116

Query  433  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  612
            DNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A
Sbjct  117  DNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAA  176

Query  613  LSTTNIIELP  642
            +ST ++IELP
Sbjct  177  ISTNDVIELP  186



>emb|CDY01837.1| BnaC06g28770D [Brassica napus]
Length=982

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = +1

Query  79   KMEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGK  258
            +MEV+MS N+L RLP +N         +      S T     +++R++V   +VVEAKGK
Sbjct  753  QMEVSMSLNALTRLPLKNTGRLEEFGLARHSLFTSRTSCLETAQRRRKV---LVVEAKGK  809

Query  259  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  438
            KGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN
Sbjct  810  KGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDN  868

Query  439  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALS  618
             LGKYIYKDT+ARN+AAVIYRDEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALS
Sbjct  869  LLGKYIYKDTIARNIAAVIYRDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALS  928

Query  619  TTNIIELP  642
            T+++IELP
Sbjct  929  TSDVIELP  936



>ref|XP_010930032.1| PREDICTED: uncharacterized protein LOC105051352 isoform X1 [Elaeis 
guineensis]
Length=237

 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 147/192 (77%), Gaps = 9/192 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP---MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  252
            MEVAMS  +L RLP  N      ++G          S T   V  +KRQ    LMVVEAK
Sbjct  1    MEVAMSVRALARLPLSNSKVTAHENGVFLGSPLPLRSQTSRRVSEKKRQ----LMVVEAK  56

Query  253  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVD--LWYPLNIVTGGTTAKIMVA  426
            GK+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIR   V   LWYPL++VTGGTTAKIMVA
Sbjct  57   GKRGMMARQFQRPPPPPLPKIEDDGNPRFVIFIRTTKVSVYLWYPLSVVTGGTTAKIMVA  116

Query  427  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  606
            AKDNFLGKYIYKDT+ARNLAAVIYRDEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR
Sbjct  117  AKDNFLGKYIYKDTIARNLAAVIYRDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLR  176

Query  607  TALSTTNIIELP  642
             A+ST ++IELP
Sbjct  177  AAISTNDVIELP  188



>ref|XP_007223900.1| hypothetical protein PRUPE_ppa010899mg [Prunus persica]
 gb|EMJ25099.1| hypothetical protein PRUPE_ppa010899mg [Prunus persica]
Length=231

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 145/189 (77%), Gaps = 6/189 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            ME  MS N++VRLP    +  S +    +      + T    +  QR GR +VVEAK K+
Sbjct  1    MEAGMSLNAVVRLP----LSSSRTHEDGLVRHSLVSTTTTTQKAEQRQGRKLVVEAKSKR  56

Query  262  GMAARQYQRNAPPPLPK--LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            GM ARQ+Q   PPP     +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIMVAAKD
Sbjct  57   GMMARQFQAKKPPPPAMPKIEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMVAAKD  116

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            NFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R AL
Sbjct  117  NFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRAAL  176

Query  616  STTNIIELP  642
            ST+++IELP
Sbjct  177  STSDVIELP  185



>ref|XP_008389783.1| PREDICTED: uncharacterized protein LOC103452079 [Malus domestica]
Length=236

 Score =   231 bits (589),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 150/191 (79%), Gaps = 8/191 (4%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            MEV +S N+ VRLP  +    ED     SL+      T T   + +RQ V R +VVE+KG
Sbjct  1    MEVGLSLNAAVRLPLSSSRTHEDGLVRHSLVSTK---TTTQKAAEQRQ-VRRALVVESKG  56

Query  256  KKGMAARQYQRNAPPPLP--KLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            K+GM ARQ+Q   PPP    K+EDDGNP+FV+FIRMA+V LWYPL++++GGTTAKIM+AA
Sbjct  57   KRGMMARQFQPKRPPPPAMPKIEDDGNPRFVVFIRMANVYLWYPLSVISGGTTAKIMIAA  116

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  609
            KDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R 
Sbjct  117  KDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRA  176

Query  610  ALSTTNIIELP  642
            ALST+++IELP
Sbjct  177  ALSTSDVIELP  187



>ref|XP_004502335.1| PREDICTED: uncharacterized protein LOC101493538 [Cicer arietinum]
Length=232

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTR-TAVPSRKRQRVGRLMVVEAKGK  258
            MEV MS N+LVR P  +        SS      S  R T+  + +RQ V   +VVEAKGK
Sbjct  1    MEVGMSLNALVRPPLSSSGSRFHDDSSFSHFLFSIPRHTSGKTHQRQHV---LVVEAKGK  57

Query  259  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  438
            KGM +RQ+QR  PPPLPK+EDDGNPKFVIFIRMA+V LWYPL+IV+GGTTAKIMVAAKDN
Sbjct  58   KGMMSRQFQRPPPPPLPKIEDDGNPKFVIFIRMANVYLWYPLSIVSGGTTAKIMVAAKDN  117

Query  439  FLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN-NNLRTAL  615
            FLGKYIYKDTL RNLAAVIY+DEKE+QK A KQ R LR++T+FRYGYKLVEN NN+R AL
Sbjct  118  FLGKYIYKDTLDRNLAAVIYKDEKEIQKSAFKQHRTLRSATEFRYGYKLVENYNNVRAAL  177

Query  616  STTNIIELP  642
            STT++IELP
Sbjct  178  STTDVIELP  186



>ref|XP_010025366.1| PREDICTED: uncharacterized protein LOC104415723 [Eucalyptus grandis]
 gb|KCW62010.1| hypothetical protein EUGRSUZ_H04690 [Eucalyptus grandis]
Length=240

 Score =   230 bits (587),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 146/189 (77%), Gaps = 2/189 (1%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            MEV MS N+ VRLP        D     +    S S    A  +R  +R    +VVEAKG
Sbjct  1    MEVGMSLNATVRLPLTGSRVAHDDSPGLARHSLSTSRAAAAAAARGPRRGRPPLVVEAKG  60

Query  256  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            K+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIRMA+V LWYPL+++TGGTTAKIMVAAKD
Sbjct  61   KRGMQARQFQRPPPPPLPKIEDDGNPRFVIFIRMANVYLWYPLSLITGGTTAKIMVAAKD  120

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            NFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ RVLR +T+FRYGYK+VEN N+R AL
Sbjct  121  NFLGKYIYKDTLARNLAAVIYRDEKEIQKTALKQHRVLRTATEFRYGYKIVENGNVRAAL  180

