BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034A17

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAB41076.1|  MAR-binding protein                                    377   6e-125   Nicotiana tabacum [American tobacco]
ref|XP_009769588.1|  PREDICTED: probable nucleolar protein 5-2          376   2e-124   Nicotiana sylvestris
ref|XP_009591833.1|  PREDICTED: probable nucleolar protein 5-2          376   2e-124   Nicotiana tomentosiformis
emb|CAN73717.1|  hypothetical protein VITISV_038844                     370   4e-123   Vitis vinifera
ref|XP_004247627.1|  PREDICTED: probable nucleolar protein 5-2          371   9e-123   
emb|CBI34244.3|  unnamed protein product                                369   1e-122   Vitis vinifera
ref|XP_006362168.1|  PREDICTED: probable nucleolar protein 5-2-li...    371   1e-122   
emb|CDP04715.1|  unnamed protein product                                365   4e-122   Coffea canephora [robusta coffee]
ref|XP_002273273.2|  PREDICTED: probable nucleolar protein 5-2          369   2e-121   Vitis vinifera
tpg|DAA45361.1|  TPA: hypothetical protein ZEAMMB73_906298              365   2e-121   
ref|XP_010243588.1|  PREDICTED: probable nucleolar protein 5-1          369   3e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010904781.1|  PREDICTED: probable nucleolar protein 5-2          369   3e-121   Elaeis guineensis
ref|XP_009382561.1|  PREDICTED: probable nucleolar protein 5-2          369   3e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004239682.1|  PREDICTED: probable nucleolar protein 5-2          366   3e-121   Solanum lycopersicum
ref|XP_008799299.1|  PREDICTED: probable nucleolar protein 5-2          365   5e-121   Phoenix dactylifera
ref|XP_006345813.1|  PREDICTED: probable nucleolar protein 5-2-like     366   7e-121   Solanum tuberosum [potatoes]
ref|XP_010241493.1|  PREDICTED: probable nucleolar protein 5-2 is...    367   1e-120   Nelumbo nucifera [Indian lotus]
ref|XP_010097360.1|  hypothetical protein L484_010238                   364   2e-120   
ref|XP_008655653.1|  PREDICTED: probable nucleolar protein 5-2          366   2e-120   Zea mays [maize]
ref|XP_008671899.1|  PREDICTED: probable nucleolar protein 5-2          361   3e-120   
ref|XP_008660157.1|  PREDICTED: probable nucleolar protein 5-2          365   3e-120   Zea mays [maize]
ref|XP_008649917.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    357   3e-120   
ref|XP_009411704.1|  PREDICTED: probable nucleolar protein 5-1          365   7e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456868.1|  hypothetical protein SORBIDRAFT_03g044260          364   8e-120   
ref|XP_010938712.1|  PREDICTED: probable nucleolar protein 5-2          365   1e-119   Elaeis guineensis
ref|XP_003557835.1|  PREDICTED: probable nucleolar protein 5-2          364   1e-119   Brachypodium distachyon [annual false brome]
ref|NP_001050112.1|  Os03g0350100                                       363   2e-119   
ref|XP_008666415.1|  PREDICTED: probable nucleolar protein 5-2          358   2e-119   
ref|XP_004984388.1|  PREDICTED: probable nucleolar protein 5-2-like     363   3e-119   Setaria italica
ref|XP_006650080.1|  PREDICTED: probable nucleolar protein 5-2-like     363   3e-119   Oryza brachyantha
ref|XP_008796212.1|  PREDICTED: probable nucleolar protein 5-2 is...    362   4e-119   Phoenix dactylifera
gb|ABF95925.1|  Nucleolar protein NOP5, putative, expressed             363   4e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008796213.1|  PREDICTED: probable nucleolar protein 5-2 is...    363   4e-119   Phoenix dactylifera
ref|NP_001050113.1|  Os03g0350300                                       362   4e-119   
ref|XP_011099778.1|  PREDICTED: probable nucleolar protein 5-2          363   5e-119   Sesamum indicum [beniseed]
dbj|BAN15014.1|  SAR DNA binding protein                                361   7e-119   Bromus inermis [awnless brome grass]
ref|XP_010687356.1|  PREDICTED: probable nucleolar protein 5-2          362   1e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004984387.1|  PREDICTED: probable nucleolar protein 5-2-like     362   1e-118   Setaria italica
dbj|BAA31260.1|  SAR DNA binding protein                                359   1e-118   Oryza sativa [red rice]
ref|XP_011099781.1|  PREDICTED: probable nucleolar protein 5-2          362   1e-118   Sesamum indicum [beniseed]
emb|CAK22424.1|  matrix attachment region binding protein               362   1e-118   Beta vulgaris [beet]
gb|EEC75255.1|  hypothetical protein OsI_11566                          364   2e-118   Oryza sativa Indica Group [Indian rice]
ref|XP_007208461.1|  hypothetical protein PRUPE_ppa003941mg             360   2e-118   Prunus persica
ref|XP_010025094.1|  PREDICTED: probable nucleolar protein 5-2          361   3e-118   Eucalyptus grandis [rose gum]
ref|XP_008218165.1|  PREDICTED: probable nucleolar protein 5-2          359   3e-118   Prunus mume [ume]
ref|XP_010241470.1|  PREDICTED: probable nucleolar protein 5-2 is...    361   3e-118   Nelumbo nucifera [Indian lotus]
ref|XP_002533223.1|  nucleolar protein nop56, putative                  358   2e-117   Ricinus communis
gb|EMS65034.1|  hypothetical protein TRIUR3_04158                       357   5e-117   Triticum urartu
gb|EYU23804.1|  hypothetical protein MIMGU_mgv1a003941mg                357   6e-117   Erythranthe guttata [common monkey flower]
gb|KDP23603.1|  hypothetical protein JCGZ_23436                         357   7e-117   Jatropha curcas
gb|EYU23803.1|  hypothetical protein MIMGU_mgv1a003693mg                357   7e-117   Erythranthe guttata [common monkey flower]
ref|XP_003537858.1|  PREDICTED: probable nucleolar protein 5-2-like     354   6e-116   Glycine max [soybeans]
ref|XP_008388628.1|  PREDICTED: probable nucleolar protein 5-2          354   6e-116   
ref|XP_002512277.1|  nucleolar protein nop56, putative                  355   6e-116   Ricinus communis
ref|XP_009342020.1|  PREDICTED: probable nucleolar protein 5-2          354   7e-116   Pyrus x bretschneideri [bai li]
ref|XP_009364569.1|  PREDICTED: probable nucleolar protein 5-2          353   8e-116   Pyrus x bretschneideri [bai li]
gb|KHN25404.1|  Putative nucleolar protein 5-2                          353   1e-115   Glycine soja [wild soybean]
gb|KDP35364.1|  hypothetical protein JCGZ_10348                         354   1e-115   Jatropha curcas
ref|XP_003540996.1|  PREDICTED: probable nucleolar protein 5-2-like     353   1e-115   Glycine max [soybeans]
ref|XP_008370662.1|  PREDICTED: probable nucleolar protein 5-2          353   1e-115   
ref|XP_007131795.1|  hypothetical protein PHAVU_011G042200g             352   3e-115   Phaseolus vulgaris [French bean]
ref|XP_003562489.1|  PREDICTED: probable nucleolar protein 5-2          351   8e-115   Brachypodium distachyon [annual false brome]
gb|KJB26511.1|  hypothetical protein B456_004G245100                    347   2e-114   Gossypium raimondii
gb|KJB82563.1|  hypothetical protein B456_013G202500                    344   6e-114   Gossypium raimondii
gb|KJB45049.1|  hypothetical protein B456_007G287100                    344   7e-114   Gossypium raimondii
ref|XP_004139213.1|  PREDICTED: probable nucleolar protein 5-2-li...    347   2e-113   Cucumis sativus [cucumbers]
ref|XP_008455669.1|  PREDICTED: probable nucleolar protein 5-2          347   2e-113   Cucumis melo [Oriental melon]
ref|XP_007030688.1|  NOP56-like pre RNA processing ribonucleoprot...    343   3e-113   
gb|EPS70798.1|  hypothetical protein M569_03961                         342   3e-113   Genlisea aurea
gb|KJB26509.1|  hypothetical protein B456_004G245100                    347   3e-113   Gossypium raimondii
ref|XP_004507477.1|  PREDICTED: probable nucleolar protein 5-1-like     347   5e-113   Cicer arietinum [garbanzo]
ref|XP_006838803.1|  hypothetical protein AMTR_s00002p00260990          348   5e-113   Amborella trichopoda
ref|XP_004139212.1|  PREDICTED: probable nucleolar protein 5-2-li...    347   6e-113   
gb|KJB45047.1|  hypothetical protein B456_007G287100                    347   7e-113   Gossypium raimondii
gb|KJB82560.1|  hypothetical protein B456_013G202500                    346   9e-113   Gossypium raimondii
gb|KHG01423.1|  putative nucleolar 5-2 -like protein                    346   9e-113   Gossypium arboreum [tree cotton]
ref|XP_006491841.1|  PREDICTED: probable nucleolar protein 5-1-like     346   9e-113   Citrus sinensis [apfelsine]
gb|KHG00213.1|  putative nucleolar 5-2 -like protein                    346   1e-112   Gossypium arboreum [tree cotton]
ref|XP_006432265.1|  hypothetical protein CICLE_v10000758mg             345   2e-112   Citrus clementina [clementine]
ref|XP_010674932.1|  PREDICTED: probable nucleolar protein 5-2          345   5e-112   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002319598.1|  hypothetical protein POPTR_0013s03260g             344   5e-112   Populus trichocarpa [western balsam poplar]
ref|XP_008650437.1|  PREDICTED: probable nucleolar protein 5-2          340   6e-112   
ref|XP_007030686.1|  NOP56-like pre RNA processing ribonucleoprot...    343   1e-111   
ref|XP_007030689.1|  NOP56-like pre RNA processing ribonucleoprot...    337   1e-111   
ref|XP_011013586.1|  PREDICTED: probable nucleolar protein 5-1          343   1e-111   Populus euphratica
ref|XP_011032532.1|  PREDICTED: probable nucleolar protein 5-1          343   1e-111   Populus euphratica
ref|XP_006382714.1|  hypothetical protein POPTR_0005s04710g             343   2e-111   Populus trichocarpa [western balsam poplar]
gb|KHG01259.1|  putative nucleolar 5-2 -like protein                    342   2e-111   Gossypium arboreum [tree cotton]
ref|XP_011003824.1|  PREDICTED: probable nucleolar protein 5-2          342   4e-111   Populus euphratica
ref|XP_003611088.1|  SAR DNA-binding protein-1                          340   4e-110   Medicago truncatula
gb|AAC16330.1|  SAR DNA-binding protein-1                               338   1e-109   Pisum sativum [garden pea]
ref|XP_003606983.1|  SAR DNA-binding protein-1                          337   3e-109   
ref|XP_010546633.1|  PREDICTED: probable nucleolar protein 5-2          337   4e-109   Tarenaya hassleriana [spider flower]
ref|XP_007030687.1|  NOP56-like pre RNA processing ribonucleoprot...    336   4e-109   
ref|XP_010550954.1|  PREDICTED: probable nucleolar protein 5-2          335   9e-109   Tarenaya hassleriana [spider flower]
tpg|DAA47456.1|  TPA: hypothetical protein ZEAMMB73_782083              327   1e-108   
gb|ACJ85748.1|  unknown                                                 335   2e-108   Medicago truncatula
ref|XP_006468094.1|  PREDICTED: probable nucleolar protein 5-2-li...    335   2e-108   Citrus sinensis [apfelsine]
ref|XP_006468095.1|  PREDICTED: probable nucleolar protein 5-2-li...    335   2e-108   Citrus sinensis [apfelsine]
ref|XP_006468097.1|  PREDICTED: probable nucleolar protein 5-2-li...    335   3e-108   Citrus sinensis [apfelsine]
ref|XP_006468096.1|  PREDICTED: probable nucleolar protein 5-2-li...    335   3e-108   Citrus sinensis [apfelsine]
ref|XP_006436388.1|  hypothetical protein CICLE_v10031140mg             333   5e-108   Citrus clementina [clementine]
tpg|DAA47457.1|  TPA: hypothetical protein ZEAMMB73_782083              328   7e-107   
ref|XP_006408115.1|  hypothetical protein EUTSA_v10020473mg             327   1e-105   Eutrema salsugineum [saltwater cress]
emb|CDX80674.1|  BnaC07g27700D                                          326   3e-105   
gb|AAC16331.1|  SAR DNA-binding protein-2                               326   3e-105   Pisum sativum [garden pea]
ref|XP_009151230.1|  PREDICTED: probable nucleolar protein 5-1          325   5e-105   Brassica rapa
ref|XP_009111930.1|  PREDICTED: probable nucleolar protein 5-1          325   7e-105   Brassica rapa
emb|CDY00004.1|  BnaC09g02970D                                          325   8e-105   
emb|CDY19706.1|  BnaA09g03590D                                          325   1e-104   Brassica napus [oilseed rape]
gb|AFW84118.1|  hypothetical protein ZEAMMB73_870642                    326   1e-104   
ref|XP_010455156.1|  PREDICTED: probable nucleolar protein 5-1          324   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010421656.1|  PREDICTED: probable nucleolar protein 5-1 is...    324   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010494044.1|  PREDICTED: probable nucleolar protein 5-1          323   6e-104   Camelina sativa [gold-of-pleasure]
gb|KFK37913.1|  hypothetical protein AALP_AA3G046300                    322   1e-103   Arabis alpina [alpine rockcress]
ref|XP_006394992.1|  hypothetical protein EUTSA_v10003966mg             321   3e-103   Eutrema salsugineum [saltwater cress]
emb|CDY52494.1|  BnaAnng11410D                                          318   2e-102   Brassica napus [oilseed rape]
ref|XP_002884489.1|  hypothetical protein ARALYDRAFT_896572             318   4e-102   Arabidopsis lyrata subsp. lyrata
ref|NP_187157.1|  putative SAR DNA-binding protein                      318   5e-102   Arabidopsis thaliana [mouse-ear cress]
emb|CAE45597.1|  SAR DNA-binding protein-like protein                   317   1e-101   Lotus japonicus
ref|XP_010422824.1|  PREDICTED: probable nucleolar protein 5-2          317   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_010485906.1|  PREDICTED: probable nucleolar protein 5-2          316   2e-101   Camelina sativa [gold-of-pleasure]
gb|AAN72071.1|  SAR DNA-binding protein - like                          312   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756465.1|  predicted protein                                  316   3e-101   
gb|AAB61073.1|  similar to S. cerevisiae SIK1P (PID:g984964)            312   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198064.1|  putative SAR DNA-binding protein                      312   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001753892.1|  predicted protein                                  313   6e-100   
ref|XP_010464014.1|  PREDICTED: probable nucleolar protein 5-2          313   7e-100   Camelina sativa [gold-of-pleasure]
ref|XP_002874406.1|  hypothetical protein ARALYDRAFT_489610             312   9e-100   
ref|XP_011457678.1|  PREDICTED: probable nucleolar protein 5-2          311   3e-99    Fragaria vesca subsp. vesca
gb|KFK23538.1|  hypothetical protein AALP_AAs63573U000200               308   7e-99    Arabis alpina [alpine rockcress]
ref|XP_006297275.1|  hypothetical protein CARUB_v10013290mg             310   2e-98    
ref|XP_006287421.1|  hypothetical protein CARUB_v10000627mg             308   3e-98    
gb|EEE59058.1|  hypothetical protein OsJ_10836                          307   4e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002970093.1|  hypothetical protein SELMODRAFT_146841             305   1e-96    Selaginella moellendorffii
ref|XP_002985284.1|  hypothetical protein SELMODRAFT_121625             300   8e-95    Selaginella moellendorffii
ref|XP_005850162.1|  hypothetical protein CHLNCDRAFT_57124              310   1e-93    Chlorella variabilis
ref|XP_005650009.1|  Nop-domain-containing protein                      286   2e-89    Coccomyxa subellipsoidea C-169
gb|KJB26512.1|  hypothetical protein B456_004G245100                    281   9e-88    Gossypium raimondii
gb|KDO50620.1|  hypothetical protein CISIN_1g0088522mg                  268   2e-87    Citrus sinensis [apfelsine]
gb|KIY95194.1|  putative nucleolar protein NOP5-2                       271   1e-86    Monoraphidium neglectum
gb|ACA96503.1|  MAR-binding protein                                     277   3e-86    Dunaliella salina
gb|AAZ31075.2|  MAR-binding protein                                     277   3e-86    Dunaliella salina
emb|CEF96991.1|  NOSIC                                                  273   2e-85    Ostreococcus tauri
ref|XP_002507734.1|  nucleolar RNA binding protein                      273   3e-85    Micromonas commoda
emb|CDY50583.1|  BnaC02g39570D                                          273   6e-85    Brassica napus [oilseed rape]
gb|AAY34142.1|  Nop58p                                                  270   4e-84    Physarum polycephalum
ref|XP_001416562.1|  predicted protein                                  269   9e-84    Ostreococcus lucimarinus CCE9901
ref|XP_007512606.1|  predicted protein                                  269   1e-83    Bathycoccus prasinos
ref|XP_009496003.1|  hypothetical protein H696_03867                    266   4e-83    Fonticula alba
emb|CAJ82550.1|  nucleolar protein 5                                    265   3e-82    Xenopus tropicalis [western clawed frog]
ref|XP_006681446.1|  hypothetical protein BATDEDRAFT_33621              265   5e-82    Batrachochytrium dendrobatidis JAM81