Query  616  STTNIIELP  642
            STT++IELP
Sbjct  181  STTDVIELP  189



>ref|XP_008221980.1| PREDICTED: uncharacterized protein LOC103321904 [Prunus mume]
Length=235

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 9/191 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            ME  MS N++VRLP  +    ED     SL+  + ++T+ A      QR GR +VV+AK 
Sbjct  1    MEAGMSLNAVVRLPLSSSRTHEDGLVRHSLVSTTTTTTQKA-----EQRQGRKLVVQAKS  55

Query  256  KKGMAARQYQRNAPPPLPK--LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAA  429
            K+GM ARQ+Q   PPP     +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIMVAA
Sbjct  56   KRGMMARQFQAKKPPPPAMPKIEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMVAA  115

Query  430  KDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRT  609
            KDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R 
Sbjct  116  KDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMRA  175

Query  610  ALSTTNIIELP  642
            ALST+++IELP
Sbjct  176  ALSTSDVIELP  186



>ref|XP_006852149.1| hypothetical protein AMTR_s00049p00073250 [Amborella trichopoda]
 gb|ERN13616.1| hypothetical protein AMTR_s00049p00073250 [Amborella trichopoda]
Length=265

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +1

Query  205  SRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPL  384
            SR+ +  G  MVV AKG++G+  R++QR A PPLPKLEDDGNPKFVIFIR A V LWYPL
Sbjct  48   SRREENSG-FMVVTAKGRRGVQDRKFQRPALPPLPKLEDDGNPKFVIFIRTAKVYLWYPL  106

Query  385  NIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTD  564
            ++VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A K++RVLR++++
Sbjct  107  SVVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKEVQKTAFKRYRVLRSASE  166

Query  565  FRYGYKLVENNNLRTALSTTNIIELP  642
            FRYGYKLVEN NLR AL+T+++IELP
Sbjct  167  FRYGYKLVENGNLRAALATSDVIELP  192



>ref|XP_010100301.1| hypothetical protein L484_027609 [Morus notabilis]
 gb|EXB82435.1| hypothetical protein L484_027609 [Morus notabilis]
Length=227

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 148/189 (78%), Gaps = 6/189 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLP--RRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKG  255
            MEV MS N++V LP  +   +ED     SL         T    ++++R  + +VVEAKG
Sbjct  1    MEVGMSLNAVVCLPLSKSRTLEDGLVRHSLFSTRS----TQRQKQEQKRQRKTLVVEAKG  56

Query  256  KKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKD  435
            KKGM ARQ+QR  PPP+PK+EDDGNP+FVIFIRMA+V  WYPL+I+TGGTTAKIM+AAKD
Sbjct  57   KKGMQARQFQRPPPPPMPKIEDDGNPRFVIFIRMANVGFWYPLSIITGGTTAKIMLAAKD  116

Query  436  NFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTAL  615
            NFLGKYIYKDTL +NLAAVIYRDEKE+QK A KQF++LR +T+FRYGYK+VEN NL+ A+
Sbjct  117  NFLGKYIYKDTLDKNLAAVIYRDEKEIQKSAFKQFKILRNATEFRYGYKIVENGNLKAAV  176

Query  616  STTNIIELP  642
            +T +++ELP
Sbjct  177  ATNDVVELP  185



>ref|XP_009359285.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103949875 
[Pyrus x bretschneideri]
Length=236

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 147/192 (77%), Gaps = 10/192 (5%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGR-LMVVEAK  252
            MEV +S N+ V+ P  +    ED     SL+      T+T +     Q+ GR  +VVE+K
Sbjct  1    MEVGLSLNAGVQFPFSSSRTHEDGLVRHSLVS-----TKTTIQKAAEQKQGRRTLVVESK  55

Query  253  GKKGMAARQYQRNAPPPLPK--LEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVA  426
             K+GM ARQ+Q   PPP     +EDDGNP+FV+F+RMA+V LWYPL++++GGTTAKIM+A
Sbjct  56   SKRGMMARQFQPKKPPPPAMPKIEDDGNPRFVVFMRMANVYLWYPLSVISGGTTAKIMIA  115

Query  427  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLR  606
            AKDNFLGKYIYKDTLARNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYK+VEN N+R
Sbjct  116  AKDNFLGKYIYKDTLARNLAAVIYRDEKEIQKTAFKQYRVLRSATDFRYGYKIVENGNMR  175

Query  607  TALSTTNIIELP  642
             ALST+++IELP
Sbjct  176  AALSTSDVIELP  187



>gb|KDO82056.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
 gb|KDO82057.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=197

 Score =   218 bits (556),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 132/167 (79%), Gaps = 7/167 (4%)
 Frame = +1

Query  94   MSFNSLVRLPRRNP--MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGM  267
            MS N+LVRLP  +    ED     S        +RT      R+R  R++VV+AKGK+G+
Sbjct  1    MSLNALVRLPLSSSRTHEDVLVKHSPFS-----SRTTQKPNGRERQRRVLVVQAKGKRGL  55

Query  268  AARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLG  447
             ARQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLG
Sbjct  56   QARQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLG  115

Query  448  KYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  588
            KYIYKDTLARNLAAVIYRDEKE+QK A KQFRVL+++T+FRYGYKLV
Sbjct  116  KYIYKDTLARNLAAVIYRDEKEIQKTAFKQFRVLQSATEFRYGYKLV  162



>gb|KEH35275.1| plant/F12A21-30 protein, putative [Medicago truncatula]
Length=194

 Score =   211 bits (536),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKK  261
            MEV MS N+L+     +P   S SS        S  R    ++++ +   ++VVEAK KK
Sbjct  1    MEVGMSLNALL-----HPPLSSSSSRFHNDSLFSMPRQFPRTQRQHQHHHVLVVEAKSKK  55

Query  262  GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNF  441
            GM +RQYQR  PPPLPK+EDDGNPKFV+FIRMA+V LWYPL+IV+GGTTAKIMVAAKDNF
Sbjct  56   GMMSRQYQRQPPPPLPKIEDDGNPKFVVFIRMANVYLWYPLSIVSGGTTAKIMVAAKDNF  115

Query  442  LGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLV  588
            LGK+IYKDTL RNLAAVIYRDEKE+QK A KQ RVL+++T+FRYGYKLV
Sbjct  116  LGKFIYKDTLDRNLAAVIYRDEKEIQKSAFKQHRVLKSATEFRYGYKLV  164



>gb|AAG28905.1|AC008113_21 F12A21.16 [Arabidopsis thaliana]
Length=998

 Score =   225 bits (573),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 113/174 (65%), Positives = 131/174 (75%), Gaps = 23/174 (13%)
 Frame = +1

Query  187  TRTAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADV  366
            +RTA      Q+   + VVEAKGKKGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V
Sbjct  718  SRTACRETAVQQRRMVFVVEAKGKKGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANV  776

Query  367  DLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYR---------------  501
             LWYPL+I+ GGTTAKIMVAAKDN LGKYIYKDT+ARN+AAVIYR               
Sbjct  777  YLWYPLSIIAGGTTAKIMVAAKDNLLGKYIYKDTIARNIAAVIYRVNYTSFCLFLCDVIS  836

Query  502  -------DEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELP  642
                   DEKE+QK A KQ RVLR +T+FRYGYKLVEN N+R ALST+++IELP
Sbjct  837  NCFYLQQDEKEIQKTAIKQHRVLRTATEFRYGYKLVENGNMRAALSTSDVIELP  890



>dbj|BAJ85479.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94426.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=256

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 118/138 (86%), Gaps = 1/138 (1%)
 Frame = +1

Query  235  MVVEAKGKKGMAARQYQRNA-PPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  411
            +VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTA
Sbjct  46   LVVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTA  105

Query  412  KIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVE  591
            KIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++  LAK+QFRVL+  T+FRYGYK+VE
Sbjct  106  KIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDLAKEQFRVLKGETEFRYGYKIVE  165

Query  592  NNNLRTALSTTNIIELPR  645
              NLR+AL+T+N++ELP+
Sbjct  166  KGNLRSALATSNVLELPK  183



>ref|NP_001047344.1| Os02g0600200 [Oryza sativa Japonica Group]
 dbj|BAD22147.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09258.1| Os02g0600200 [Oryza sativa Japonica Group]
 dbj|BAG90207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=266

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  235  MVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  414
            +VVEA+G+ G + R+ Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAK
Sbjct  59   LVVEARGR-GWSDRRSQQQRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAK  117

Query  415  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN  594
            IM+AAKDNFLGKYIYKDTLARNLAAVIY+DE ++   AK+Q+RVL+   +FRYGYK+VEN
Sbjct  118  IMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDDIIDTAKEQYRVLKTDNEFRYGYKVVEN  177

Query  595  NNLRTALSTTNIIELPR  645
             NLR+AL+T+N+IELP+
Sbjct  178  GNLRSALTTSNVIELPK  194



>ref|XP_010235641.1| PREDICTED: uncharacterized protein LOC104583798 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010235642.1| PREDICTED: uncharacterized protein LOC104583798 isoform X1 [Brachypodium 
distachyon]
Length=249

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +1

Query  193  TAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVD  369
               P  +R    RL VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V 
Sbjct  28   AGFPRPRRLHAARL-VVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVY  86

Query  370  LWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVL  549
             WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++   AK+QFRVL
Sbjct  87   FWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDTAKEQFRVL  146

Query  550  RASTDFRYGYKLVENNNLRTALSTTNIIELPR  645
            ++  +FRYGYK+VE  NLR+AL+T+N+IELP+
Sbjct  147  KSENEFRYGYKVVEKGNLRSALATSNVIELPK  178



>gb|EEC73537.1| hypothetical protein OsI_07935 [Oryza sativa Indica Group]
 gb|EEE67978.1| hypothetical protein OsJ_25898 [Oryza sativa Japonica Group]
Length=300

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  235  MVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  414
            +VVEA+G+ G + R+ Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAK
Sbjct  59   LVVEARGR-GWSDRRSQQQRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAK  117

Query  415  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN  594
            IM+AAKDNFLGKYIYKDTLARNLAAVIY+DE ++   AK+Q+RVL+   +FRYGYK+VEN
Sbjct  118  IMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDDIIDTAKEQYRVLKTDNEFRYGYKVVEN  177

Query  595  NNLRTALSTTNIIELPR  645
             NLR+AL+T+N+IELP+
Sbjct  178  GNLRSALTTSNVIELPK  194



>ref|XP_004952998.1| PREDICTED: uncharacterized protein LOC101783266 isoform X1 [Setaria 
italica]
Length=288

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  KRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNI  390
            +RQ   R +VVEA+G+     +  Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RRQPARRALVVEARGRSWSERQMEQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  391  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  570
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE  +   AK+Q+RVL+   +FR
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDVIIDTAKEQYRVLKTENEFR  158

Query  571  YGYKLVENNNLRTALSTTNIIELPR  645
            YGYK+VEN N+R+AL+T+N+IELP+
Sbjct  159  YGYKVVENGNVRSALTTSNVIELPK  183



>ref|NP_001141155.1| uncharacterized protein LOC100273241 [Zea mays]
 gb|ACF79164.1| unknown [Zea mays]
 gb|ACF85560.1| unknown [Zea mays]
 gb|AFW72183.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=249

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = +1

Query  214  RQRVGRLMVVEAKGKKGMAARQYQRNAPPPL-PKLEDDGNPKFVIFIRMADVDLWYPLNI  390
            RQ   R +VVEA+G +G + RQ Q+    PL PK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RQPARRALVVEARGGRGWSERQMQQQRRAPLLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  391  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  570
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE  +   AK+Q+RVL+    FR
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDVIIDTAKEQYRVLKTENQFR  158

Query  571  YGYKLVENNNLRTALSTTNIIELPR  645
            YGYK+VE  N+R+AL+T+N+IELP+
Sbjct  159  YGYKVVEKGNIRSALTTSNVIELPK  183



>ref|XP_004952999.1| PREDICTED: uncharacterized protein LOC101783266 isoform X2 [Setaria 
italica]
Length=249

 Score =   199 bits (507),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  211  KRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNI  390
            +RQ   R +VVEA+G+     +  Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RRQPARRALVVEARGRSWSERQMEQQRRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  391  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  570
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE  +   AK+Q+RVL+   +FR
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDVIIDTAKEQYRVLKTENEFR  158

Query  571  YGYKLVENNNLRTALSTTNIIELPR  645
            YGYK+VEN N+R+AL+T+N+IELP+
Sbjct  159  YGYKVVENGNVRSALTTSNVIELPK  183