ref|NP_989298.1|  NOP58 ribonucleoprotein                               265   1e-81    Xenopus tropicalis [western clawed frog]
gb|AAH77204.1|  MGC78950 protein                                        265   1e-81    Xenopus laevis [clawed frog]
ref|NP_001086628.1|  NOP58 ribonucleoprotein                            265   1e-81    Xenopus laevis [clawed frog]
gb|AAI30064.1|  LOC398558 protein                                       262   5e-81    Xenopus laevis [clawed frog]
gb|AAH44082.1|  LOC398558 protein                                       262   5e-81    Xenopus laevis [clawed frog]
gb|AAI06292.1|  LOC398558 protein                                       262   1e-80    Xenopus laevis [clawed frog]
ref|XP_005995463.1|  PREDICTED: nucleolar protein 58 isoform X2         261   3e-80    Latimeria chalumnae
ref|XP_005995462.1|  PREDICTED: nucleolar protein 58 isoform X1         261   3e-80    Latimeria chalumnae
ref|XP_002166198.2|  PREDICTED: nucleolar protein 58-like               256   3e-80    
ref|XP_005777664.1|  hypothetical protein EMIHUDRAFT_206438             256   6e-80    Emiliania huxleyi CCMP1516
ref|XP_005771074.1|  hypothetical protein EMIHUDRAFT_75659              256   7e-80    Emiliania huxleyi CCMP1516
gb|KDD76960.1|  putative snoRNA binding domain-containing protein       259   7e-80    Helicosporidium sp. ATCC 50920
emb|CDS04923.1|  hypothetical protein LRAMOSA07453                      258   3e-79    Lichtheimia ramosa
tpg|DAA42144.1|  TPA: hypothetical protein ZEAMMB73_016967              253   3e-79    
ref|XP_001690352.1|  nucleolar protein, component of C/D snoRNPs        258   3e-79    Chlamydomonas reinhardtii
emb|CDH51673.1|  loc398558 protein                                      258   3e-79    Lichtheimia corymbifera JMRC:FSU:9682
gb|KHN07217.1|  Putative nucleolar protein 5-2                          248   4e-79    Glycine soja [wild soybean]
ref|XP_011399356.1|  putative nucleolar protein 5-2                     257   5e-79    Auxenochlorella protothecoides
ref|XP_006567771.1|  PREDICTED: nucleolar protein 58-like               259   6e-79    Apis mellifera [bee]
ref|XP_006618628.1|  PREDICTED: nucleolar protein 58-like               258   1e-78    Apis dorsata [rock honeybee]
ref|XP_003056558.1|  nucleolar RNA binding protein                      255   1e-78    Micromonas pusilla CCMP1545
ref|XP_007501981.1|  PREDICTED: nucleolar protein 58 isoform X4         257   2e-78    Monodelphis domestica
ref|XP_007501980.1|  PREDICTED: nucleolar protein 58 isoform X3         257   2e-78    Monodelphis domestica
ref|XP_007501979.1|  PREDICTED: nucleolar protein 58 isoform X2         257   2e-78    Monodelphis domestica
ref|XP_003230376.2|  PREDICTED: nucleolar protein 58-like               257   2e-78    Anolis carolinensis [Carolina anole]
ref|XP_001371978.1|  PREDICTED: nucleolar protein 58 isoform X1         257   2e-78    Monodelphis domestica
ref|XP_003491528.1|  PREDICTED: nucleolar protein 58-like               256   9e-78    Bombus impatiens
gb|EFX84998.1|  hypothetical protein DAPPUDRAFT_300779                  254   2e-77    Daphnia pulex
ref|XP_001750802.1|  hypothetical protein                               253   2e-77    Monosiga brevicollis MX1
ref|XP_002598583.1|  hypothetical protein BRAFLDRAFT_113716             253   3e-77    Branchiostoma floridae
gb|EIE91295.1|  hypothetical protein RO3G_16006                         252   5e-77    Rhizopus delemar RA 99-880
ref|XP_009054674.1|  hypothetical protein LOTGIDRAFT_144966             250   1e-76    Lottia gigantea
emb|CEP14638.1|  hypothetical protein                                   251   2e-76    Parasitella parasitica
ref|XP_008618047.1|  hypothetical protein SDRG_13728                    251   2e-76    Saprolegnia diclina VS20
gb|EIE85756.1|  hypothetical protein RO3G_10466                         250   2e-76    Rhizopus delemar RA 99-880
ref|XP_011064344.1|  PREDICTED: nucleolar protein 58-like               254   2e-76    Acromyrmex echinatior
gb|KDO24106.1|  hypothetical protein SPRG_10894                         250   2e-76    Saprolegnia parasitica CBS 223.65
ref|XP_008113176.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    247   5e-76    Anolis carolinensis [Carolina anole]
ref|XP_011341650.1|  PREDICTED: nucleolar protein 58                    253   7e-76    Ooceraea biroi
dbj|GAN04212.1|  nop-domain-containing protein                          248   1e-75    Mucor ambiguus
gb|EPB89396.1|  hypothetical protein HMPREF1544_03765                   248   1e-75    Mucor circinelloides f. circinelloides 1006PhL
emb|CEI87149.1|  Putative U3 snoRNP protein Nop58                       244   2e-75    Rhizopus microsporus
ref|XP_011267939.1|  PREDICTED: nucleolar protein 58                    252   2e-75    Camponotus floridanus
emb|CEI96131.1|  Putative Nucleolar protein 58                          246   1e-74    Rhizopus microsporus
ref|XP_009086324.1|  PREDICTED: nucleolar protein 58                    246   1e-74    Serinus canaria [canary]
gb|EMC81163.1|  Nucleolar protein 58                                    244   2e-74    
ref|XP_005519952.1|  PREDICTED: nucleolar protein 58                    246   2e-74    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006273562.1|  PREDICTED: nucleolar protein 58                    246   2e-74    Alligator mississippiensis
ref|XP_007422082.1|  PREDICTED: nucleolar protein 58                    246   2e-74    Python bivittatus
emb|CEG70655.1|  Putative Nucleolar protein 58                          245   2e-74    Rhizopus microsporus
ref|XP_005049217.1|  PREDICTED: nucleolar protein 58                    246   2e-74    Ficedula albicollis
emb|CCA22673.1|  nucleolar protein NOP5 putative                        245   2e-74    Albugo laibachii Nc14
ref|XP_006017720.1|  PREDICTED: nucleolar protein 58                    246   3e-74    Alligator sinensis
ref|XP_010563240.1|  PREDICTED: nucleolar protein 58 isoform X2         244   3e-74    Haliaeetus leucocephalus
ref|XP_421942.1|  PREDICTED: nucleolar protein 58                       245   3e-74    Gallus gallus [bantam]
ref|XP_010711773.1|  PREDICTED: nucleolar protein 58                    245   4e-74    Meleagris gallopavo [common turkey]
ref|XP_005837542.1|  hypothetical protein GUITHDRAFT_66997              244   4e-74    Guillardia theta CCMP2712
ref|XP_005306283.1|  PREDICTED: nucleolar protein 58 isoform X1         245   6e-74    Chrysemys picta bellii
ref|XP_004378293.1|  PREDICTED: nucleolar protein 58                    245   7e-74    Trichechus manatus latirostris
gb|EGW06124.1|  Nucleolar protein 58                                    235   7e-74    Cricetulus griseus [Chinese hamsters]
ref|XP_005511378.1|  PREDICTED: nucleolar protein 58                    244   9e-74    
ref|XP_010563232.1|  PREDICTED: nucleolar protein 58 isoform X1         244   9e-74    Haliaeetus leucocephalus
ref|XP_009836884.1|  hypothetical protein H257_11594                    244   9e-74    Aphanomyces astaci
ref|XP_002189225.1|  PREDICTED: nucleolar protein 58                    244   1e-73    Taeniopygia guttata
ref|XP_005144700.1|  PREDICTED: nucleolar protein 58                    244   1e-73    Melopsittacus undulatus
ref|XP_008872332.1|  hypothetical protein H310_08394                    243   2e-73    Aphanomyces invadans
ref|XP_002903084.1|  nucleolar protein NOP5                             243   2e-73    Phytophthora infestans T30-4
ref|XP_003743589.1|  PREDICTED: nucleolar protein 58                    244   2e-73    Galendromus occidentalis
gb|ETL31667.1|  hypothetical protein L916_15560                         242   4e-73    Phytophthora parasitica
gb|ETI38018.1|  hypothetical protein F443_16119                         242   4e-73    Phytophthora parasitica P1569
ref|XP_008911207.1|  hypothetical protein PPTG_15671                    242   4e-73    Phytophthora parasitica INRA-310
ref|XP_004367446.1|  matrix attachment region binding protein           242   6e-73    Acanthamoeba castellanii str. Neff
ref|XP_008187145.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    241   7e-73    
ref|XP_009530825.1|  hypothetical protein PHYSODRAFT_246404             241   8e-73    Phytophthora sojae
emb|CBJ32359.1|  conserved unknown protein                              243   1e-72    Ectocarpus siliculosus
gb|ESA16249.1|  hypothetical protein GLOINDRAFT_158776                  239   1e-72    
dbj|BAJ91724.1|  predicted protein                                      242   3e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003907873.1|  PREDICTED: nucleolar protein 58 isoform X1         237   3e-72    
ref|XP_011308274.1|  PREDICTED: nucleolar protein 58                    241   4e-72    Fopius arisanus
ref|XP_001641027.1|  predicted protein                                  239   5e-72    Nematostella vectensis
gb|AAH87637.1|  Nol5 protein                                            238   5e-72    Rattus norvegicus [brown rat]
ref|XP_005574023.1|  PREDICTED: nucleolar protein 58 isoform X4         237   6e-72    
ref|XP_007190607.1|  PREDICTED: nucleolar protein 58 isoform X6         237   7e-72    Balaenoptera acutorostrata scammoni
ref|XP_003701979.1|  PREDICTED: nucleolar protein 58-like               241   7e-72    Megachile rotundata
ref|XP_006636806.1|  PREDICTED: nucleolar protein 58-like               239   8e-72    
gb|AAC23535.1|  unknown                                                 237   9e-72    Rattus sp. [rats]
ref|XP_002407966.1|  ribosome biogenesis protein - Nop58p/Nop5p, ...    239   1e-71    Ixodes scapularis [blacklegged tick]
dbj|BAE21954.1|  unnamed protein product                                237   1e-71    Mus musculus [mouse]
ref|XP_008556600.1|  PREDICTED: nucleolar protein 58                    240   1e-71    
emb|CAH91951.1|  hypothetical protein                                   237   1e-71    Pongo abelii [orang utan]
ref|XP_005574021.1|  PREDICTED: nucleolar protein 58 isoform X2         237   2e-71    Macaca fascicularis [crab eating macaque]
gb|KFH64217.1|  hypothetical protein MVEG_10042                         238   2e-71    Mortierella verticillata NRRL 6337
ref|XP_004701594.1|  PREDICTED: nucleolar protein 58                    238   3e-71    Echinops telfairi [lesser hedgehog tenrec]
dbj|BAE22082.1|  unnamed protein product                                237   3e-71    Mus musculus [mouse]
gb|AAH09306.1|  NOP58 protein                                           238   3e-71    Homo sapiens [man]
ref|XP_003483763.1|  PREDICTED: nucleolar protein 58                    238   4e-71    
ref|XP_007520557.1|  PREDICTED: nucleolar protein 58                    238   4e-71    Erinaceus europaeus [common hedgehog]
ref|XP_009236281.1|  PREDICTED: nucleolar protein 58                    236   4e-71    
ref|XP_006921426.1|  PREDICTED: nucleolar protein 58 isoform X1         237   5e-71    Pteropus alecto
ref|NP_057018.1|  nucleolar protein 58                                  237   5e-71    Homo sapiens [man]
ref|XP_005858297.1|  PREDICTED: nucleolar protein 58 isoform X1         238   5e-71    Myotis brandtii
ref|XP_005366385.1|  PREDICTED: nucleolar protein 58 isoform X2         237   5e-71    
ref|XP_006153110.1|  PREDICTED: nucleolar protein 58-like isoform X1    237   5e-71    Tupaia chinensis
ref|XP_003785079.1|  PREDICTED: nucleolar protein 58                    237   5e-71    Otolemur garnettii
ref|XP_004393512.1|  PREDICTED: nucleolar protein 58 isoform 2          237   5e-71    Odobenus rosmarus divergens
ref|XP_008144676.1|  PREDICTED: nucleolar protein 58                    238   5e-71    Eptesicus fuscus
ref|XP_003820813.1|  PREDICTED: nucleolar protein 58 isoform X1         237   5e-71    Pan paniscus [bonobo]
ref|XP_516036.2|  PREDICTED: nucleolar protein 58 isoform X1            237   5e-71    Pan troglodytes
ref|XP_005858298.1|  PREDICTED: nucleolar protein 58 isoform X2         237   5e-71    
ref|NP_068522.1|  nucleolar protein 58                                  237   5e-71    Rattus norvegicus [brown rat]
ref|NP_001248115.1|  nucleolar protein 58                               237   5e-71    Macaca mulatta [rhesus macaque]
ref|XP_003254003.1|  PREDICTED: nucleolar protein 58                    237   5e-71    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_002712586.1|  PREDICTED: nucleolar protein 58 isoform X1         237   6e-71    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004426861.1|  PREDICTED: nucleolar protein 58                    237   6e-71    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006862038.1|  PREDICTED: nucleolar protein 58                    237   6e-71    Chrysochloris asiatica
ref|XP_007964075.1|  PREDICTED: nucleolar protein 58 isoform X1         237   6e-71    Chlorocebus sabaeus
ref|XP_005397115.1|  PREDICTED: nucleolar protein 58                    237   6e-71    Chinchilla lanigera
ref|XP_005640604.1|  PREDICTED: nucleolar protein 58 isoform X2         237   6e-71    
ref|XP_004393511.1|  PREDICTED: nucleolar protein 58 isoform 1          237   6e-71    Odobenus rosmarus divergens
ref|XP_005366384.1|  PREDICTED: nucleolar protein 58 isoform X1         237   6e-71    Microtus ochrogaster [prairie voles]
ref|XP_004601337.1|  PREDICTED: nucleolar protein 58                    237   6e-71    Sorex araneus [Eurasian shrew]
ref|XP_006734635.1|  PREDICTED: nucleolar protein 58 isoform X2         237   6e-71    Leptonychotes weddellii
ref|XP_003497458.1|  PREDICTED: nucleolar protein 58 isoform X1         237   6e-71    Cricetulus griseus [Chinese hamsters]
ref|XP_002874404.1|  hypothetical protein ARALYDRAFT_326985             235   7e-71    
ref|XP_003406179.1|  PREDICTED: nucleolar protein 58 isoform X1         237   7e-71    Loxodonta africana [African bush elephant]
ref|XP_004764234.1|  PREDICTED: nucleolar protein 58 isoform X1         237   7e-71    Mustela putorius furo [black ferret]
ref|XP_008063382.1|  PREDICTED: nucleolar protein 58                    237   7e-71    Carlito syrichta
dbj|BAC31822.1|  unnamed protein product                                237   7e-71    
ref|XP_005070655.1|  PREDICTED: nucleolar protein 58 isoform X2         237   7e-71    
ref|XP_004764235.1|  PREDICTED: nucleolar protein 58 isoform X2         237   7e-71    
ref|NP_061356.2|  nucleolar protein 58                                  237   7e-71    
ref|XP_008833672.1|  PREDICTED: nucleolar protein 58 isoform X1         237   7e-71    
gb|ERE81087.1|  nucleolar protein 58                                    237   7e-71    
ref|XP_006975091.1|  PREDICTED: nucleolar protein 58 isoform X1         237   7e-71    
ref|XP_010614435.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_011223162.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_005640603.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_005070654.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_006935540.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_004904636.1|  PREDICTED: nucleolar protein 58                    237   8e-71    
ref|XP_001601436.1|  PREDICTED: nucleolar protein 58                    238   8e-71    
ref|XP_006734634.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_008685594.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_007090043.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
ref|XP_006756294.1|  PREDICTED: nucleolar protein 58 isoform X1         237   8e-71    
gb|EWM24974.1|  nucleolar protein expressed                             237   8e-71    
gb|AAH44394.1|  Nop58 protein                                           236   8e-71    
ref|XP_002749695.1|  PREDICTED: nucleolar protein 58 isoform X1         236   9e-71    
ref|XP_004262889.1|  PREDICTED: nucleolar protein 58 isoform 2          236   1e-70    
ref|XP_007469243.1|  PREDICTED: nucleolar protein 58 isoform X2         236   1e-70    
gb|AAI55195.1|  Nop58 protein                                           237   1e-70    
ref|XP_007190602.1|  PREDICTED: nucleolar protein 58 isoform X1         236   1e-70    
ref|XP_002946402.1|  hypothetical protein VOLCADRAFT_102990             236   1e-70    
ref|XP_004262888.1|  PREDICTED: nucleolar protein 58 isoform 1          236   1e-70    
ref|XP_007469242.1|  PREDICTED: nucleolar protein 58 isoform X1         236   1e-70    
ref|XP_005165784.1|  PREDICTED: nucleolar protein 58 isoform X1         237   1e-70    
gb|AAI51885.1|  Nop58 protein                                           236   1e-70    
ref|XP_003966575.1|  PREDICTED: nucleolar protein 58-like               236   1e-70    