>ref|XP_010235643.1| PREDICTED: uncharacterized protein LOC104583798 isoform X2 [Brachypodium 
distachyon]
Length=236

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 119/150 (79%), Gaps = 2/150 (1%)
 Frame = +1

Query  193  TAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAP-PPLPKLEDDGNPKFVIFIRMADVD  369
               P  +R    RL VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V 
Sbjct  28   AGFPRPRRLHAARL-VVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVY  86

Query  370  LWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVL  549
             WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++   AK+QFRVL
Sbjct  87   FWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDTAKEQFRVL  146

Query  550  RASTDFRYGYKLVENNNLRTALSTTNIIEL  639
            ++  +FRYGYK+VE  NLR+AL+T+N+IE+
Sbjct  147  KSENEFRYGYKVVEKGNLRSALATSNVIEV  176



>ref|XP_006665147.1| PREDICTED: uncharacterized protein LOC102722271, partial [Oryza 
brachyantha]
Length=194

 Score =   192 bits (489),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +1

Query  283  QRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYK  462
            Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLN+VTGGTTAKIM+AAKDNFLGKYIYK
Sbjct  1    QQQRMPSLPKIEDDGNPRFVIFIRTANVYFWYPLNVVTGGTTAKIMLAAKDNFLGKYIYK  60

Query  463  DTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELP  642
            DTLARNLAAVIY+DE E+   AK+Q+RVL+   +FRYGYK+VEN NLR+AL+T+N+IELP
Sbjct  61   DTLARNLAAVIYKDEDEIIDTAKEQYRVLKTENEFRYGYKVVENANLRSALTTSNVIELP  120

Query  643  R  645
            +
Sbjct  121  K  121



>gb|EMT22924.1| hypothetical protein F775_29812 [Aegilops tauschii]
Length=276

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 120/158 (76%), Gaps = 21/158 (13%)
 Frame = +1

Query  235  MVVEAKGKKGMAARQYQRNA-PPPLPKLEDDGNPKFVIFIRMADV-------DL------  372
            +VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V       DL      
Sbjct  46   LVVEARGGRGWSDRQSQQQRRMPQLPKIEDDGNPRFVIFIRTANVYSSSIPSDLIVCMYI  105

Query  373  -------WYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAK  531
                   WYPLNIVTGGTTAKIM+AAKDNFLGKYIYKDTLARNLA VIY+DE ++  LAK
Sbjct  106  NFLLVYFWYPLNIVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLATVIYKDEDDIIDLAK  165

Query  532  KQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELPR  645
            +QFRVL+  T+FRYGYK+VE  NLR+AL+T+N++ELP+
Sbjct  166  EQFRVLKGETEFRYGYKIVEKGNLRSALATSNVLELPK  203



>gb|KDO82053.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=198

 Score =   184 bits (467),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 124/183 (68%), Gaps = 32/183 (17%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  273
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  274  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  453
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  454  IYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNII  633
            IYKDTLARNLAAVIYR                             EN NLR ALST+++I
Sbjct  118  IYKDTLARNLAAVIYR-----------------------------ENGNLRAALSTSDVI  148

Query  634  ELP  642
            ELP
Sbjct  149  ELP  151



>ref|XP_002887139.1| F12A21.16 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63398.1| F12A21.16 [Arabidopsis lyrata subsp. lyrata]
Length=985

 Score =   189 bits (479),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 108/197 (55%), Positives = 136/197 (69%), Gaps = 17/197 (9%)
 Frame = +1

Query  79   KMEVAMSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGK  258
            K +++MS N+L RLP +N          L+R S+ S+RTA      Q+   + VVEAKGK
Sbjct  684  KPKMSMSLNALTRLPLKN--TGRFEEVGLVRQSLFSSRTACRETAVQQRRMVFVVEAKGK  741

Query  259  KGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDN  438
            KGMAARQYQR  PPP+PK+EDDGNP+FVIFIRMA+V LWYPL+I+ GGTTAKIMVAAKDN
Sbjct  742  KGMAARQYQRT-PPPMPKIEDDGNPRFVIFIRMANVYLWYPLSIIAGGTTAKIMVAAKDN  800

Query  439  FLGKYIYKDTLARNLAAVIYRDEKE---------LQKLAKKQFRVLRASTDFRYGYKLVE  591
             LGKYIYKDT+ARN+AAVIYR             L  + +K+F+  + S+         E
Sbjct  801  LLGKYIYKDTIARNIAAVIYRVNYTSCFLFGLIPLFNMMRKRFKRQQLSSTVS-----CE  855

Query  592  NNNLRTALSTTNIIELP  642
            N N+R ALST+++IELP
Sbjct  856  NGNMRAALSTSDVIELP  872



>gb|KDO82058.1| hypothetical protein CISIN_1g027148mg [Citrus sinensis]
Length=142

 Score =   174 bits (440),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = +1

Query  94   MSFNSLVRLPRRNPMEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAKGKKGMAA  273
            MS N+LVRLP  +          L++HS  S+RT      R+R  R++VV+AKGK+G+ A
Sbjct  1    MSLNALVRLPLSS---SRTHEDVLVKHSPFSSRTTQKPNGRERQRRVLVVQAKGKRGLQA  57

Query  274  RQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKY  453
            RQ+QR  PP LPK+EDDGNP+FVIFIRMA+V LWYPL+I+TGGTTAKIMVAAKDNFLGKY
Sbjct  58   RQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMVAAKDNFLGKY  117

Query  454  IYKDTLARNLAAVIYRDEKELQKL  525
            IYKDTLARNLAAVIYR    L +L
Sbjct  118  IYKDTLARNLAAVIYRVSSVLLQL  141



>gb|ABK23133.1| unknown [Picea sitchensis]
Length=232

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 116/149 (78%), Gaps = 1/149 (1%)
 Frame = +1

Query  196  AVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLW  375
            A+ SRK    G +++VEAKG+K M  + YQ+  PP +PK EDD NP+FV+FIR  +V  W
Sbjct  39   ALWSRKNTGRGGVVIVEAKGRKSMQEKMYQQRPPPSVPKAEDD-NPRFVVFIRSKNVPRW  97

Query  376  YPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRA  555
            YPLNI++GGTTAKIMVA KD  +GK++Y+  L RN+AAV+Y+DEKE++K+A KQ+ VL+A
Sbjct  98   YPLNIISGGTTAKIMVAGKDTPVGKFLYEGALTRNIAAVVYKDEKEIRKIALKQYPVLKA  157

Query  556  STDFRYGYKLVENNNLRTALSTTNIIELP  642
            +++ +YGYKL++  N  +AL +++II++P
Sbjct  158  ASELQYGYKLIDPKNPNSALYSSDIIKIP  186



>emb|CBI27531.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   166 bits (420),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +1

Query  355  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  534
            MA+V LWYPL+++TGGTTAKIMVAAKDNFLGKYIY+DT+ARNLAAVIY+DEKE+QK A +
Sbjct  1    MANVYLWYPLSLITGGTTAKIMVAAKDNFLGKYIYRDTIARNLAAVIYKDEKEIQKTAFR  60

Query  535  QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELP  642
            Q+RVLR++ +FRYGYKLVENNN+R+ALSTT++IELP
Sbjct  61   QYRVLRSAKEFRYGYKLVENNNVRSALSTTDVIELP  96



>ref|XP_006648812.1| PREDICTED: uncharacterized protein LOC102699572 [Oryza brachyantha]
Length=193

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/94 (74%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  364  VDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFR  543
            V  WYPLN+VTGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+DE E+   AK+Q+R
Sbjct  27   VYFWYPLNVVTGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDEIIDTAKEQYR  86

Query  544  VLRASTDFRYGYKLVENNNLRTALSTTNIIELPR  645
            VL+   +FRYGYK+VEN NLR+AL+T+N+IELP+
Sbjct  87   VLKTENEFRYGYKVVENANLRSALTTSNVIELPK  120



>gb|EAY86575.1| hypothetical protein OsI_07955 [Oryza sativa Indica Group]
Length=477

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +1

Query  235  MVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  414
            +VVEA+G+ G + R+ Q+   P LPK+EDDGNP+FVIFIR A+V  WYPLNIVTGGTTAK
Sbjct  59   LVVEARGR-GWSDRRSQQQRMPQLPKIEDDGNPRFVIFIRTANVYFWYPLNIVTGGTTAK  117

Query  415  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFR  543
            IM+AAKDNFLGKYIYKDTLARNLAAVIY+DE ++   AK+Q+R
Sbjct  118  IMLAAKDNFLGKYIYKDTLARNLAAVIYKDEDDIIDTAKEQYR  160



>gb|AFW72182.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=165

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +1

Query  214  RQRVGRLMVVEAKGKKGMAARQYQRNA-PPPLPKLEDDGNPKFVIFIRMADVDLWYPLNI  390
            RQ   R +VVEA+G +G + RQ Q+    P LPK+EDDGNP+FVIFIR A+V  WYPLNI
Sbjct  39   RQPARRALVVEARGGRGWSERQMQQQRRAPLLPKIEDDGNPRFVIFIRTANVYFWYPLNI  98

Query  391  VTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFR  570
            +TGGTTAKIM+AAKDNFLGKYIYKDTLARNLAAVIY+   + Q+L    F  L  S+   
Sbjct  99   ITGGTTAKIMLAAKDNFLGKYIYKDTLARNLAAVIYKVIDDQQQL----FFWLHHSSHIL  154

Query  571  YGYKLV  588
             G+ ++
Sbjct  155  NGHPIL  160



>ref|XP_001765741.1| predicted protein [Physcomitrella patens]
 gb|EDQ69332.1| predicted protein [Physcomitrella patens]
Length=209

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 100/136 (74%), Gaps = 2/136 (1%)
 Frame = +1

Query  241  VEAKGKK--GMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAK  414
            V AKG++  G+  RQ  R   P +P +EDDGNPKFV+FIR  +V  WYPL++VTGGTTAK
Sbjct  30   VRAKGRRNAGIPGRQPNRQQMPSMPAMEDDGNPKFVLFIRTLNVPRWYPLSVVTGGTTAK  89

Query  415  IMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVEN  594
            +MV A  N  GK +Y+ TL RN+A VIY+DEK++ + A KQ+ VL+++T F+YGYK+++ 
Sbjct  90   MMVGAMKNDWGKKLYEGTLTRNIAGVIYKDEKKIIQTAIKQYPVLKSATGFQYGYKIMDP  149

Query  595  NNLRTALSTTNIIELP  642
               ++A+ +++++ +P
Sbjct  150  EKPQSAMFSSDVVTIP  165



>gb|KHN24102.1| Small heat shock protein, chloroplastic, partial [Glycine soja]
Length=320

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 89/130 (68%), Gaps = 34/130 (26%)
 Frame = +1

Query  229  RLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTT  408
            ++ VVEAKGKKGM +RQ+QRN+PPPLPK+EDDGNPKFVIFIRMA+               
Sbjct  38   QVFVVEAKGKKGMMSRQFQRNSPPPLPKIEDDGNPKFVIFIRMAN---------------  82

Query  409  AKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKL-  585
                            YKDTL RNLAAVIYRDEKE+QK A KQ+RVLR++TDFRYGYKL 
Sbjct  83   ----------------YKDTLDRNLAAVIYRDEKEVQKSACKQYRVLRSATDFRYGYKLL  126

Query  586  --VENNNLRT  609
              ++ +NL +
Sbjct  127  WEIQTDNLSS  136



>ref|XP_010930034.1| PREDICTED: uncharacterized protein LOC105051352 isoform X3 [Elaeis 
guineensis]
Length=189

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 103/190 (54%), Gaps = 53/190 (28%)
 Frame = +1

Query  82   MEVAMSFNSLVRLPRRNP---MEDsgsssslirhsissTRTAVPSRKRQRVGRLMVVEAK  252
            MEVAMS  +L RLP  N      ++G          S T   V  +KRQ    LMVVEAK
Sbjct  1    MEVAMSVRALARLPLSNSKVTAHENGVFLGSPLPLRSQTSRRVSEKKRQ----LMVVEAK  56

Query  253  GKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAK  432
            GK+GM ARQ+QR  PPPLPK+EDDGNP+FVIFIR                          
Sbjct  57   GKRGMMARQFQRPPPPPLPKIEDDGNPRFVIFIRTT------------------------  92

Query  433  DNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTA  612
                                  +DEKE+QK A KQ+RVLR++T FRYGYKL+ENNNLR A
Sbjct  93   ----------------------KDEKEIQKTAFKQYRVLRSATAFRYGYKLIENNNLRAA  130