ref|NP_001009889.1|  nucleolar protein 58                               236   2e-70    
ref|XP_006205257.1|  PREDICTED: nucleolar protein 58 isoform X2         236   2e-70    
ref|XP_011154526.1|  PREDICTED: nucleolar protein 58                    239   2e-70    
ref|XP_005338975.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    236   2e-70    
gb|EXX52337.1|  Nop58p                                                  239   2e-70    
ref|XP_006205258.1|  PREDICTED: nucleolar protein 58 isoform X3         236   2e-70    
ref|XP_006189993.1|  PREDICTED: nucleolar protein 58 isoform X3         236   2e-70    
ref|XP_006189992.1|  PREDICTED: nucleolar protein 58 isoform X2         236   2e-70    
ref|XP_007908792.1|  PREDICTED: nucleolar protein 58                    236   2e-70    
ref|XP_010141276.1|  PREDICTED: nucleolar protein 58                    235   2e-70    
ref|XP_006205256.1|  PREDICTED: nucleolar protein 58 isoform X1         236   2e-70    
ref|XP_006189991.1|  PREDICTED: nucleolar protein 58 isoform X1         236   2e-70    
ref|XP_004004885.1|  PREDICTED: nucleolar protein 58                    236   2e-70    
gb|AAI51726.1|  NOP58 protein                                           236   2e-70    
ref|XP_005904317.1|  PREDICTED: nucleolar protein 58                    235   3e-70    
ref|NP_001179886.1|  nucleolar protein 58                               235   3e-70    
ref|XP_005980258.1|  PREDICTED: nucleolar protein 58 isoform X2         236   3e-70    
ref|XP_005676438.1|  PREDICTED: nucleolar protein 58 isoform X1         236   3e-70    
ref|XP_007117841.1|  PREDICTED: nucleolar protein 58 isoform X1         235   3e-70    
ref|XP_005676439.1|  PREDICTED: nucleolar protein 58 isoform X2         235   3e-70    
ref|XP_004458928.1|  PREDICTED: nucleolar protein 58 isoform 1          235   3e-70    
ref|XP_005202669.1|  PREDICTED: nucleolar protein 58 isoform X1         235   3e-70    
emb|CAB55989.2|  hypothetical protein                                   233   3e-70    
ref|XP_005980257.1|  PREDICTED: nucleolar protein 58 isoform X1         235   5e-70    
emb|CBK23082.2|  unnamed protein product                                235   5e-70    
ref|XP_011171488.1|  PREDICTED: nucleolar protein 58                    237   5e-70    
emb|CCI10534.1|  unnamed protein product                                233   7e-70    
ref|XP_006889153.1|  PREDICTED: nucleolar protein 58                    234   7e-70    
ref|XP_007248939.1|  PREDICTED: nucleolar protein 58-like               235   8e-70    
emb|CEI90787.1|  Putative NOSIC domain-containing protein               223   3e-69    
gb|KFB40543.1|  AGAP002171-PA-like protein                              233   4e-69    
ref|XP_008323109.1|  PREDICTED: nucleolar protein 58                    233   6e-69    
ref|XP_006082477.1|  PREDICTED: nucleolar protein 58                    231   8e-69    
ref|XP_004524214.1|  PREDICTED: nucleolar protein 58-like               231   9e-69    
ref|XP_003611091.1|  SAR DNA-binding protein-1                          221   1e-68    
gb|KHN70664.1|  Nucleolar protein 58                                    232   1e-68    
gb|ERE81088.1|  nucleolar protein 58                                    231   2e-68    
ref|XP_004929127.1|  PREDICTED: nucleolar protein 58-like isoform X3    230   2e-68    
ref|XP_004929126.1|  PREDICTED: nucleolar protein 58-like isoform X2    230   3e-68    
ref|XP_004929125.1|  PREDICTED: nucleolar protein 58-like isoform X1    230   3e-68    
ref|XP_011484149.1|  PREDICTED: nucleolar protein 58                    226   5e-68    
ref|XP_002052488.1|  GJ17567                                            229   6e-68    
ref|XP_308017.5|  AGAP002171-PA                                         229   1e-67    
ref|XP_004350742.1|  MAR-binding protein                                230   1e-67    
gb|KFP49456.1|  Nucleolar protein 58                                    223   1e-67    
ref|NP_001133496.1|  Nucleolar protein 5                                228   1e-67    
ref|XP_010885076.1|  PREDICTED: nucleolar protein 58                    228   1e-67    
gb|KDR23571.1|  Nucleolar protein 58                                    229   1e-67    
ref|XP_003384738.1|  PREDICTED: nucleolar protein 58-like               228   1e-67    
ref|XP_003766066.1|  PREDICTED: nucleolar protein 58                    230   2e-67    
gb|KFV47252.1|  Nucleolar protein 58                                    225   2e-67    
ref|XP_002116484.1|  hypothetical protein TRIADDRAFT_30778              226   2e-67    
ref|XP_009962135.1|  PREDICTED: nucleolar protein 58                    225   2e-67    
ref|XP_001864867.1|  nucleolar protein NOP5                             228   2e-67    
dbj|BAN20575.1|  hypothetical protein                                   228   3e-67    
gb|ETN58428.1|  nucleolar protein NOP5                                  227   8e-67    
gb|ENN72260.1|  hypothetical protein YQE_11121                          226   1e-66    
gb|KFV52995.1|  Nucleolar protein 58                                    223   1e-66    
ref|XP_005808115.1|  PREDICTED: nucleolar protein 58-like               226   1e-66    
ref|XP_007071996.1|  PREDICTED: nucleolar protein 58                    226   1e-66    
gb|KFV18563.1|  Nucleolar protein 58                                    225   2e-66    
ref|XP_973420.1|  PREDICTED: nucleolar protein 58                       226   2e-66    
gb|KFR14872.1|  Nucleolar protein 58                                    223   2e-66    
gb|KFO12035.1|  Nucleolar protein 58                                    224   3e-66    
ref|XP_006897028.1|  PREDICTED: nucleolar protein 58-like               216   3e-66    
ref|XP_008283621.1|  PREDICTED: nucleolar protein 58 isoform X2         225   3e-66    
ref|XP_008283620.1|  PREDICTED: nucleolar protein 58 isoform X1         225   3e-66    
ref|XP_010738555.1|  PREDICTED: nucleolar protein 58                    225   3e-66    
ref|XP_005484291.1|  PREDICTED: nucleolar protein 58                    224   5e-66    
ref|XP_009985382.1|  PREDICTED: nucleolar protein 58                    224   5e-66    
ref|XP_005097537.1|  PREDICTED: nucleolar protein 58-like               224   5e-66    
gb|EFA85918.1|  MAR-binding protein                                     226   6e-66    
ref|XP_002430815.1|  Nucleolar protein NOP5, putative                   225   6e-66    
gb|AAY34140.1|  Nop58p                                                  219   7e-66    
gb|KFP02491.1|  Nucleolar protein 58                                    222   7e-66    
gb|KFV10796.1|  Nucleolar protein 58                                    223   7e-66    
gb|KFQ17268.1|  Nucleolar protein 58                                    223   7e-66    
ref|XP_004570503.1|  PREDICTED: nucleolar protein 58-like isoform X1    224   8e-66    
ref|XP_004570504.1|  PREDICTED: nucleolar protein 58-like isoform X2    224   8e-66    
gb|KGL97403.1|  Nucleolar protein 58                                    223   9e-66    
ref|XP_008423022.1|  PREDICTED: nucleolar protein 58                    223   9e-66    
ref|XP_006809619.1|  PREDICTED: nucleolar protein 58-like               224   9e-66    
ref|XP_668690.1|  snoRNA binding domain                                 222   1e-65    
gb|KFQ12269.1|  Nucleolar protein 58                                    223   1e-65    
ref|XP_005943428.1|  PREDICTED: nucleolar protein 58-like isoform X1    223   1e-65    
ref|XP_005943429.1|  PREDICTED: nucleolar protein 58-like isoform X2    223   1e-65    
gb|KFP26270.1|  Nucleolar protein 58                                    223   1e-65    
ref|XP_003696631.1|  PREDICTED: nucleolar protein 58-like               228   1e-65    
gb|KFQ45269.1|  Nucleolar protein 58                                    223   1e-65    
gb|KFO75339.1|  Nucleolar protein 58                                    223   1e-65    
gb|KFP42804.1|  Nucleolar protein 58                                    223   1e-65    
ref|XP_004990291.1|  nucleolar protein 5                                223   1e-65    
gb|KFQ00730.1|  Nucleolar protein 58                                    223   1e-65    
ref|XP_005416180.1|  PREDICTED: nucleolar protein 58                    223   2e-65    
gb|ETE66100.1|  Nucleolar protein 58                                    223   2e-65    
ref|XP_005016922.1|  PREDICTED: nucleolar protein 58 isoform X2         223   2e-65    
gb|KFQ94812.1|  Nucleolar protein 58                                    222   2e-65    
ref|XP_005016921.1|  PREDICTED: nucleolar protein 58 isoform X1         223   2e-65    
ref|XP_010076307.1|  PREDICTED: nucleolar protein 58                    223   2e-65    
ref|XP_002088107.1|  GE18393                                            222   2e-65    
gb|KFZ49164.1|  Nucleolar protein 58                                    222   2e-65    
gb|KFP88851.1|  Nucleolar protein 58                                    222   2e-65    
ref|XP_005465917.1|  PREDICTED: nucleolar protein 58                    223   3e-65    
ref|XP_005237133.1|  PREDICTED: nucleolar protein 58                    223   3e-65    
gb|EOB03329.1|  Nucleolar protein 5                                     220   3e-65    
gb|KFV64288.1|  Nucleolar protein 58                                    222   3e-65    
gb|KFM11174.1|  Nucleolar protein 58                                    222   3e-65    
gb|KFQ40527.1|  Nucleolar protein 58                                    222   3e-65    
gb|KFW61788.1|  Nucleolar protein 58                                    222   3e-65    
ref|XP_011432893.1|  PREDICTED: nucleolar protein 58-like               222   3e-65    
gb|KFO59877.1|  Nucleolar protein 58                                    222   3e-65    
gb|KFW02653.1|  Nucleolar protein 58                                    222   3e-65    
ref|XP_010784446.1|  PREDICTED: nucleolar protein 58 isoform X2         222   3e-65    
ref|XP_010784445.1|  PREDICTED: nucleolar protein 58 isoform X1         222   3e-65    
gb|KFQ74083.1|  Nucleolar protein 58                                    221   3e-65    
ref|XP_010120485.1|  PREDICTED: nucleolar protein 58                    221   4e-65    
ref|XP_010202697.1|  PREDICTED: nucleolar protein 58                    221   4e-65    
gb|KFW89632.1|  Nucleolar protein 58                                    221   4e-65    
ref|XP_008947581.1|  PREDICTED: nucleolar protein 58                    223   4e-65    
ref|XP_009938133.1|  PREDICTED: nucleolar protein 58                    221   4e-65    
ref|XP_005434610.1|  PREDICTED: nucleolar protein 58                    223   4e-65    
gb|KFP19825.1|  Nucleolar protein 58                                    221   4e-65    
gb|KFU84958.1|  Nucleolar protein 58                                    221   4e-65    
ref|XP_008633036.1|  PREDICTED: nucleolar protein 58                    222   4e-65    
ref|XP_007565433.1|  PREDICTED: nucleolar protein 58 isoform X2         222   5e-65    
gb|EJW86153.1|  hypothetical protein WUBG_02934                         220   6e-65    
gb|KFV86118.1|  Nucleolar protein 58                                    221   6e-65    
ref|XP_006130811.1|  PREDICTED: nucleolar protein 58                    221   6e-65    
gb|KGL80295.1|  Nucleolar protein 58                                    221   7e-65    
ref|XP_781458.2|  PREDICTED: nucleolar protein 58                       221   7e-65    
ref|XP_626779.1|  nucleolar protein NOP5/NOP58-like pre-mRNA spli...    219   7e-65    
gb|KFZ53794.1|  Nucleolar protein 58                                    221   7e-65    
gb|KFP67783.1|  Nucleolar protein 58                                    221   8e-65    
ref|XP_009331224.1|  PREDICTED: nucleolar protein 58                    221   9e-65    
ref|XP_010217344.1|  PREDICTED: nucleolar protein 58                    221   9e-65    
ref|XP_009912989.1|  PREDICTED: nucleolar protein 58                    220   1e-64    
ref|XP_010405578.1|  PREDICTED: nucleolar protein 58                    221   1e-64    
gb|KFQ66314.1|  Nucleolar protein 58                                    220   1e-64    
ref|XP_009682520.1|  PREDICTED: nucleolar protein 58                    220   2e-64    
ref|XP_010150930.1|  PREDICTED: nucleolar protein 58                    220   2e-64    
ref|XP_009894776.1|  PREDICTED: nucleolar protein 58                    220   2e-64    
ref|XP_009867823.1|  PREDICTED: nucleolar protein 58                    220   2e-64    
ref|XP_010005686.1|  PREDICTED: nucleolar protein 58                    221   2e-64    
ref|XP_009558103.1|  PREDICTED: nucleolar protein 58                    220   2e-64    
ref|XP_009489427.1|  PREDICTED: nucleolar protein 58                    220   2e-64    
ref|XP_009704053.1|  PREDICTED: nucleolar protein 58                    219   2e-64    
emb|CCA71243.1|  probable NOP58-required for pre-18S rRNA processing    221   2e-64    
gb|KFQ83091.1|  Nucleolar protein 58                                    219   2e-64    
gb|EHJ76702.1|  hypothetical protein KGM_05763                          220   2e-64    
ref|XP_010161415.1|  PREDICTED: nucleolar protein 58                    220   3e-64    
ref|XP_008494188.1|  PREDICTED: nucleolar protein 58                    221   3e-64    
ref|XP_009460634.1|  PREDICTED: nucleolar protein 58                    221   4e-64    
ref|XP_009641816.1|  PREDICTED: nucleolar protein 58                    219   7e-64    
ref|XP_009888542.1|  PREDICTED: nucleolar protein 58                    219   8e-64    
ref|XP_011495780.1|  PREDICTED: nucleolar protein 58                    219   8e-64    
ref|XP_009809548.1|  PREDICTED: nucleolar protein 58                    216   8e-64    
gb|KFP74755.1|  Nucleolar protein 58                                    218   8e-64    
ref|XP_009282980.1|  PREDICTED: nucleolar protein 58                    221   9e-64    
ref|XP_009019750.1|  hypothetical protein HELRODRAFT_94516              222   1e-63    
ref|XP_002737742.1|  PREDICTED: nucleolar protein 58-like               219   1e-63    
gb|EPQ02705.1|  Nucleolar protein 58                                    219   1e-63    
emb|CAG04989.1|  unnamed protein product                                207   2e-63    
gb|EJY83562.1|  Nop multi-domain protein                                215   2e-63    
ref|XP_008035630.1|  Nop-domain-containing protein                      218   2e-63    
ref|XP_007364391.1|  Nop-domain-containing protein                      218   2e-63    
ref|XP_009067494.1|  PREDICTED: nucleolar protein 58                    217   2e-63    
gb|ELW62707.1|  Nucleolar protein 58                                    216   4e-63    
ref|XP_007338313.1|  Nop-domain-containing protein                      218   4e-63    
emb|CCL99180.1|  predicted protein                                      217   5e-63    
gb|EFB14929.1|  hypothetical protein PANDA_007776                       214   5e-63    
gb|EMD41003.1|  hypothetical protein CERSUDRAFT_71225                   214   5e-63    
ref|XP_002671988.1|  predicted protein                                  214   5e-63    
ref|XP_009267103.1|  Nucleolar protein 58                               216   7e-63    
ref|XP_005601801.1|  PREDICTED: nucleolar protein 58                    216   7e-63    
ref|XP_007862590.1|  Nop domain-containing protein                      216   9e-63    
ref|XP_011213731.1|  PREDICTED: nucleolar protein 58                    215   9e-63    
gb|EPT03090.1|  hypothetical protein FOMPIDRAFT_1159146                 216   1e-62    
ref|XP_011190691.1|  PREDICTED: nucleolar protein 58                    215   1e-62    
emb|CDW76614.1|  UNKNOWN                                                213   1e-62    
dbj|GAM26411.1|  hypothetical protein SAMD00019534_095860               217   1e-62    
ref|XP_003286800.1|  hypothetical protein DICPUDRAFT_31443              215   2e-62    
ref|XP_002141621.1|  nucleolar protein 5                                213   2e-62    
ref|XP_010493886.1|  PREDICTED: probable nucleolar protein 5-2          202   2e-62    
gb|EMS19643.1|  nucleolar protein NOP58                                 214   4e-62    
gb|EGU11242.1|  Nucleolar protein 58                                    214   4e-62    
gb|KDQ20622.1|  hypothetical protein BOTBODRAFT_124315                  215   4e-62    
ref|XP_008471019.1|  PREDICTED: nucleolar protein 58                    213   6e-62    
ref|XP_002123502.1|  PREDICTED: nucleolar protein 58                    214   7e-62    
ref|XP_008515601.1|  PREDICTED: nucleolar protein 58 isoform X2         213   7e-62    
ref|XP_007381782.1|  Nop-domain-containing protein                      214   8e-62    