Query  613  LSTTNIIELP  642
            +ST ++IELP
Sbjct  131  ISTNDVIELP  140



>gb|AFB34514.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34515.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34516.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
 gb|AFB34517.1| hypothetical protein CL4511Contig1_02, partial [Pinus mugo]
Length=85

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +1

Query  232  LMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  411
            L++VEAKGKK M  + Y++  PP LPK EDD NP+FV+FIR  +V  WYPLNI++GGTTA
Sbjct  1    LVIVEAKGKKSMQEKLYKQRPPPSLPKAEDD-NPRFVVFIRTKNVPRWYPLNIISGGTTA  59

Query  412  KIMVAAKDNFLGKYIYKDTLARNLAA  489
            KIMVA KD  +GK++Y+  L RN+AA
Sbjct  60   KIMVAGKDTPVGKFLYEGALTRNIAA  85



>gb|AEW09177.1| hypothetical protein CL4511Contig1_02, partial [Pinus radiata]
 gb|AFG53863.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53864.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53865.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53866.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53867.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53868.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53869.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53870.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53871.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53872.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53873.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53874.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53875.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53876.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53877.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53878.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
 gb|AFG53879.1| hypothetical protein CL4511Contig1_02, partial [Pinus taeda]
Length=85

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 1/86 (1%)
 Frame = +1

Query  232  LMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  411
            L++VEAKGKK M  + Y++  PP LPK EDD NP+FV+FIR  +V  WYPLNI++GGTTA
Sbjct  1    LVIVEAKGKKNMQEKLYKQRPPPSLPKAEDD-NPRFVVFIRTKNVPRWYPLNIISGGTTA  59

Query  412  KIMVAAKDNFLGKYIYKDTLARNLAA  489
            KIMVA KD  +GK++Y+  L RN+AA
Sbjct  60   KIMVAGKDTPVGKFLYEGALTRNIAA  85



>gb|AFB34513.1| hypothetical protein CL4511Contig1_02, partial [Larix decidua]
Length=85

 Score =   107 bits (266),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 66/86 (77%), Gaps = 1/86 (1%)
 Frame = +1

Query  232  LMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTA  411
            L++VEAKG+K M  + Y++  PP +P  EDD NP+FV+FIR  +V  WYPLNI++GGTTA
Sbjct  1    LVIVEAKGRKSMQEKMYKQRPPPSVPPAEDD-NPRFVVFIRSKNVPRWYPLNIISGGTTA  59

Query  412  KIMVAAKDNFLGKYIYKDTLARNLAA  489
            KIMVA KD  +GK++Y+  L RN+AA
Sbjct  60   KIMVAGKDTPVGKFLYEGALTRNIAA  85



>ref|XP_002983221.1| hypothetical protein SELMODRAFT_422572 [Selaginella moellendorffii]
 gb|EFJ15563.1| hypothetical protein SELMODRAFT_422572 [Selaginella moellendorffii]
Length=184

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 92/156 (59%), Gaps = 8/156 (5%)
 Frame = +1

Query  190  RTAVPSRKRQRVGRLMVVEAKGKKG-----MAARQYQRNAPPPLPKLEDDGNPKFVIFIR  354
            R A+ S +R    +++ +EA  +KG        +Q Q+ + P +P  EDD NP+FVIFIR
Sbjct  3    RAAIASSERSL--QVLTIEASKRKGPMRRMQQQQQMQQRSLPKVPAAEDD-NPRFVIFIR  59

Query  355  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  534
              +V LWYPLNIV+GG  AK MV    N  GK IY ++L  N+ A +Y+DE+++     K
Sbjct  60   SKNVPLWYPLNIVSGGNAAKFMVGVTKNEWGKKIYGNSLTNNIGAAVYKDEEKIIASVVK  119

Query  535  QFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELP  642
             +  L+ + +F++GYKLV+      AL   ++  +P
Sbjct  120  TYPTLKTAKEFQFGYKLVDEEKANEALRPVDVTLIP  155



>ref|XP_002961342.1| hypothetical protein SELMODRAFT_403146 [Selaginella moellendorffii]
 gb|EFJ38881.1| hypothetical protein SELMODRAFT_403146 [Selaginella moellendorffii]
Length=179

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 88/147 (60%), Gaps = 6/147 (4%)
 Frame = +1

Query  217  QRVGRLMVVEAKGKKG-----MAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYP  381
            +R  +++ +EA  +KG        +Q Q+ + P +P  EDD NP+FVIFIR  +V LWYP
Sbjct  5    ERSLQVLTIEASKRKGPMRRMQQQQQMQQRSLPKVPAAEDD-NPRFVIFIRSKNVPLWYP  63

Query  382  LNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRAST  561
            LNIV+GG  AK MV    N  GK IY ++L  N+ A +Y+DE+++     K +  L+ + 
Sbjct  64   LNIVSGGNAAKFMVGVTKNEWGKKIYGNSLTNNIGAAVYKDEEKIIASVVKTYPTLKTAK  123

Query  562  DFRYGYKLVENNNLRTALSTTNIIELP  642
            +F++GYKLV+      AL   ++  +P
Sbjct  124  EFQFGYKLVDEEKANEALRPVDVTLIP  150



>ref|XP_005648734.1| hypothetical protein COCSUDRAFT_53257 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24190.1| hypothetical protein COCSUDRAFT_53257 [Coccomyxa subellipsoidea 
C-169]
Length=213

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 79/137 (58%), Gaps = 7/137 (5%)
 Frame = +1

Query  193  TAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAP------PPLPKLEDDGNPKFVIFIR  354
            TA P+  R   GR + +E    KG   ++  ++A       PP P ++ D N +FV+FIR
Sbjct  34   TAAPATCRPGSGRSLRLEVSAVKGAGKKKLAQSAQAGAAQLPPTPPVDPD-NAEFVLFIR  92

Query  355  MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKK  534
                  WYPL++V GG+ A I+V A ++  G+ +Y  TL RN+  V+Y+D ++++ + K+
Sbjct  93   AVKFPQWYPLSVVKGGSAANIIVRAMESEFGRLLYGKTLIRNIGTVVYQDRRKIENMVKR  152

Query  535  QFRVLRASTDFRYGYKL  585
               +++   DF +G+K+
Sbjct  153  SLPMMKNFKDFEFGFKI  169



>ref|XP_001415572.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93864.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=147

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 63/111 (57%), Gaps = 6/111 (5%)
 Frame = +1

Query  298  PPLPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLA  474
            PP+    D  N +FVI +R    +  WYPLN+VTGG+ A  +V   DN + K + + +L+
Sbjct  10   PPI----DPDNEQFVIHVRSKRGIKAWYPLNVVTGGSAANTLVKGLDNDMSKEMAQKSLS  65

Query  475  RNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTN  627
            +N+   IY+D   + K+A+    +L+ + +  YG+ +++  N R+  S  N
Sbjct  66   QNIGKAIYKDMAAIDKVARS-MPMLKQAKEIEYGFSVLDKENPRSMFSPAN  115



>ref|XP_011397511.1| Uncharacterized protein YhiN [Auxenochlorella protothecoides]
 gb|KFM24623.1| Uncharacterized protein YhiN [Auxenochlorella protothecoides]
Length=457

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +1

Query  298  PPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLAR  477
            PP P+  D  N +FV+F+R   +  W PL+I+ GGT A ++V +    LGK +Y +TL R
Sbjct  319  PPTPE-PDPKNEEFVMFVRSKKLMKWVPLSIMKGGTAANMLVKSMQGNLGKKMYTNTLIR  377

Query  478  NLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKL  585
            N+A  +Y+D  E+++  + Q+   + + +F Y +K+
Sbjct  378  NIAQGLYKDRLEVERQLRNQYPFFKETKEFEYAFKI  413



>ref|XP_003074445.1| Metalloendopeptidase family-saccharolysin & thimet oligopeptidase 
(ISS) [Ostreococcus tauri]
 emb|CAL50296.1| unnamed product [Ostreococcus tauri]
Length=205

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 77/136 (57%), Gaps = 11/136 (8%)
 Frame = +1

Query  244  EAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIM  420
            E  G K M+  Q ++  PP  P      N +FVI++R    +  WYPLN+VTGG+ A  +
Sbjct  52   EGSGAKMMS--QVEQFMPPIDPD-----NEQFVIYVRSKRGLKAWYPLNVVTGGSAANTL  104

Query  421  VAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            V   DN + + + + +L +N+   IY+D + ++K+A+    +L+ + +  YG+ +++  N
Sbjct  105  VKGLDNDMSREMAQKSLQQNIGKAIYKDFEAIEKVART-MPMLKQAKEIEYGFAVLDKKN  163

Query  601  LRTALS--TTNIIELP  642
             R+  S  + +++ +P
Sbjct  164  PRSMFSPASGSVMMIP  179



>ref|XP_002507497.1| hypothetical protein MICPUN_113391 [Micromonas sp. RCC299]
 gb|ACO68755.1| hypothetical protein MICPUN_113391 [Micromonas sp. RCC299]
Length=215

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = +1

Query  304  LPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARN  480
            +P ++ D N +FVI++R       W+PLN+VTGG+TA  +V   D+ L + + K +L  N
Sbjct  68   MPPVDPD-NEQFVIYVRSKKGFKAWFPLNVVTGGSTANTLVKGLDSNLSRDMAKKSLTNN  126

Query  481  LAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            +   IY+D  +LQ++ ++   +L+A+ +  YG+ +++  N
Sbjct  127  IGQAIYKDADQLQEMCRR-MPMLKAAKELEYGFMILDKKN  165



>ref|XP_005534863.1| hypothetical protein CYME_CMJ126C [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80256.1| hypothetical protein CYME_CMJ126C [Cyanidioschyzon merolae strain 
10D]
Length=224

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 68/131 (52%), Gaps = 6/131 (5%)
 Frame = +1

Query  223  VGRLMVVEAKGKKGMAARQYQRNAP-PPLPKLE--DDGNPKFVIFIRMADVDLWYPLNIV  393
            V R   +  +G  G+ A++ + NAP  P  +LE  +DG P F I  R     LWYPL  +
Sbjct  51   VHRSTALPHRGVIGLQAKKGKPNAPLAPPSELEVPEDGTPVFAILARSPVSGLWYPLGTM  110

Query  394  TGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDE-KELQKLAKKQFRVLRAST--D  564
             G   AK++V A     G+  Y DTL + +A  ++ ++ + +   A +++  LR  T  D
Sbjct  111  RGDGRAKMLVNAMRTSWGRKFYGDTLNKGVARSVFSEQGRRMIHAALRKYSALRKYTADD  170

Query  565  FRYGYKLVENN  597
              YGY+++  +
Sbjct  171  LEYGYRVIAKD  181



>ref|XP_003056036.1| hypothetical protein MICPUCDRAFT_70697 [Micromonas pusilla CCMP1545]
 gb|EEH59412.1| hypothetical protein MICPUCDRAFT_70697 [Micromonas pusilla CCMP1545]
Length=214

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 62/100 (62%), Gaps = 3/100 (3%)
 Frame = +1

Query  304  LPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARN  480
            LP ++ D N +FVI++R       WYPLN+VTGG+TA  +V   D+ L + +   +L  N
Sbjct  71   LPPIDPD-NEQFVIYVRSKKGFKAWYPLNVVTGGSTANTLVKGLDSDLSRELAVKSLTTN  129

Query  481  LAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
            +   IY++ ++L+++ ++   +L+ + +  +G+ +++ +N
Sbjct  130  IGQAIYKETEQLEEMCRR-MPMLKNAKELEFGFMVLDKSN  168



>ref|XP_005852074.1| hypothetical protein CHLNCDRAFT_133084 [Chlorella variabilis]
 gb|EFN59972.1| hypothetical protein CHLNCDRAFT_133084 [Chlorella variabilis]
Length=206

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/108 (26%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = +1

Query  319  DDGNPKFVIFIRMADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIY  498
            D  N +FVIF+R   +  W PL++V GGT A ++V   D+   K     TL +N+   +Y
Sbjct  70   DPDNEEFVIFVRSKKLPQWVPLSVVKGGTAANMLVKGLDSDWMKDTTAKTLVQNIGKAVY  129

Query  499  RDEKELQKLAKKQFRVLRASTDFRYGYKLVENNNLRTALSTTNIIELP  642
            +D++++    +K +   + + +F + +K+ E  + +       ++++P
Sbjct  130  KDKEQIIASLRKAYPPFKETKEFEFAFKIREKADPKAWYVPKGLMDIP  177