>dbj|BAB41076.1| MAR-binding protein [Nicotiana tabacum]
Length=555

 Score =   377 bits (969),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009769588.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana sylvestris]
Length=559

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009591833.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana tomentosiformis]
Length=559

 Score =   376 bits (965),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/190 (94%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGSQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CAN73717.1| hypothetical protein VITISV_038844 [Vitis vinifera]
Length=472

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARQVVKLKAFSKFENTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_004247627.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=547

 Score =   371 bits (953),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CBI34244.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006362168.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362169.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Solanum 
tuberosum]
Length=548

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/190 (92%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+ D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSTDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TLAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CDP04715.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   365 bits (938),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARK+VKLKAFSKF+NTSEALSAA
Sbjct  1    MLALFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKIVKLKAFSKFDNTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GL  QDL+PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDD+DKELNTYAMR
Sbjct  121  LSELISGLAAQDLSPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDIDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002273273.2| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
 ref|XP_010659961.1| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
Length=573

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFS++++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSSESARQVVKLKAFSKFENTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR HCDG+TLAVADSKLGNAIKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRVHCDGETLAVADSKLGNAIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>tpg|DAA45361.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=450

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010243588.1| PREDICTED: probable nucleolar protein 5-1 [Nelumbo nucifera]
Length=577

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARK+VKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKMVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+TVMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNTVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010904781.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=588

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT++ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTTDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009382561.1| PREDICTED: probable nucleolar protein 5-2 [Musa acuminata subsp. 
malaccensis]
Length=585

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFK+LDEGKL KVEDLWKEF+T+++ARK+VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKILDEGKLDKVEDLWKEFATSESARKIVKLKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRTHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_004239682.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
 ref|XP_010321330.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=513

 Score =   366 bits (940),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL +ADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGIADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008799299.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
 ref|XP_008799300.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
Length=497

 Score =   365 bits (937),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 186/190 (98%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEF+T+++AR+VVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFATSESARQVVKLKAFSKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+H++ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHSNAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006345813.1| PREDICTED: probable nucleolar protein 5-2-like [Solanum tuberosum]
Length=541

 Score =   366 bits (940),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+T+D+ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTTSDSARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HCDG+TL VADSKLGNAIKEKLQI+CVHN+ VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIECVHNNVVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010241493.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDLWKEFST+++ARKVVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010097360.1| hypothetical protein L484_010238 [Morus notabilis]
 gb|EXB67670.1| hypothetical protein L484_010238 [Morus notabilis]
Length=514

 Score =   364 bits (935),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDLW+EFSTAD+AR+VVKLKAFSKFENTSEAL A 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLWREFSTADSARQVVKLKAFSKFENTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGN IKEKLQ++CVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNIIKEKLQVECVHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008655653.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008655660.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 tpg|DAA45362.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=564

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008671899.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=425

 Score =   361 bits (926),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TMIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008660157.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008660158.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 gb|AFW88396.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88397.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88398.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=562

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008649917.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleolar protein 5-2 
[Zea mays]
Length=329

 Score =   357 bits (917),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDT+I+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTIIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYG HFP
Sbjct  181  VREWYGXHFP  190



>ref|XP_009411704.1| PREDICTED: probable nucleolar protein 5-1 [Musa acuminata subsp. 
malaccensis]
Length=588

 Score =   365 bits (937),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG ALFKVLDEGKL KVEDLWKEF+T+++AR++VKLKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGLALFKVLDEGKLDKVEDLWKEFATSESARQIVKLKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCDG+TLAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDGETLAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002456868.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
 gb|EES01988.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
Length=568

 Score =   364 bits (935),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGN+IKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNSIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010938712.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=600

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEFST+++ARKVVKLKAFSKFENTSEALS A
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+IDC+HN+ VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGEALAVADSKLGNAIKEKLKIDCLHNNAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_003557835.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLD+GKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDQGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCVHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|NP_001050112.1| Os03g0350100 [Oryza sativa Japonica Group]
 dbj|BAF12026.1| Os03g0350100, partial [Oryza sativa Japonica Group]
Length=556

 Score =   363 bits (932),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008666415.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=420

 Score =   358 bits (919),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/191 (88%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            EMLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  21   EMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  80

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL+IDC+HNS VMELMRGLRN
Sbjct  81   ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRN  140

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  141  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  200

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  201  RVREWYGWHFP  211



>ref|XP_004984388.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=567

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006650080.1| PREDICTED: probable nucleolar protein 5-2-like [Oryza brachyantha]
Length=565

 Score =   363 bits (931),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008796212.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Phoenix 
dactylifera]
Length=564

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|ABF95925.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95926.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95927.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89998.1| hypothetical protein OsI_11565 [Oryza sativa Indica Group]
 dbj|BAG94281.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008796213.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Phoenix 
dactylifera]
Length=583

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL +VEDLWKEFST+++ARKVVKLKAFSKFENTSEALS  
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDRVEDLWKEFSTSESARKVVKLKAFSKFENTSEALSTV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID KPSKGLRKFLR+HC+G+TLAVADSKLGNAIKEKL+IDC+H+S VMELMRGLR+Q
Sbjct  61   TLLIDGKPSKGLRKFLRAHCEGETLAVADSKLGNAIKEKLKIDCLHSSAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|NP_001050113.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|ABF95928.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12027.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|EAZ26910.1| hypothetical protein OsJ_10837 [Oryza sativa Japonica Group]
 dbj|BAG93321.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_011099778.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099779.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099780.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=585

 Score =   363 bits (931),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF+T D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFATPDSARQVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>dbj|BAN15014.1| SAR DNA binding protein [Bromus inermis]
Length=539

 Score =   361 bits (927),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDCVHNS VMELMRGL+NQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCVHNSVVMELMRGLKNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGTQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010687356.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_004984387.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=568

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+AR+VV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARRVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+ID KPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  61   TLIIDGKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG Q+L PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLGAQELGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>dbj|BAA31260.1| SAR DNA binding protein [Oryza sativa]
Length=485

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR LRNQ
Sbjct  61   TLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRRLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_011099781.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=583

 Score =   362 bits (929),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEF++ D+AR+VVKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFASPDSARQVVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHC+GD LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCEGDILAVADSKLGNTIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CAK22424.1| matrix attachment region binding protein [Beta vulgaris]
Length=572

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 185/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS++EDLWKEF++ D+ARKVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSQIEDLWKEFTSVDSARKVVKLKAFDKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAVADSKLGNAIKEKLQI+CVHN++VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCKGETLAVADSKLGNAIKEKLQIECVHNNSVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGAQDLAPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|EEC75255.1| hypothetical protein OsI_11566 [Oryza sativa Indica Group]
Length=657

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 186/195 (95%), Gaps = 0/195 (0%)
 Frame = +1

Query  94   R*AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSE  273
            R   EMLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+
Sbjct  85   RAVREMLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSD  144

Query  274  ALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            ALSAATL+IDSKP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMR
Sbjct  145  ALSAATLIIDSKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMR  204

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            GLRNQLTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELN
Sbjct  205  GLRNQLTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELN  264

Query  634  TYAMRVREWYGWHFP  678
            TYAMRVREWYGWHFP
Sbjct  265  TYAMRVREWYGWHFP  279



>ref|XP_007208461.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
 gb|EMJ09660.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
Length=539

 Score =   360 bits (923),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010025094.1| PREDICTED: probable nucleolar protein 5-2 [Eucalyptus grandis]
 gb|KCW61686.1| hypothetical protein EUGRSUZ_H04416 [Eucalyptus grandis]
Length=579

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 184/190 (97%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGK+SKVEDLW+EFS+A++A+KVVKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKVSKVEDLWQEFSSAESAKKVVKLKAFSKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T LI+SKP KGLRKFLR+HCDG++LAVADSKLGNAIKEKLQIDCVHN+ VMELMRG+R+Q
Sbjct  61   TCLIESKPYKGLRKFLRAHCDGESLAVADSKLGNAIKEKLQIDCVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008218165.1| PREDICTED: probable nucleolar protein 5-2 [Prunus mume]
Length=538

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+VEDLWKEFS+A++AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSQVEDLWKEFSSAESARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HC G+TLAVADSKLGN IKEKL+IDCVHN++VMELMRG+RNQ
Sbjct  61   TLLIDSKPSKGLRKFLRAHCSGETLAVADSKLGNVIKEKLKIDCVHNNSVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSRYKLKFS +KVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRYKLKFSAEKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010241470.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241474.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241483.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   361 bits (926),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 185/194 (95%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVE----DLWKEFSTADTARKVVKLKAFSKFENTSEA  276
            ML+LFETPAGFALFKVLDEGKLSKVE    DLWKEFST+++ARKVVKLKAFSKFENTSEA
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVESGLQDLWKEFSTSESARKVVKLKAFSKFENTSEA  60

Query  277  LSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            LSAATLLIDSKPSK LRKFLR+HCDG+TLAVADSK GNAIKEKL+I+CVHN+ VMELMRG
Sbjct  61   LSAATLLIDSKPSKALRKFLRAHCDGETLAVADSKFGNAIKEKLKIECVHNNAVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+QLTELI+GL VQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT
Sbjct  121  VRSQLTELISGLAVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNT  180

Query  637  YAMRVREWYGWHFP  678
            YAMRVREWYGWHFP
Sbjct  181  YAMRVREWYGWHFP  194



>ref|XP_002533223.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF29163.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF+ AD+ARKVVKLKAFSKFENTS+AL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFANADSARKVVKLKAFSKFENTSKALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DS PSKGLRKFL+SHCDG+TLAVADSKLGNAIK+KL+IDCVHN+ VMELMRGLR+Q
Sbjct  61   TKLLDSAPSKGLRKFLKSHCDGETLAVADSKLGNAIKDKLKIDCVHNNAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LT+LI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTDLISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|EMS65034.1| hypothetical protein TRIUR3_04158 [Triticum urartu]
Length=560

 Score =   357 bits (916),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS VEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSSVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKLQIDC+HNS VMELMRGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLQIDCLHNSAVMELMRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|EYU23804.1| hypothetical protein MIMGU_mgv1a003941mg [Erythranthe guttata]
Length=553

 Score =   357 bits (915),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDE KLSK EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  1    MLLLFETPAGFALFKVLDEAKLSKAEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  61   TLLIDSKPSKGLRKFLRSHCDDDILAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KDP23603.1| hypothetical protein JCGZ_23436 [Jatropha curcas]
Length=577

 Score =   357 bits (916),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+   SKGLRKFLR+HC+G+ LAVADSKLGNAIKEKL+I+CVHN+ +MELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCEGEILAVADSKLGNAIKEKLKIECVHNNAIMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNT+AMR
Sbjct  121  LTELITGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTFAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|EYU23803.1| hypothetical protein MIMGU_mgv1a003693mg [Erythranthe guttata]
Length=569

 Score =   357 bits (916),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 168/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDE K+SK+EDL KEFS+ D+AR++VKLKAFSKFENTSEALSAA
Sbjct  27   MLLLFETPAGFALFKVLDERKVSKIEDLGKEFSSPDSARQIVKLKAFSKFENTSEALSAA  86

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLRSHCD D LAVADSKLGN IKEKLQI+CVHN+ VMELMRG+R+Q
Sbjct  87   TLLIDSKPSKGLRKFLRSHCDDDVLAVADSKLGNIIKEKLQIECVHNNAVMELMRGVRSQ  146

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELNTYAMR
Sbjct  147  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNTYAMR  206

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  207  VREWYGWHFP  216



>ref|XP_003537858.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
 gb|KHN39811.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=551

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008388628.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=552

 Score =   354 bits (908),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002512277.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF49729.1| nucleolar protein nop56, putative [Ricinus communis]
Length=575

 Score =   355 bits (910),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEFSTAD+ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFSTADSARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+   SKGLRKFLR+HCDG+ L VADSKLGNAIKEKL+I+CVH++ VMELMRG+R+Q
Sbjct  61   TKIIEGTASKGLRKFLRAHCDGEILGVADSKLGNAIKEKLKIECVHSNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009342020.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=552

 Score =   354 bits (908),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009364569.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=550

 Score =   353 bits (907),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSNADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNAVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KHN25404.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=553

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KDP35364.1| hypothetical protein JCGZ_10348 [Jatropha curcas]
Length=565

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL KEF++ADTARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLSKEFTSADTARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DS  SKGLRKFL+SHCDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRGLR Q
Sbjct  61   TKLLDSTTSKGLRKFLKSHCDGEILAVADSKLGNAIKDKLKIECVHNNAVMELMRGLRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLHAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_003540996.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
Length=556

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDC+HN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCIHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008370662.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=553

 Score =   353 bits (906),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+FS+AD AR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFSSADKARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL++HC G+TLAV+DSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKPSKGLRKFLKAHCSGETLAVSDSKLGNIIKEKLKIDCVHNNXVMELMRGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQDLAPMSLGLSHSLSR+KLKFS DKVDTM++QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLQVQDLAPMSLGLSHSLSRFKLKFSADKVDTMVIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_007131795.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
 gb|ESW03789.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
Length=556

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLW  FS+ADTAR+VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWTNFSSADTARQVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR HC+ +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  61   TLLIDGKASKGLRKFLRVHCENETLGVADSKLGNVIKEKLKIDCVHNNAVMELMRGVRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_003562489.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   351 bits (901),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDLWK+F+++D ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLWKDFASSDKARKVVELKAFNKFENTSDALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFL+ HCDG+TLAVADSKLGNAIKEKL+IDC H+S VMELMRGLR+Q
Sbjct  61   TLLIDSKPSKGLRKFLQKHCDGETLAVADSKLGNAIKEKLKIDCRHDSAVMELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTEL++GL   DL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELMSGLAEHDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KJB26511.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=450

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>gb|KJB82563.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=416

 Score =   344 bits (883),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KJB45049.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=414

 Score =   344 bits (882),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>ref|XP_004139213.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156444.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN60839.1| hypothetical protein Csa_2G012710 [Cucumis sativus]
Length=544

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008455669.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis melo]
 gb|ADN33903.1| MAR-binding protein [Cucumis melo subsp. melo]
Length=554

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL A 
Sbjct  1    MLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEALEAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGLRNQ
Sbjct  61   TLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGLRNQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_007030688.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
 gb|EOY11190.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
Length=443

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>gb|EPS70798.1| hypothetical protein M569_03961, partial [Genlisea aurea]
Length=392

 Score =   342 bits (876),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFST +++R+VVKLKAFSKFENT+EAL+AA
Sbjct  4    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSTPESSRQVVKLKAFSKFENTAEALTAA  63

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLI+SKPSKGLRKFLRSHC+G+ L VADSKLG++IKEKLQI+CVHN+ V ELMRG+R+Q
Sbjct  64   TLLIESKPSKGLRKFLRSHCEGEILGVADSKLGSSIKEKLQIECVHNNVVSELMRGIRSQ  123

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL +QDLAPMSLGLSHSLSRYKLKF+PDK+DTMI+Q I+LLDDLDKELN Y MR
Sbjct  124  LTELISGLALQDLAPMSLGLSHSLSRYKLKFTPDKIDTMIIQGIALLDDLDKELNIYVMR  183

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  184  VREWYGWHFP  193



>gb|KJB26509.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=567

 Score =   347 bits (891),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDC+HN++VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCIHNTSVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>ref|XP_004507477.1| PREDICTED: probable nucleolar protein 5-1-like [Cicer arietinum]
Length=553

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFA+FKVLDEGKLSKVEDL  EF+TAD ARKVVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFAIFKVLDEGKLSKVEDLSNEFATADAARKVVKLKAFSKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR+HCD +TL VADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   TLLIDGKASKGLRKFLRAHCDNETLGVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006838803.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
 gb|ERN01372.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
Length=591

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFK+LDEGKL KV+DLWKEF+T D A+K+VKLKAFSKFENT+EALSAA
Sbjct  1    MLVLFETPAGFALFKLLDEGKLDKVDDLWKEFTTVDNAKKIVKLKAFSKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSKPSKGLRKFLR+HCD + LAVADSKLG+ IK+KLQI+C+HN+ V ELMR LR Q
Sbjct  61   TLLIDSKPSKGLRKFLRAHCDNEILAVADSKLGSVIKDKLQIECIHNNAVTELMRCLRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELIVGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            V+EWYGWHFP
Sbjct  181  VKEWYGWHFP  190



>ref|XP_004139212.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156443.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
Length=566

 Score =   347 bits (889),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = +1

Query  100  AEEMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEAL  279
            A  MLVLFET AGFALFKVLDEGKLSKVEDL K+FS A++AR++VKLKAFSKFEN SEAL
Sbjct  20   AVNMLVLFETSAGFALFKVLDEGKLSKVEDLSKDFSNAESARQIVKLKAFSKFENMSEAL  79

Query  280  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
             A TLLIDSKPSKGLRKFLR++CDG+TL VADSKLGN IKEKLQIDCVHN++VMEL+RGL
Sbjct  80   EATTLLIDSKPSKGLRKFLRANCDGETLGVADSKLGNIIKEKLQIDCVHNNSVMELIRGL  139

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQL ELI GL VQDLAPMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTY
Sbjct  140  RNQLNELIAGLAVQDLAPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTY  199

Query  640  AMRVREWYGWHFP  678
            AMRVREWYGWHFP
Sbjct  200  AMRVREWYGWHFP  212



>gb|KJB45047.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
 gb|KJB45048.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=567

 Score =   347 bits (889),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>gb|KJB82560.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82561.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82562.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82564.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82565.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82566.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=564

 Score =   346 bits (888),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KHG01423.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=567

 Score =   346 bits (888),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV L+AFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLQAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>ref|XP_006491841.1| PREDICTED: probable nucleolar protein 5-1-like [Citrus sinensis]
Length=551

 Score =   346 bits (887),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KHG00213.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
 gb|KHG00214.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=562

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF   D+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAPDSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESAPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNNAVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006432265.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
 gb|ESR45505.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
Length=551

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010674932.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLS++EDLWKEF+  D+A+KVVKLKAF KFENT+EALSAA
Sbjct  1    MLVLFETCAGFALFKVLDEGKLSQIEDLWKEFADVDSAKKVVKLKAFDKFENTAEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLL +SKPSKGLRKFL++HC GDTLAVADSKLG+AIKEKLQIDC+HN+ VMELMRG+R+Q
Sbjct  61   TLLSESKPSKGLRKFLKAHCKGDTLAVADSKLGSAIKEKLQIDCLHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTY MR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYGMR  180

Query  649  VREWYGWHFP  678
             +EWYGWHFP
Sbjct  181  GQEWYGWHFP  190



>ref|XP_002319598.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
 gb|EEE95521.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
Length=561

 Score =   344 bits (883),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_008650437.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
Length=451

 Score =   340 bits (873),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 177/190 (93%), Gaps = 5/190 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPA F LFKVLD     KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  1    MLVLFETPARFTLFKVLD-----KVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  55

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  56   TLIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  115

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAMR
Sbjct  116  LTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAMR  175

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  176  VREWYGWHFP  185



>ref|XP_007030686.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
 gb|EOY11188.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
Length=565

 Score =   343 bits (881),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>ref|XP_007030689.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
 gb|EOY11191.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
Length=388

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  118  LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  297
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  298  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  477
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  478  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVRE  657
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+RE
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRIRE  180

Query  658  WYGWHFP  678
            WYGWHFP
Sbjct  181  WYGWHFP  187



>ref|XP_011013586.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011013588.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_011032532.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032533.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032534.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006382714.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 ref|XP_006382715.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60511.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60512.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
Length=562

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLLLFETPGGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGETLGVADSKLGNAIKDKLKIECVHNNGVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KHG01259.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=548

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFE PAGFALFKVLDEGKL+ VEDL KEF  AD+ARKVV LKAFSKFENT+EAL AA
Sbjct  1    MLVLFEIPAGFALFKVLDEGKLNNVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R Q
Sbjct  61   TKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEKLKIDCVHNTYVMELLRGVRTQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            +REWYGWHFP
Sbjct  181  IREWYGWHFP  190



>ref|XP_011003824.1| PREDICTED: probable nucleolar protein 5-2 [Populus euphratica]
Length=563

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFALFKVLDEGKLSKVEDL KEFS+ D+ARKVVKLKAFSKFENTSEAL + 
Sbjct  1    MLLLFETPAGFALFKVLDEGKLSKVEDLGKEFSSPDSARKVVKLKAFSKFENTSEALESV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +I+S  SKGLRKFLR++CDG+ LAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TKIIESSTSKGLRKFLRANCDGEMLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLATQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_003611088.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES94046.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=590

 Score =   340 bits (872),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+V+DLWKEFS+AD ARKVVKLK F KFEN SEA  AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLWKEFSSADAARKVVKLKGFQKFENISEATEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            +LLID K SKGLRKFLR+HCD +TLAVAD+KLG  IKEKL+IDCVH++ VME+MRG+R Q
Sbjct  61   SLLIDGKASKGLRKFLRAHCDNETLAVADTKLGTIIKEKLKIDCVHSNAVMEIMRGIRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELITGL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELITGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|AAC16330.1| SAR DNA-binding protein-1 [Pisum sativum]
Length=560

 Score =   338 bits (867),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVL+EGKLS+V+DL  +FSTAD ARKVVKLKAFSKFENT+EAL AA
Sbjct  1    MLVLFETPAGFALFKVLNEGKLSEVQDLSLDFSTADAARKVVKLKAFSKFENTAEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            + LID K SKGLRKFLR+HCD + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+R Q
Sbjct  61   SCLIDGKTSKGLRKFLRAHCDDEILAVADSKLGNIIKEKLKIDCVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_003606983.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES89180.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=553

 Score =   337 bits (864),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQD+APMSLGLSHSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLSHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010546633.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=563

 Score =   337 bits (864),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL  EF TAD+ARKVVKLKAF+KF+NTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGNEFLTADSARKVVKLKAFNKFDNTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+ LAVADSKLGNAIKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNAIKEKLKIDCVHNTAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_007030687.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11189.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
Length=536

 Score =   336 bits (861),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/187 (85%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = +1

Query  118  LFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLL  297
            LFETPAGFALFKVLDEGKL+KVEDL KEF  AD+ARKVV LKAFSKFENT+EAL AAT L
Sbjct  1    LFETPAGFALFKVLDEGKLNKVEDLSKEFLAADSARKVVSLKAFSKFENTAEALEAATKL  60

Query  298  IDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTE  477
            ++S PSKGLRKFLR+HCDG+T+AVADSKLGNAIKEKL+I+CVHN+ VMELMRG+R+QLTE
Sbjct  61   LESTPSKGLRKFLRAHCDGETVAVADSKLGNAIKEKLKIECVHNNAVMELMRGVRSQLTE  120

Query  478  LITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVRE  657
            LI+GL  QDLAPMSLGLSHSLSR+KLKFS DKVDTMIVQAI LLDDLDKELNTYAMR+RE
Sbjct  121  LISGLAAQDLAPMSLGLSHSLSRFKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMRIRE  180

Query  658  WYGWHFP  678
            WYGWHFP
Sbjct  181  WYGWHFP  187



>ref|XP_010550954.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
 ref|XP_010550955.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=539

 Score =   335 bits (859),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVEDL  +F TAD+ARKVVKLKAF+KFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEDLGTDFLTADSARKVVKLKAFNKFENTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+I+CVHNS VMEL+RG+R+Q
Sbjct  61   AKLMEGAPSKGLRKFLKANCEGEALAVADSKLGNVIKEKLKIECVHNSAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL  QDLAPMSLGLSHSL+RYKLKFSPDKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLADQDLAPMSLGLSHSLARYKLKFSPDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>tpg|DAA47456.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=309

 Score =   327 bits (838),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 171/191 (90%), Gaps = 12/191 (6%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  262  RVREWYGWHFP  272



>gb|ACJ85748.1| unknown [Medicago truncatula]
 gb|AFK40384.1| unknown [Medicago truncatula]
 gb|AFK49114.1| unknown [Medicago truncatula]
Length=553

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVL+EGKLSKVEDL  EF+TAD ARKVVKLKAF+KF NTSEAL AA
Sbjct  1    MLLLFETPAGFAIFKVLNEGKLSKVEDLQNEFTTADAARKVVKLKAFNKFANTSEALEAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLIDSK SKGLRKFLR HC+ +TL VADSKLGN IKEKL+I+CVHN+ VMELMRG+R Q
Sbjct  61   TLLIDSKASKGLRKFLRVHCENETLGVADSKLGNIIKEKLKIECVHNNAVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL VQD+APMSLGL HSLSRY+LKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LNELIAGLAVQDMAPMSLGLPHSLSRYRLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006468094.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Citrus 
sinensis]
Length=549

 Score =   335 bits (858),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006468095.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Citrus 
sinensis]
Length=573

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006468097.1| PREDICTED: probable nucleolar protein 5-2-like isoform X4 [Citrus 
sinensis]
Length=588

 Score =   335 bits (860),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006468096.1| PREDICTED: probable nucleolar protein 5-2-like isoform X3 [Citrus 
sinensis]
Length=565

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF++ D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNSPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006436388.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
 gb|ESR49628.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
Length=552

 Score =   333 bits (855),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKLSK E L +EF+  D+AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETAAGFALFKVLDEGKLSKFEGLGQEFNRPDSARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKP+K LRKFLR+HCDG+TL VADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPTKDLRKFLRAHCDGETLGVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GL VQD+ PMSLGLSHSLSRYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLAVQDIQPMSLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>tpg|DAA47457.1| TPA: hypothetical protein ZEAMMB73_782083 [Zea mays]
Length=469

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 171/191 (90%), Gaps = 12/191 (6%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +MLVLFETPAGF LFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSA
Sbjct  94   KMLVLFETPAGFTLFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSA  153

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            ATL+IDSKPSKGLRKFL+ HC+G+TL VADSKLGNAIKEKL            LMRGLRN
Sbjct  154  ATLIIDSKPSKGLRKFLQKHCEGETLVVADSKLGNAIKEKL------------LMRGLRN  201

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLTELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+Q I LLDDLDKELNTYAM
Sbjct  202  QLTELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQDIGLLDDLDKELNTYAM  261

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  262  RVREWYGWHFP  272



>ref|XP_006408115.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
 gb|ESQ49568.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
Length=541

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVLDEG+LS VEDL KEF++ D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGRLSNVEDLGKEFASPDSARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CDX80674.1| BnaC07g27700D [Brassica napus]
Length=536

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADSARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|AAC16331.1| SAR DNA-binding protein-2 [Pisum sativum]
Length=550

 Score =   326 bits (836),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFET AGFALFKVLDEGKLSKVEDL + FS+ADTARKVVKLKAFSKFENTSEAL +A
Sbjct  1    MLLLFETAAGFALFKVLDEGKLSKVEDLQQSFSSADTARKVVKLKAFSKFENTSEALKSA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
             LLID K SK LRKFL  HC  +TL VAD+KL + IKEKLQIDCVHN  VMELMRG+R Q
Sbjct  61   NLLIDGKASKDLRKFLSVHCQNETLGVADTKLASIIKEKLQIDCVHNVGVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI GL VQD+APMSLGLSHSLSRYKLKFS DKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LTELIAGLAVQDMAPMSLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009151230.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
 emb|CDX86179.1| BnaA06g28960D [Brassica napus]
Length=537

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVLDEGKLS VEDL   FS+AD ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLDEGKLSNVEDLGNVFSSADAARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009111930.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
Length=536

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CDY00004.1| BnaC09g02970D [Brassica napus]
Length=536

 Score =   325 bits (833),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CDY19706.1| BnaA09g03590D [Brassica napus]
Length=535

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAGFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPAGFAVFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|AFW84118.1| hypothetical protein ZEAMMB73_870642 [Zea mays]
Length=586

 Score =   326 bits (835),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/195 (84%), Positives = 180/195 (92%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVL ETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF+KFENTS+ALSAA
Sbjct  8    LLVLLETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAFNKFENTSDALSAA  67

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TL+IDSKPSKGL KFL+ HC G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  68   TLIIDSKPSKGLHKFLQKHCQGETLAVADSKLGNAIKEKLKIDCLHNSVVMELMRGLRNQ  127

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK-----VDTMIVQAISLLDDLDKELN  633
            LTELITG G QDL PMSLGLSHSLSRYKLKFSP+K     VDTMI+QAI LLDDLDK+LN
Sbjct  128  LTELITGFGAQDLGPMSLGLSHSLSRYKLKFSPEKACLISVDTMIIQAIGLLDDLDKDLN  187

Query  634  TYAMRVREWYGWHFP  678
            T+AMRVREWYGWHFP
Sbjct  188  TFAMRVREWYGWHFP  202



>ref|XP_010455156.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=529

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010421656.1| PREDICTED: probable nucleolar protein 5-1 isoform X2 [Camelina 
sativa]
Length=529

 Score =   324 bits (830),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVL EGKLS  EDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNAEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+D  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010494044.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=531

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETP GFALFKVL EGKLS VEDL  EF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLVLFETPGGFALFKVLKEGKLSNVEDLGNEFMTAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTEL++GLG  DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELLSGLGDNDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|KFK37913.1| hypothetical protein AALP_AA3G046300 [Arabis alpina]
Length=529

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGTPSKGLRKFLKANCQGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSADKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_006394992.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
 gb|ESQ32278.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
Length=536

 Score =   321 bits (822),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLS VEDL   FS+A +ARK+VKL+AF KF+NTSEAL A 
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSNVEDLGNLFSSAASARKMVKLQAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C+G+ LAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGAPSKGLRKFLKANCEGEALAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>emb|CDY52494.1| BnaAnng11410D [Brassica napus]
Length=531

 Score =   318 bits (816),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVLDEGKLS VEDL   FS+A++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLLLFETPGGFAIFKVLDEGKLSNVEDLGNVFSSAESARKMVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C  +TLAVADSKLGN IKEKL IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLVEGTPSKGLRKFLKANCKDETLAVADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGEQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002884489.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60748.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  182  VREWYGWHFP  191



>ref|NP_187157.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|Q9MAB3.1|NOP5B_ARATH RecName: Full=Probable nucleolar protein 5-2; AltName: Full=MAR-binding 
NOP56/58 homolog 2; AltName: Full=Nucleolar protein 
58-2 [Arabidopsis thaliana]
 gb|AAF27012.1|AC009177_2 putative SAR DNA-binding protein-1 [Arabidopsis thaliana]
 gb|AAG40837.1|AF302491_1 NOP58-like protein [Arabidopsis thaliana]
 gb|AAL06533.1|AF412080_1 AT3g05060/T12H1_2 [Arabidopsis thaliana]
 gb|AEE74181.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   318 bits (814),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVL+ET AGFALFKV DEGK++ VEDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  2    VLVLYETAAGFALFKVKDEGKMANVEDLCKEFDTPDSARKMVKLKAFEKFDNTSEALEAV  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDC+HN+ VMEL+RG+R+Q
Sbjct  62   AKLLEGAPSKGLRKFLKANCQGETLAVADSKLGNVIKEKLKIDCIHNNAVMELLRGVRSQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  122  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  181

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  182  VREWYGWHFP  191



>emb|CAE45597.1| SAR DNA-binding protein-like protein [Lotus japonicus]
Length=537

 Score =   317 bits (811),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 165/190 (87%), Gaps = 14/190 (7%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE              VVKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVE--------------VVKLKAFSKFENTSEALEAA  46

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            TLLID K SKGLRKFLR+HC+ + LAVADSKLGN IKEKL+IDCVHN+ VMELMRG+RNQ
Sbjct  47   TLLIDGKASKGLRKFLRAHCEDEMLAVADSKLGNMIKEKLKIDCVHNNAVMELMRGVRNQ  106