>gb|AFW72181.1| hypothetical protein ZEAMMB73_079373 [Zea mays]
Length=92

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 1/52 (2%)
 Frame = +1

Query  214  RQRVGRLMVVEAKGKKGMAARQYQRNAPPPL-PKLEDDGNPKFVIFIRMADV  366
            RQ   R +VVEA+G +G + RQ Q+    PL PK+EDDGNP+FVIFIR A+V
Sbjct  39   RQPARRALVVEARGGRGWSERQMQQQRRAPLLPKIEDDGNPRFVIFIRTANV  90



>ref|XP_001695603.1| hypothetical protein CHLREDRAFT_205992 [Chlamydomonas reinhardtii]
 gb|EDP01390.1| predicted protein [Chlamydomonas reinhardtii]
Length=223

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 72/163 (44%), Gaps = 25/163 (15%)
 Frame = +1

Query  220  RVGRLMVVEAKGKKGMAARQ---------YQRNAPPPLPKLEDDGNPKFVIFIR------  354
            R    +  + KGK   A RQ          +R AP P     D  N +FVIF R      
Sbjct  34   RTSVQVFAKGKGKGKSALRQGSMPNQMEMVRREAPTPD---VDPENAEFVIFFRCLKYKD  90

Query  355  -----MADVDLWYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIYRDEKELQ  519
                 M    LW PL+IV G   +  +  A  +  G  +Y  TL   +A+ +Y+D+ +L+
Sbjct  91   PQLNAMVGPSLWVPLSIVKGNQVSNFLANAIKSPWGMRLYGRTLIWQMASGLYQDKAKLE  150

Query  520  KLAKKQFRVL--RASTDFRYGYKLVENNNLRTALSTTNIIELP  642
            K  +K F      AS+DF+Y +K+ +  N +   +  N+   P
Sbjct  151  KELRKNFPPFANSASSDFQYAFKIRDKANPKDWTAAENLTFFP  193



>ref|XP_007509245.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19702.1| predicted protein [Bathycoccus prasinos]
Length=171

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 64/116 (55%), Gaps = 19/116 (16%)
 Frame = +1

Query  304  LPKLEDDGNPKFVIFIRMA-DVDLWYPLNIVTGGTTAKIMVAAKDNFLGK------YIYK  462
            LP ++ D N +FVI++R    +  W+PLN+VTGG+TA  +V   D+ L K      + Y 
Sbjct  11   LPPIDPD-NEQFVIYVRSKKGLKTWFPLNVVTGGSTANTLVKGLDSNLSKDVCLSLFYYH  69

Query  463  ----------DTLARNLAAVIYRDEKELQKLAKKQFRVLRASTDFRYGYKLVENNN  600
                       +L  N+   +Y+++ +L+++ +K   +L+++ +  YG+ +++  N
Sbjct  70   FSHYFLQMALKSLTNNIGQALYKEQVQLEEMVRK-MPMLKSARELEYGFSVLDKKN  124



>ref|XP_005718910.1| unnamed protein product [Chondrus crispus]
 emb|CDF39005.1| unnamed protein product [Chondrus crispus]
Length=249

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 63/134 (47%), Gaps = 7/134 (5%)
 Frame = +1

Query  193  TAVPSRKRQRVGRLMVVEAKGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDL  372
            T++P+R R     + + + + ++ +  R+ Q         L +DG P F IF+R     L
Sbjct  85   TSLPARARPTYTPIQMKKGRSRQPLQPRRAQDQM-----SLPEDGTPVFAIFVRTPRTKL  139

Query  373  WYPLNIVTGGTTAKIMVAAKDNFLGKYIYKDTLARNLAAVIY--RDEKELQKLAKKQFRV  546
            WYP+  V G   +K +V A      K +Y + L + +A  +Y    +K +Q   +   ++
Sbjct  140  WYPMGAVQGDDRSKNLVNALKGGFAKAMYANALDKGIAQTVYGKGGDKFVQSAVRMYPQL  199

Query  547  LRASTDFRYGYKLV  588
             + +    +GY++ 
Sbjct  200  KKYTKQLEFGYRVT  213



>ref|XP_002953545.1| hypothetical protein VOLCADRAFT_121174 [Volvox carteri f. nagariensis]
 gb|EFJ45518.1| hypothetical protein VOLCADRAFT_121174 [Volvox carteri f. nagariensis]
Length=233

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (50%), Gaps = 16/129 (12%)
 Frame = +1

Query  298  PPLPKLEDDGNPKFVIFIRM---------ADV--DLWYPLNIVTGGTTAKIMVAAKDNFL  444
            PP+P++ D  N + V+F+R+          DV   LW P+N++ G      +V A     
Sbjct  66   PPVPEV-DPENAEIVLFVRVLKYKDPTLNMDVGPSLWMPVNLIKGNQVLNFLVEALKTDW  124

Query  445  GKYIYKDTLARNLAAVIYRDEKELQKLAKK---QFRVLRASTDFRYGYKLVENNNLRTAL  615
            G  +Y  TL   +A+ IY+D+ +++K  KK   QF    AS DF Y +K+ + +  +  L
Sbjct  125  GMRLYGRTLIWQIASGIYQDKAKVEKDLKKNVPQF-ANAASKDFEYAFKIRDKSVPKDWL  183

Query  616  STTNIIELP  642
               N+   P
Sbjct  184  KPENLTICP  192



>ref|XP_002184929.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43665.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=206

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 60/131 (46%), Gaps = 6/131 (5%)
 Frame = +1

Query  250  KGKKGMAARQYQRNAPPPLPKLEDDGNPKFVIFIRMADVDLWYPLNIVTGGT-TAKIMVA  426
            K K+ MA R+    A  P      DG P F +F+R    ++WYP     G   +A +  +
Sbjct  62   KQKEMMAMREEMIAAQKP----GQDGLPVFNLFVRTKKANMWYPCGSFKGDERSAALAKS  117

Query  427  AKDNFLGKYIYKDTLARNLAAVIYRDEKELQKLAKKQFRVLRAS-TDFRYGYKLVENNNL  603
              D  L   + K  +   +A  +YRD+ +L++   + +  LR S  DF +GYKL  +   
Sbjct  118  YADGGLLAGVSKRQIDGGIAGSLYRDQGKLKESVARSYPQLRKSREDFEFGYKLSYDGLS  177

Query  604  RTALSTTNIIE  636
                S   +IE
Sbjct  178  EEQSSEIKVIE  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000