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI+GL VQD+APMSLGLSHSLSRYKLKFS +KVDTM+VQAI LLDDLDKELNTYAMR
Sbjct  107  LNELISGLAVQDMAPMSLGLSHSLSRYKLKFSAEKVDTMVVQAIGLLDDLDKELNTYAMR  166

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  167  VREWYGWHFP  176



>ref|XP_010422824.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=554

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M++L ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIILVETPAGFALFKVKDEGKLANIEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010485906.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
 ref|XP_010485908.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=535

 Score =   316 bits (810),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M+VL ETPAGFALFKV DEGKL+ +EDL KEF T D+ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MIVLVETPAGFALFKVKDEGKLANLEDLAKEFETPDSARKIVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TEL++GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|AAN72071.1| SAR DNA-binding protein - like [Arabidopsis thaliana]
Length=423

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREW+GWHFP
Sbjct  181  VREWFGWHFP  190



>ref|XP_001756465.1| predicted protein [Physcomitrella patens]
 gb|EDQ78861.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADAARKMVKLKAFDKFENTTDALNAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            + L+DSK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVDSKLPKGLRKFLKKQCQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|AAB61073.1| similar to S. cerevisiae SIK1P (PID:g984964) [Arabidopsis thaliana]
Length=439

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREW+GWHFP
Sbjct  181  VREWFGWHFP  190



>ref|NP_198064.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|O04658.2|NOP5A_ARATH RecName: Full=Probable nucleolar protein 5-1; AltName: Full=MAR-binding 
NOP56/58 homolog 1; AltName: Full=NOP58-like protein 
F108; AltName: Full=Nucleolar protein 58-1 [Arabidopsis 
thaliana]
 gb|AAG40836.1|AF302490_1 NOP58-like protein F108 [Arabidopsis thaliana]
 gb|AAL66978.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20318.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AED93652.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   312 bits (800),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETP GFA+FKVL+EGKLS VEDL  EFSTA  ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MLILFETPGGFAIFKVLNEGKLSNVEDLGNEFSTAKLARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+I CVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIVCVHNNAVMELLRGIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LTELISGLGDQDLGPMSLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREW+GWHFP
Sbjct  181  VREWFGWHFP  190



>ref|XP_001753892.1| predicted protein [Physcomitrella patens]
 gb|EDQ81214.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   313 bits (803),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFETPAGFALFKVL+EGKL   E+L+KEF TAD ARK+VKLKAF KFENT++AL+AA
Sbjct  1    MLALFETPAGFALFKVLNEGKLDASEELYKEFETADLARKMVKLKAFEKFENTTDALNAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            + L++SK  KGLRKFL+  C G+TLA+ADSKLG AI +KL+I+CV+N+ V ELMRGLR+Q
Sbjct  61   SHLVESKLPKGLRKFLKKECQGETLAIADSKLGKAISDKLEINCVNNAAVAELMRGLRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GL   D+APMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLAGHDMAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_010464014.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=553

 Score =   313 bits (801),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+L ETPAGFA+FK+ DEGKL+ +EDL KEF TA++ARK+VKLKAF KF+NTSEAL A 
Sbjct  1    MLILVETPAGFAVFKLKDEGKLANIEDLAKEFETAESARKIVKLKAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L +  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   VKLHEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
             TEL++GLG  D+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  FTELLSGLGDHDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002874406.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50665.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   312 bits (799),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M +LFETP GFA+FKVLDEGKLS VED+  EF TA +ARK+VKL AF KF+NT+EAL A 
Sbjct  1    MHILFETPGGFAIFKVLDEGKLSNVEDIGNEFLTAKSARKMVKLVAFDKFDNTAEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L++  PSKGLRKFL+++C G+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLEGTPSKGLRKFLKANCVGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ELI+GLG +DLAPMSLGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAMR
Sbjct  121  LSELISGLGDKDLAPMSLGLSHSLARYKLKFSTDKVDTMIIQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_011457678.1| PREDICTED: probable nucleolar protein 5-2 [Fragaria vesca subsp. 
vesca]
Length=548

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 170/193 (88%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVL-DEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEAL  279
            ML+LFE P GF LFKVL D+GK +K E  D+ KEF T ++ARKVVKLKAFSKFEN SEAL
Sbjct  1    MLLLFENPGGFMLFKVLKDDGKFTKAEAHDIAKEFETGESARKVVKLKAFSKFENMSEAL  60

Query  280  SAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
             AAT+LIDSKP+K LRKFL+ HC+G+ L VADSKLGN IKEKL+I+CVH++ VMELMRG+
Sbjct  61   EAATMLIDSKPTKDLRKFLKKHCEGEILGVADSKLGNIIKEKLKIECVHDNAVMELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+QL +++TGL +QD+APMSLGLSHSLSRYKLKFS DKVDTM++QAI LLDDLDKELNTY
Sbjct  121  RSQLNDVVTGLQLQDMAPMSLGLSHSLSRYKLKFSADKVDTMVIQAIGLLDDLDKELNTY  180

Query  640  AMRVREWYGWHFP  678
            AMRVREWYGWHFP
Sbjct  181  AMRVREWYGWHFP  193



>gb|KFK23538.1| hypothetical protein AALP_AAs63573U000200 [Arabis alpina]
Length=483

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 169/206 (82%), Gaps = 16/206 (8%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            M+VLFETPAGFALFKV DEGKLS VE L KEFST D ARK+VKL AF KF+NTSEAL A 
Sbjct  1    MIVLFETPAGFALFKVKDEGKLSDVESLGKEFSTPDLARKMVKLIAFDKFDNTSEALEAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+D  PSKGLRKFL+++C G+TLAVADSKLGN IK+KL+IDCVHN+ VMEL+RG+R+Q
Sbjct  61   AKLLDGSPSKGLRKFLKANCQGETLAVADSKLGNVIKDKLKIDCVHNNAVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK----------------VDTMIVQAI  600
             TELI+GLG QDLAPMSLGLSHSL+RYKLKFS DK                VDTMI+QAI
Sbjct  121  FTELISGLGDQDLAPMSLGLSHSLARYKLKFSVDKGYLTSVPTSYVGLFYLVDTMIIQAI  180

Query  601  SLLDDLDKELNTYAMRVREWYGWHFP  678
             LLDDLDKELNTYAMRVREWYGWH+P
Sbjct  181  GLLDDLDKELNTYAMRVREWYGWHYP  206



>ref|XP_006297275.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
 gb|EOA30173.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
Length=593

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +M++L ETPAGF LFKV D GKLS VEDL KEF T D+ARK+VKL AF KF+NTSEAL A
Sbjct  35   KMILLVETPAGFGLFKVKDVGKLSNVEDLGKEFDTPDSARKMVKLLAFDKFDNTSEALEA  94

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
               L++  PSKGLRKFL+++C+G+TLAVADSKLGN IKEKL+I+CVHN+ VMEL+RG+R+
Sbjct  95   VAKLLEGTPSKGLRKFLKANCEGETLAVADSKLGNVIKEKLKIECVHNNAVMELLRGVRS  154

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q TELI+GLG QD+APM LGLSHSL+RYKLKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  155  QFTELISGLGDQDMAPMRLGLSHSLARYKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  214

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  215  RVREWYGWHFP  225



>ref|XP_006287421.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
 gb|EOA20319.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
Length=551

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 166/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  106  EMLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSA  285
            +ML LFETP GFALFKVL EGKLS VEDL  EF TA++ARK+V+LKAF KF+NTS+AL A
Sbjct  20   KMLALFETPGGFALFKVLKEGKLSNVEDLGNEFLTAESARKMVQLKAFDKFDNTSDALEA  79

Query  286  ATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
               L +   SK LRKFL+S+CDG+TLAVADSKLGN IKEKL+IDCVHN+ VMEL+RG+R+
Sbjct  80   VAKLREGTASKSLRKFLKSNCDGETLAVADSKLGNIIKEKLKIDCVHNNAVMELLRGVRS  139

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q TELI+GLG  DLAPMSLGLSHSL+RY LKFS DKVDTMI+QAI LLDDLDKELNTYAM
Sbjct  140  QFTELISGLGDNDLAPMSLGLSHSLARYTLKFSSDKVDTMIIQAIGLLDDLDKELNTYAM  199

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  200  RVREWYGWHFP  210



>gb|EEE59058.1| hypothetical protein OsJ_10836 [Oryza sativa Japonica Group]
Length=525

 Score =   307 bits (787),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/189 (77%), Positives = 162/189 (86%), Gaps = 17/189 (9%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKL KVEDLWKEF+T+D+ARKVV+LKAF             
Sbjct  1    MLVLFETPAGFALFKVLDEGKLDKVEDLWKEFTTSDSARKVVELKAF-------------  47

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
                ++KP+KGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQ
Sbjct  48   ----NNKPTKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQ  103

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            LTELI+GLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKE N YAMR
Sbjct  104  LTELISGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKEFNIYAMR  163

Query  649  VREWYGWHF  675
              EWYGW+F
Sbjct  164  FSEWYGWYF  172



>ref|XP_002970093.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
 gb|EFJ29217.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
Length=575

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +++SK SKGL+KFL++ C G TLA+ADSKLG  I EKL+I C+HN+ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQTLAIADSKLGRIITEKLEISCIHNNGVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002985284.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
 gb|EFJ13778.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
Length=576

 Score =   300 bits (769),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 163/190 (86%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL ETPAGFALFK+LDE KL++V+D+WKEF T   AR++VKLK+F KFENT+EAL AA
Sbjct  1    MLVLVETPAGFALFKLLDEAKLNQVDDIWKEFETPAAARQIVKLKSFHKFENTAEALGAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +++SK SKGL+KFL++ C G  LA+ADSKLG  I EKL+I C+H++ VMEL+RG+R+Q
Sbjct  61   TAIVESKLSKGLKKFLKAECQGQILAIADSKLGRIITEKLEISCIHSNGVMELLRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L +L+ GL  QDLA MSLGLSHSL RY LKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LADLVEGLSNQDLASMSLGLSHSLCRYTLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_005850162.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
 gb|EFN58060.1| hypothetical protein CHLNCDRAFT_57124 [Chlorella variabilis]
Length=1332

 Score =   310 bits (793),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 166/192 (86%), Gaps = 2/192 (1%)
 Frame = +1

Query  109   MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  282
             ML+LFE+ AGFALFKVLDEGKL + E  D+W +F T + A+KVVKLKAFSKFENT+EAL 
Sbjct  918   MLLLFESSAGFALFKVLDEGKLREAETKDVWSDFETPEAAKKVVKLKAFSKFENTTEALQ  977

Query  283   AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
             AA  L+DSK SKGL+KFL+ H +GDTLAV D+KLGN IKEKL I+C+++S VMEL RG+R
Sbjct  978   AAASLVDSKISKGLKKFLKKHAEGDTLAVLDAKLGNVIKEKLGINCLYSSGVMELTRGIR  1037

Query  463   NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
             NQLT L+ GL  QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYA
Sbjct  1038  NQLTNLVGGLSAQDLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYA  1097

Query  643   MRVREWYGWHFP  678
             MRVREWYGWHFP
Sbjct  1098  MRVREWYGWHFP  1109



>ref|XP_005650009.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25465.1| Nop-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=554

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFET AGFALFKVL E K+ + EDLW++F T D A+KVVKLKAFSKFE+T +AL+AA
Sbjct  1    MLLLFETAAGFALFKVLQENKIQETEDLWQDFQTLDAAQKVVKLKAFSKFESTIDALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L DSK SK L+KFL+ + DG TL VAD+KLG+ IKEKL I C++++ V EL RG+R+Q
Sbjct  61   TALGDSKLSKDLKKFLKKNADGKTLGVADAKLGSIIKEKLGIPCIYSNGVQELTRGVRSQ  120

Query  469  LTELITGL-GVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            +  LI+GL G QDL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  IEGLISGLAGGQDLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  181  RVREWYGWHFP  191



>gb|KJB26512.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=531

 Score =   281 bits (718),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +1

Query  226  KVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEK  405
            KVV LKAFSKFENT+EAL AAT L++S PSKGLRKFLR+HCDG+TL VADSKLGNAIKEK
Sbjct  4    KVVSLKAFSKFENTAEALEAATKLLESTPSKGLRKFLRAHCDGETLGVADSKLGNAIKEK  63

Query  406  LQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTM  585
            L+IDC+HN++VMEL+RG+R QLTELI+GLG QDLAPMSLGLSHSLSRYKLKFS DKVDTM
Sbjct  64   LKIDCIHNTSVMELLRGVRTQLTELISGLGAQDLAPMSLGLSHSLSRYKLKFSADKVDTM  123

Query  586  IVQAISLLDDLDKELNTYAMRVREWYGWHFP  678
            IVQAI LLDDLDKELNTYAMR+REWYGWHFP
Sbjct  124  IVQAIGLLDDLDKELNTYAMRIREWYGWHFP  154



>gb|KDO50620.1| hypothetical protein CISIN_1g0088522mg, partial [Citrus sinensis]
Length=155

 Score =   268 bits (684),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAGFALFKVLDEGKLSKVE LW+EF++A++AR++VKLKAFSKFENTSEAL AA
Sbjct  1    MLVLFETPAGFALFKVLDEGKLSKVEGLWQEFNSAESARQIVKLKAFSKFENTSEALKAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L++SKPSK LRKFLR+HCDG+TLAVADSKLGNAIK+KL+I+CVHN+ VMELMRG+R+Q
Sbjct  61   TCLLESKPSKDLRKFLRTHCDGETLAVADSKLGNAIKDKLKIECVHNNAVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDK  573
            LTELI+GL  QDL PMSLGLSHSLSRYKLKFS DK
Sbjct  121  LTELISGLAGQDLQPMSLGLSHSLSRYKLKFSADK  155



>gb|KIY95194.1| putative nucleolar protein NOP5-2 [Monoraphidium neglectum]
Length=313

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML LFET AG+ALFKV+ EGKL K EDL+K+F T D A+KVVKLKAFSKF+NT+EAL+AA
Sbjct  1    MLFLFETAAGYALFKVVKEGKLEKSEDLYKDFETLDAAQKVVKLKAFSKFQNTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DSK  KGL+KFL+ +  G+TLAV D+KLG+ IK+KL I CV++  V EL RG+R Q
Sbjct  61   TALVDSKLDKGLKKFLKKNATGETLAVLDAKLGSLIKDKLDIPCVYSGAVQELARGVRAQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L+ LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  121  LSGLISGLAGADLTPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>gb|ACA96503.1| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  182  VREWYGWHFP  191



>gb|AAZ31075.2| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 157/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            +LVLFET  G ALFKVL EGKL + ED+  +F T + A+K+VKLKAFSKF++T+EA+ AA
Sbjct  2    VLVLFETAGGLALFKVLQEGKLKQTEDVSADFGTLEQAQKMVKLKAFSKFQDTTEAMEAA  61

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T L+DSK SK ++KFLR + DG+ LA+ D KLG  ++EKL I CV+++ V+EL RG+RNQ
Sbjct  62   TALVDSKLSKPMKKFLRKNVDGEELAILDKKLGGIVQEKLGIPCVYSNAVLELTRGIRNQ  121

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L  LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAMR
Sbjct  122  LQGLISGLSGVDLKPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR  181

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  182  VREWYGWHFP  191



>emb|CEF96991.1| NOSIC [Ostreococcus tauri]
Length=476

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFKV DE KL  VE L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEKKLGDVEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKSLKKFLTKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_002507734.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
 gb|ACO68992.1| nucleolar RNA binding protein [Micromonas sp. RCC299]
Length=471

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 156/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG+ALFKV DEG L  VE   K FS+++ A+ +V L AFSKF+NTS+AL+A 
Sbjct  1    MLLLFETPAGYALFKVKDEGILENVE---KAFSSSEKAQNIVSLAAFSKFDNTSDALAAT  57

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              ++DSK  K L+KFL+ H  G+TLA+AD+KLG  IK+KL I C+ NS +MELMRG+R Q
Sbjct  58   AAMVDSKIGKDLKKFLKKHAIGETLALADAKLGGLIKDKLGISCISNSGIMELMRGVRRQ  117

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            + ELI GL   D+APM+LGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  118  VNELIGGLTDADVAPMALGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  177

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  178  VREWYGWHFP  187



>emb|CDY50583.1| BnaC02g39570D [Brassica napus]
Length=525

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 146/164 (89%), Gaps = 0/164 (0%)
 Frame = +1

Query  187  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  366
            DL   FS+ ++ARK+VKLKAF KF+NTS+AL A   L++  PSKGLRKFL+++C G+TLA
Sbjct  17   DLGNVFSSPESARKMVKLKAFDKFDNTSDALEAVAKLVEGTPSKGLRKFLKANCKGETLA  76

Query  367  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  546
            VADSKLGN IKEKL IDCVHN+ VMEL+RG+R+QL+ELITGLG QDLAPMSLGLSHSL+R
Sbjct  77   VADSKLGNIIKEKLTIDCVHNNAVMELLRGVRSQLSELITGLGEQDLAPMSLGLSHSLAR  136

Query  547  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVREWYGWHFP  678
            YKLKFS DKVDTMI+QAI LLDDLDKELNTYAMRVREWYGWHFP
Sbjct  137  YKLKFSSDKVDTMIIQAIGLLDDLDKELNTYAMRVREWYGWHFP  180



>gb|AAY34142.1| Nop58p [Physarum polycephalum]
Length=474

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 160/194 (82%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AGFALFKVLDEGKL + +D+WKEF T   A K+V LK+FSKF+NT++AL++A
Sbjct  1    MLVLFETAAGFALFKVLDEGKLKQTDDIWKEFETPSKAGKMVSLKSFSKFDNTADALASA  60

Query  289  TLLIDSKPSKGLRKFL-RSHCDG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++SK SK L+KFL ++  D    +TLAVAD  LG+AIK+KL I CV+++ V EL+RG
Sbjct  61   TALVESKVSKDLKKFLTKNIVDAGAKETLAVADKLLGSAIKDKLNIKCVYDTAVQELIRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R QL+ L+ G+   D+  M+LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDD+DKELN 
Sbjct  121  IRQQLSNLVAGMTESDVTTMALGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDMDKELNI  180

Query  637  YAMRVREWYGWHFP  678
            YAMRVREWYGWHFP
Sbjct  181  YAMRVREWYGWHFP  194



>ref|XP_001416562.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=474

 Score =   269 bits (687),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFKV  E KL   E L   FST + A+K+V +KAFSKFENT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKVKAEKKLQDAEKLQDAFSTVEGAKKMVSMKAFSKFENTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+DSK  K L+KFL  H +G+TLAVADSKLG AIKEKL I+CV +S VMELMRG+R Q
Sbjct  61   ATLVDSKVGKNLKKFLSKHAEGETLAVADSKLGAAIKEKLGINCVADSGVMELMRGVRYQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL   DLAPM+LGLSHSLSRYKLKFSPDKVDTM++QAI LLD+LDKELNTY+MR
Sbjct  121  LNELIGGLTDADLAPMALGLSHSLSRYKLKFSPDKVDTMVIQAIGLLDELDKELNTYSMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_007512606.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17206.1| predicted protein [Bathycoccus prasinos]
Length=482

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 162/190 (85%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFKV DE KL  ++ L K FS+A++A+KVV +KAF KFENT++AL+AA
Sbjct  1    MLLLFETPAGYSLFKVKDEDKLKDIDALAKSFSSAESAKKVVSMKAFGKFENTTDALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              +++SK  K L+ FL+ H   +TLA+ADSKLG AIKEKL I+CV+++ VMELMRG+R+Q
Sbjct  61   ATMVESKVGKSLKTFLKKHVKDETLAIADSKLGVAIKEKLGIECVYSNNVMELMRGVRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L ELI GL   D+APM+LGLSHSLSRYKLKFSP+KVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNELIGGLTDADIAPMALGLSHSLSRYKLKFSPEKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_009496003.1| hypothetical protein H696_03867 [Fonticula alba]
 gb|KCV69438.1| hypothetical protein H696_03867 [Fonticula alba]
Length=447

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+ALF V +E KL+  + +WKEF TAD A K+VKL+AF KF+NT+EALSAA
Sbjct  1    MLVLFETSAGYALFSVKNESKLADTDSIWKEFETADKANKLVKLQAFGKFQNTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L+D+K  K L+ FL+S        D LAVAD+KLG  IKEKL I C HN  + ELMRG
Sbjct  61   TALLDNKVPKELKNFLKSEVLKKNLTDELAVADAKLGGVIKEKLGIACKHNDAINELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+Q + L++GL  ++L  M LGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT
Sbjct  121  IRSQFSSLMSGLPEEELVAMQLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  180

Query  637  YAMRVREWYGWHFP  678
            YAMR++EWYGWHFP
Sbjct  181  YAMRIKEWYGWHFP  194



>emb|CAJ82550.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=482

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K LR     +    LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_006681446.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77866.1| hypothetical protein BATDEDRAFT_33621 [Batrachochytrium dendrobatidis 
JAM81]
Length=518

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFK+LD+GK+S  +D+++ F T+  A K VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLFETPAGYALFKLLDDGKMSAPDDIYQSFETSQAANKTVKLKAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++ K SK L+ FL     G    DTLAV DSKLG AI +KL I  V ++ V EL RG
Sbjct  61   TALVEGKISKNLKSFLSKEIAGKDLSDTLAVGDSKLGAAIAKKLNIKVVSDNAVNELFRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+QL+ LITGL   D+  M LGLSHSLSRYKLKFSPDKVDTMI+QAI+LLDDLDKELNT
Sbjct  121  IRSQLSSLITGLAESDMNAMVLGLSHSLSRYKLKFSPDKVDTMIIQAIALLDDLDKELNT  180

Query  637  YAMRVREWYGWHFP  678
            YAMR +EWYGWHFP
Sbjct  181  YAMRAKEWYGWHFP  194



>ref|NP_989298.1| NOP58 ribonucleoprotein [Xenopus (Silurana) tropicalis]
 gb|AAH64169.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=533

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A +VVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANRVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K LR     +    LA+AD+KLG  IK+K  I CVH+S V ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKANISCVHSSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQIDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>gb|AAH77204.1| MGC78950 protein [Xenopus laevis]
Length=533

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|NP_001086628.1| NOP58 ribonucleoprotein [Xenopus laevis]
 gb|AAI22513.1| MGC78950 protein [Xenopus laevis]
Length=534

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CVH S V ELMRG+
Sbjct  61   TALVEGKIGKNLKKVLRKIAAKEAHEQLAIADAKLGGVIKDKVNISCVHTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQVDGLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>gb|AAI30064.1| LOC398558 protein [Xenopus laevis]
 gb|AAI60690.1| LOC398558 protein [Xenopus laevis]
Length=488

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>gb|AAH44082.1| LOC398558 protein, partial [Xenopus laevis]
Length=489

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>gb|AAI06292.1| LOC398558 protein, partial [Xenopus laevis]
Length=526

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ +WKEF T + A KVVKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDESKLQEVDSIWKEFETPEKANKVVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K LR     +    LA+AD+KLG  IK+K+ I CV+ S V ELMRG+
Sbjct  61   TALVEGKLGKNLKKALRKIAAKEAHEQLAIADAKLGGVIKDKVNIGCVYTSMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITG+  +++A MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMDSLITGISSREMAAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_005995463.1| PREDICTED: nucleolar protein 58 isoform X2 [Latimeria chalumnae]
Length=530

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SKGL+K L+     +    LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_005995462.1| PREDICTED: nucleolar protein 58 isoform X1 [Latimeria chalumnae]
Length=531

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF +T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFLDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SKGL+K L+     +    LA+AD+KLG  IKEKL + CVH+  V ELMRG+
Sbjct  61   TALVEGKLSKGLKKVLKKIAAKEAHEQLAIADAKLGGVIKEKLNLSCVHSPAVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LITGL  ++++ MSLGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RTQIEGLITGLPSREMSAMSLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_002166198.2| PREDICTED: nucleolar protein 58-like, partial [Hydra vulgaris]
Length=358

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KLS+V+DL+K+F T + A K+VKLK F KFE+T+EALSA 
Sbjct  1    MLVLFETPAGYAIFKLLDEKKLSQVDDLFKDFETPELASKIVKLKHFKKFEDTTEALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  I+ K SK L+K ++     +    LAVAD+K+GN IK+K  I+CV ++ V ELMRG+
Sbjct  61   TASIEGKMSKSLKKIMKKVASKEMHEELAVADAKIGNLIKDKFDINCVCSTAVNELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LITG+  ++   MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMNGLITGITDKEFTAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_005777664.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
 gb|EOD25235.1| hypothetical protein EMIHUDRAFT_206438 [Emiliania huxleyi CCMP1516]
Length=368

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  637  YAMRVREWYGWHFP  678
            YAMR++EWYGWHFP
Sbjct  181  YAMRLKEWYGWHFP  194



>ref|XP_005771074.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
 gb|EOD18645.1| hypothetical protein EMIHUDRAFT_75659 [Emiliania huxleyi CCMP1516]
Length=390

 Score =   256 bits (654),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 124/194 (64%), Positives = 153/194 (79%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG ALF++LD GKL K + L + FS+ D  RK+VKLKAF KFE+T+EA+ +A
Sbjct  1    MLVLFETPAGHALFQLLDAGKLKKPDSLRESFSSPDKTRKLVKLKAFKKFEDTAEAVQSA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L++ K S  ++KFL+ +  G    ++LAV D+KLG  IKEKL I CVH+  VMELMRG
Sbjct  61   TALVEGKLSATMKKFLKKNVAGQDLKESLAVCDAKLGATIKEKLNIACVHDEGVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            LR Q+ EL+T     ++  M++GL+HSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNT
Sbjct  121  LRAQVEELVTAATPAEMRSMAIGLAHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNT  180

Query  637  YAMRVREWYGWHFP  678
            YAMR++EWYGWHFP
Sbjct  181  YAMRLKEWYGWHFP  194



>gb|KDD76960.1| putative snoRNA binding domain-containing protein [Helicosporidium 
sp. ATCC 50920]
Length=481

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 158/192 (82%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKL--SKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALS  282
            +LVLFE+PAG ALFKVL EGKL  ++ ED+W  F T + A+KVVKLKAFS+FE+T+EAL 
Sbjct  2    VLVLFESPAGLALFKVLKEGKLKEAETEDVWSNFETLEAAQKVVKLKAFSRFESTAEALQ  61

Query  283  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            +A  L++SK SKGL+K L+ H  G+TLAV D+KLG+ IKEKL I CV ++ V EL RG+R
Sbjct  62   SAASLVESKVSKGLKKLLKKHAAGETLAVLDAKLGSVIKEKLDIPCVFSAGVGELSRGIR  121

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL   +L PMSLGL+HSLSRYKLKFSPDKVDTM+VQAI LLDDLDKELNTYA
Sbjct  122  HQMEGLLGGLSSAELRPMSLGLAHSLSRYKLKFSPDKVDTMVVQAIGLLDDLDKELNTYA  181

Query  643  MRVREWYGWHFP  678
            MRVREWYGWHFP
Sbjct  182  MRVREWYGWHFP  193



>emb|CDS04923.1| hypothetical protein LRAMOSA07453 [Absidia idahoensis var. thermophila]
Length=496

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 152/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TY+MRV+EWYGWHFP
Sbjct  181  TYSMRVKEWYGWHFP  195



>tpg|DAA42144.1| TPA: hypothetical protein ZEAMMB73_016967 [Zea mays]
Length=343

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +1

Query  292  LLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQL  471
            ++IDSKPSKGLRKFL+ HC+G+TLAVADSKLGNAIKEKL+IDC+HNS VMELMRGLRNQL
Sbjct  1    MIIDSKPSKGLRKFLQKHCEGETLAVADSKLGNAIKEKLKIDCLHNSAVMELMRGLRNQL  60

Query  472  TELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRV  651
            TELITGLG QDL PMSLGLSHSLSRYKLKFSP+KVDTMI+QAI LLDDLDKELNTYAMRV
Sbjct  61   TELITGLGAQDLGPMSLGLSHSLSRYKLKFSPEKVDTMIIQAIGLLDDLDKELNTYAMRV  120

Query  652  REWYGWHFP  678
            REWYGWHFP
Sbjct  121  REWYGWHFP  129



>ref|XP_001690352.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP05611.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=508

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFET AGFALFKVL E KL + EDL  +F+T + A+KVVKLKAFSKFENT+EAL+AA
Sbjct  1    MLLLFETAAGFALFKVLKEKKLEEAEDLASDFATLEAAQKVVKLKAFSKFENTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGD-TLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            T L+DSK SKGL+KFL+ H D D  LA+ D KLG+ ++EKL ++ + ++ V+EL RG+R+
Sbjct  61   TALVDSKLSKGLKKFLKKHVDEDEKLALLDKKLGSIVQEKLGLNVLWSNQVLELSRGIRS  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            QLT LI+GL   DL PMSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELNTYAM
Sbjct  121  QLTGLISGLAGADLRPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAM  180

Query  646  RVREWYGWHFP  678
            RVREWYGWHFP
Sbjct  181  RVREWYGWHFP  191



>emb|CDH51673.1| loc398558 protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=497

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 152/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GKL K +D+WK F TA+ A + VKLKAFSKFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKLEKPDDIWKHFETAEKANQTVKLKAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL S         + L V D KLG+A+ +KL I+ V +STVM+L R
Sbjct  61   TGIVEGKIPKNLKKFLSSEISEKEMKKEKLVVGDPKLGSAVNKKLGINVVSDSTVMDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL  MSLGLSHSLSRYKLKFSPDKVDTMIVQAI LLDDLDKELN
Sbjct  121  GIREQFESLVSGLSHHDLNAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TY+MRV+EWYGWHFP
Sbjct  181  TYSMRVKEWYGWHFP  195



>gb|KHN07217.1| Putative nucleolar protein 5-2, partial [Glycine soja]
Length=190

 Score =   248 bits (632),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 133/164 (81%), Gaps = 14/164 (9%)
 Frame = +1

Query  187  DLWKEFSTADTARKVVKLKAFSKFENTSEALSAATLLIDSKPSKGLRKFLRSHCDGDTLA  366
            DLWK FS  DTAR+VVKLKAFSKFENT EAL AATLLID K SKGLRKFLR +C+ +TL 
Sbjct  1    DLWKNFSCVDTARQVVKLKAFSKFENTLEALEAATLLIDGKASKGLRKFLRVYCENETLG  60

Query  367  VADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQLTELITGLGVQDLAPMSLGLSHSLSR  546
                          +IDC+HN+ +M LMRG+RNQLTELI+GL VQD+APMSLGLSHSLSR
Sbjct  61   --------------KIDCIHNNAIMNLMRGVRNQLTELISGLPVQDMAPMSLGLSHSLSR  106

Query  547  YKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMRVREWYGWHFP  678
            YKLKF+ +KVDTMIVQAI LLDDL KELNTYAMRV EWYGWHFP
Sbjct  107  YKLKFTREKVDTMIVQAIDLLDDLGKELNTYAMRVLEWYGWHFP  150



>ref|XP_011399356.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
 gb|KFM26424.1| putative nucleolar protein 5-2 [Auxenochlorella protothecoides]
Length=496

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVE--DLWKEFSTADTARKVVKLKAFSKFENTSEALS  282
            +L+LFE+ AGFALFKVLDEGKL + E  D+W  F T D A+KVVKLKAFSKFENT++AL 
Sbjct  2    VLLLFESAAGFALFKVLDEGKLKEAETQDVWSSFETLDAAKKVVKLKAFSKFENTADALQ  61

Query  283  AATLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            AA  L+DSK SK L+KFL+ H   DTLAV D+KLGN IKEKL+I CV+++ V EL RG+R
Sbjct  62   AAASLVDSKVSKSLKKFLKKHAGSDTLAVLDAKLGNVIKEKLEIPCVYSTGVSELTRGVR  121

Query  463  NQLTELITGLGVQ-DLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            NQL  L+ GLG + DL PMSLGLSHSLSRYKLKFSPDKVDTMI+QAI LLDDLDKELNTY
Sbjct  122  NQLGGLLAGLGHEADLRPMSLGLSHSLSRYKLKFSPDKVDTMIIQAIGLLDDLDKELNTY  181

Query  640  AMRVREWYGWHFP  678
            AMRVREWYGWHFP
Sbjct  182  AMRVREWYGWHFP  194



>ref|XP_006567771.1| PREDICTED: nucleolar protein 58-like [Apis mellifera]
Length=578

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 152/192 (79%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MRVREWYGWHFP  678
            MR REWYGWHFP
Sbjct  181  MRCREWYGWHFP  192



>ref|XP_006618628.1| PREDICTED: nucleolar protein 58-like [Apis dorsata]
Length=578

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 152/192 (79%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ EF T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTEVENLYHEFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MRVREWYGWHFP  678
            MR REWYGWHFP
Sbjct  181  MRCREWYGWHFP  192



>ref|XP_003056558.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
 gb|EEH59934.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
Length=469

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+LFETPAG++LFK+ DE  +   E +    +T + A+ +V LKAFSKF+NT+EAL+AA
Sbjct  1    MLLLFETPAGYSLFKIKDERNIDDAEAIENALNTTEGAKNLVSLKAFSKFDNTAEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
              L+DSK  K L+KFL+ + +G+ LAVAD+KLG  IKEKL I C++++ VMELMRG+R+Q
Sbjct  61   ASLVDSKLGKDLKKFLKKNAEGEILAVADAKLGGHIKEKLGIACIYSANVMELMRGVRHQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            L +LI GL   D+APMSLGLSHSLSRYKLKFSPDKVDTM+VQAI LLD+LDKELNTYAMR
Sbjct  121  LNDLIGGLDDIDVAPMSLGLSHSLSRYKLKFSPDKVDTMVVQAIGLLDELDKELNTYAMR  180

Query  649  VREWYGWHFP  678
            VREWYGWHFP
Sbjct  181  VREWYGWHFP  190



>ref|XP_007501981.1| PREDICTED: nucleolar protein 58 isoform X4 [Monodelphis domestica]
Length=533

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_007501980.1| PREDICTED: nucleolar protein 58 isoform X3 [Monodelphis domestica]
Length=534

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_007501979.1| PREDICTED: nucleolar protein 58 isoform X2 [Monodelphis domestica]
Length=535

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_003230376.2| PREDICTED: nucleolar protein 58-like [Anolis carolinensis]
Length=539

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK  +K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNFKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_001371978.1| PREDICTED: nucleolar protein 58 isoform X1 [Monodelphis domestica]
Length=540

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+   +    + LAVAD+KLG  IK+KL + C+H+ T+ ELMRG+
Sbjct  61   TALVEGKLSKNLKKVLKKIAAKEAHEQLAVADAKLGGVIKDKLNLSCIHSPTITELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFS DKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSADKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_003491528.1| PREDICTED: nucleolar protein 58-like [Bombus impatiens]
Length=588

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 152/192 (79%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A K+VKLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDEDKLTEVENLYHDFETPEAASKIVKLKHFEKFADTTEALVAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC+   + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCNELQEQLAVADAKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQMDSLLAGLPKKEITAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MRVREWYGWHFP  678
            MR REWYGWHFP
Sbjct  181  MRCREWYGWHFP  192



>gb|EFX84998.1| hypothetical protein DAPPUDRAFT_300779 [Daphnia pulex]
Length=515

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL + ++L+++F T + A KVVKLK F KF +T+EALSA 
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLQQTDNLFQDFQTPEGASKVVKLKHFKKFTDTTEALSAT  60

Query  289  TLLIDSKPSKGLRKFLRS---HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  I+ K SK LRK L+S       + LAVAD+KLG+AIKEKLQI+C+ NS + ELMR +
Sbjct  61   TAAIEGKLSKTLRKTLKSLFAEEAHEALAVADAKLGSAIKEKLQINCLSNSAIQELMRCI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q   L+ GL  Q++  M+LGL+HSLSRYKLKFSPDK+DTMIVQA+SLLDDLDKELN Y
Sbjct  121  RSQADSLMGGLPKQEMMAMALGLAHSLSRYKLKFSPDKIDTMIVQAVSLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  VMRCREWYGWHFP  193



>ref|XP_001750802.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ84401.1| predicted protein [Monosiga brevicollis MX1]
Length=492

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 151/194 (78%), Gaps = 5/194 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFKV    KLS+  DL   F+T D A + VKLK F KFE+T EAL+AA
Sbjct  1    MLVLFETPAGYALFKVKKGVKLSEA-DLADVFATPDAANEAVKLKGFHKFEDTVEALTAA  59

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T L + K SKGL+ FL+ +       DTLAV ++KLG  IKEKL I CV++S V ELMRG
Sbjct  60   TALTEGKLSKGLKSFLKDNIISKEVQDTLAVPEAKLGTVIKEKLGIQCVYDSGVQELMRG  119

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R+QL+ +I+GL   DL  M+LGL+HSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNT
Sbjct  120  IRSQLSAVISGLRESDLTAMTLGLAHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNT  179

Query  637  YAMRVREWYGWHFP  678
            Y MRVREWYGWHFP
Sbjct  180  YTMRVREWYGWHFP  193



>ref|XP_002598583.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
 gb|EEN54595.1| hypothetical protein BRAFLDRAFT_113716 [Branchiostoma floridae]
Length=517

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 155/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+L+E KL + E+L+K+F T + A K+VKLK F KF++T+EALSAA
Sbjct  1    MLVLFETPAGYAIFKLLNEKKLQETEELFKDFETPEKASKIVKLKHFQKFDDTTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  ++ K SK ++K L+   +    + LAVAD+KLGNAIK+KL + CVHN+ + ELMR +
Sbjct  61   TAAVEGKMSKTMKKMLKKIVAKEAHEELAVADAKLGNAIKDKLDLQCVHNTAIAELMRCI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            ++Q+  LITGL  +++A M+LGL+H LSRYKLKFSPDKVDTMI+QAI LLDDLDKELN Y
Sbjct  121  KSQVNNLITGLPNKEMAAMALGLAHGLSRYKLKFSPDKVDTMIIQAICLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR +EWYGWHFP
Sbjct  181  IMRCKEWYGWHFP  193



>gb|EIE91295.1| hypothetical protein RO3G_16006 [Rhizopus delemar RA 99-880]
Length=493

 Score =   252 bits (643),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELYRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMRVREWYGWHFP  678
            AMR +EWYGWHFP
Sbjct  181  AMRCKEWYGWHFP  193



>ref|XP_009054674.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
 gb|ESO94640.1| hypothetical protein LOTGIDRAFT_144966 [Lottia gigantea]
Length=471

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 150/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FK+L E KL K E+L+ +F + +TA KVVKLK F KF + +EALSAA
Sbjct  1    MLVLFETAAGYAVFKLLSEKKLQKAENLFNDFESPETASKVVKLKHFQKFGDMTEALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  ++ K SK L+K ++     D    LAV+D+KLGN IKEK Q+ CV NS++ ELMR +
Sbjct  61   TAAVEGKMSKTLKKVMKKLVAADAQEELAVSDAKLGNIIKEKYQLPCVSNSSIQELMRCI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++  MSLGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQVDSLITGLPQKEIMAMSLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  TMRAREWYGWHFP  193



>emb|CEP14638.1| hypothetical protein [Parasitella parasitica]
Length=494

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GK+ K ++++KEF + D A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPDEIYKEFESVDKANQAVKLKAFKKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL S         + L ++D KLG+++ +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLESEISEKEMKKEKLVISDPKLGSSVNKKLGINVLSDSTVQDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TYAMRV+EWYGWHFP
Sbjct  181  TYAMRVKEWYGWHFP  195



>ref|XP_008618047.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
 gb|EQC28399.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
Length=492

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 148/194 (76%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  ++ LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMSSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            YAMRVREW+GWHFP
Sbjct  181  YAMRVREWFGWHFP  194



>gb|EIE85756.1| hypothetical protein RO3G_10466 [Rhizopus delemar RA 99-880]
Length=467

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL+K E+++KEF  A+TA  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDSKLNKPEEIYKEFQDAETANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL++     + + L ++D KLG++I +KL I  + +STV EL RG+
Sbjct  61   TGIVEGKMPKNLKKFLQAEIKDMNKEQLIISDPKLGSSISKKLGIKVLSDSTVQELCRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMRVREWYGWHFP  678
            AMR +EWYGWHFP
Sbjct  181  AMRCKEWYGWHFP  193



>ref|XP_011064344.1| PREDICTED: nucleolar protein 58-like [Acromyrmex echinatior]
 gb|EGI59331.1| Nucleolar protein 58 [Acromyrmex echinatior]
Length=644

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 153/192 (80%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL++ EDL K+F T + A +++KL  F KFE+T+EAL AA
Sbjct  1    MLVLFETSAGYAIFKVLNENKLAQSEDLHKDFETPEAASRLLKLTYFHKFEDTTEALCAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC--DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T L++SK SK L+K LR+ C    + LAVAD+KLG AIK+KLQ+ CV N+ V ELMR +R
Sbjct  61   TALVNSKLSKSLKKTLRNCCIEAHEQLAVADAKLGCAIKDKLQLSCVSNTAVQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +QL  LI+G+  ++   M+LGL+HSLSRYKLKFSPDKVDTM++QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLISGVTEKERTAMTLGLAHSLSRYKLKFSPDKVDTMVIQAVCLLDDLDKELNNYI  180

Query  643  MRVREWYGWHFP  678
            MR REWYGWHFP
Sbjct  181  MRAREWYGWHFP  192



>gb|KDO24106.1| hypothetical protein SPRG_10894 [Saprolegnia parasitica CBS 223.65]
Length=492

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 147/194 (76%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+++D A +VVKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKHFASSDKASQVVKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
                D    K L+KFL+ H       D LAV D   G  IKEKL I CVH+ +V ELMRG
Sbjct  61   ADCTDGTVGKSLKKFLKKHVKDAGVSDKLAVMDKAFGGIIKEKLGIQCVHDKSVDELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLEDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            YAMRVREW+GWHFP
Sbjct  181  YAMRVREWFGWHFP  194



>ref|XP_008113176.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Anolis 
carolinensis]
Length=424

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +++ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEIDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKISKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RTQMEGLISGLPAKEMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_011341650.1| PREDICTED: nucleolar protein 58 [Cerapachys biroi]
 gb|EZA52528.1| Nucleolar protein [Cerapachys biroi]
Length=667

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 153/192 (80%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A KVVKLK F KFE+T+EAL+A+
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKSENLYLDFKTVEGANKVVKLKYFHKFEDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T +I+ K SK L+K L+S C    + LAVAD+KLGN+IK KLQ+ CV N+ + ELMR +R
Sbjct  61   TAIIEGKLSKSLKKTLKSCCSDLHEQLAVADAKLGNSIKNKLQVPCVSNTAIHELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q   L+T +  +D+  M+LGL+HSLSRYKLKFSPDKVD M++QA+ LLD+LDK+LN Y 
Sbjct  121  SQAESLVTEVNSKDMTAMALGLAHSLSRYKLKFSPDKVDIMVIQAVCLLDELDKQLNNYM  180

Query  643  MRVREWYGWHFP  678
            M+ REWYGWHFP
Sbjct  181  MKTREWYGWHFP  192



>dbj|GAN04212.1| nop-domain-containing protein [Mucor ambiguus]
Length=499

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TYAMRV+EWYGWHFP
Sbjct  181  TYAMRVKEWYGWHFP  195



>gb|EPB89396.1| hypothetical protein HMPREF1544_03765 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=501

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++D+GK+ K E+++K+F + + A + VKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETAAGYALFKLVDDGKMEKPEEIYKDFESVEKANQAVKLKAFKKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T +++ K  K L+KFL +         + L ++D KLG++I +KL I+ + +STV +L R
Sbjct  61   TGIVEGKMPKNLKKFLETEISEKEMKKEKLVISDPKLGSSINKKLGINVLSDSTVQDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R Q   L++GL   DL+ MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRQQFESLVSGLSQSDLSAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TYAMRV+EWYGWHFP
Sbjct  181  TYAMRVKEWYGWHFP  195



>emb|CEI87149.1| Putative U3 snoRNP protein Nop58 [Rhizopus microsporus]
Length=377

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 150/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMRVREWYGWHFP  678
            AMR +EWYGWHFP
Sbjct  181  AMRCKEWYGWHFP  193



>ref|XP_011267939.1| PREDICTED: nucleolar protein 58 [Camponotus floridanus]
 gb|EFN60271.1| Nucleolar protein 5 [Camponotus floridanus]
Length=675

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 153/191 (80%), Gaps = 1/191 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL+K E+L+K+F T + A K+VKL+ F KFE+ +EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLTKSENLYKDFETPEDASKIVKLEHFHKFEDITEALAAT  60

Query  289  TLLIDSKPSKGLRKFLR-SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
            T L+++K  K L+K LR S  D   LAVAD +LG+AIK+KL + CV N+ + ELMR +RN
Sbjct  61   TALVENKVPKSLKKALRQSPIDHQKLAVADLRLGHAIKDKLDVSCVSNNAIQELMRCIRN  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q+  LIT +  ++++ M+LGL+HSLSRYKLKFSPDK+DTM++QA+ LLDD+DKELN Y M
Sbjct  121  QMDSLITDVTKKEMSAMALGLAHSLSRYKLKFSPDKIDTMVIQAVCLLDDIDKELNNYIM  180

Query  646  RVREWYGWHFP  678
            R REWYGWHFP
Sbjct  181  RAREWYGWHFP  191



>emb|CEI96131.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 150/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMRVREWYGWHFP  678
            AMR +EWYGWHFP
Sbjct  181  AMRCKEWYGWHFP  193



>ref|XP_009086324.1| PREDICTED: nucleolar protein 58 [Serinus canaria]
Length=527

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>gb|EMC81163.1| Nucleolar protein 58, partial [Columba livia]
Length=468

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_005519952.1| PREDICTED: nucleolar protein 58 [Pseudopodoces humilis]
Length=527

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_006273562.1| PREDICTED: nucleolar protein 58 [Alligator mississippiensis]
Length=525

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_007422082.1| PREDICTED: nucleolar protein 58 [Python bivittatus]
Length=538

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL ++++LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLDEKKLQEIDNLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKIGKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LI+GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLISGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>emb|CEG70655.1| Putative Nucleolar protein 58 [Rhizopus microsporus]
Length=494

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 150/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ET AG+ALFK++ + KL K E+L+KEF  A++A  VVKLKAF KFENT++ALSA 
Sbjct  1    MLVLYETSAGYALFKLVKDNKLDKPEELYKEFQDAESANNVVKLKAFEKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHC---DGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T +++ K  K L+KFL+S     + + L ++D KL +++ +KL I  + + TV +L RG+
Sbjct  61   TGIVEGKMPKNLKKFLQSEIKDMNKEQLIISDPKLASSVSKKLGIKVLSDGTVQDLFRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R Q   L+TGL   DLA MSLGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELNTY
Sbjct  121  REQFESLVTGLSHSDLAAMSLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELNTY  180

Query  640  AMRVREWYGWHFP  678
            AMR +EWYGWHFP
Sbjct  181  AMRCKEWYGWHFP  193



>ref|XP_005049217.1| PREDICTED: nucleolar protein 58 [Ficedula albicollis]
Length=527

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>emb|CCA22673.1| nucleolar protein NOP5 putative [Albugo laibachii Nc14]
Length=497

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 151/193 (78%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE KL+KVE + K+F T D A +++KLK F  F++T++A++A 
Sbjct  1    MLVLFETAAGHALFKVQDESKLAKVETITKQFETIDQANQLIKLKGFHAFKDTTQAVAAV  60

Query  289  TLLIDSKPSKGLRKFLRSH-CDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
               +D+K  KGLRKFL+ +  DG  + LAV+D  LG+ IKEKL I CV+++ V ELMRG+
Sbjct  61   ADTLDAKIGKGLRKFLKKNISDGIKEKLAVSDKALGSMIKEKLGIPCVYDACVFELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R  +  LITGL ++DL  M+LGLSHSLSRYKLKFS DKVDTMI+QAI LLD+LDKE+N Y
Sbjct  121  RTHMNSLITGLEIEDLKSMTLGLSHSLSRYKLKFSADKVDTMIIQAIGLLDELDKEINAY  180

Query  640  AMRVREWYGWHFP  678
            +MRVREW+GWHFP
Sbjct  181  SMRVREWFGWHFP  193



>ref|XP_006017720.1| PREDICTED: nucleolar protein 58 [Alligator sinensis]
Length=525

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETGAGYAIFKVLDEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_010563240.1| PREDICTED: nucleolar protein 58 isoform X2 [Haliaeetus leucocephalus]
Length=485

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_421942.1| PREDICTED: nucleolar protein 58 [Gallus gallus]
Length=527

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_010711773.1| PREDICTED: nucleolar protein 58 [Meleagris gallopavo]
Length=528

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_005837542.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
 gb|EKX50562.1| hypothetical protein GUITHDRAFT_66997 [Guillardia theta CCMP2712]
Length=501

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 149/194 (77%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVL+ETPAG+ALFKV DE KL  V+D+ + F+  D A K +KLKAF KFE+TSEAL AA
Sbjct  1    MLVLYETPAGYALFKVTDEKKLKDVDDIQEVFADPDKASKAMKLKAFQKFEDTSEALVAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T +++S  SKGL+KFL  +       + LAV ++KLG  IKEKL++ C+++  V+E+MRG
Sbjct  61   TAMLESSLSKGLKKFLEKNIVKKGLNEELAVYETKLGKVIKEKLEVPCIYDDKVLEIMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  L  L+ G   QDL  M LGL+HSL R+KLKFSPDKVDTM+VQAI LLD+LDKELNT
Sbjct  121  VRANLEVLLGGTTEQDLKTMRLGLAHSLGRHKLKFSPDKVDTMVVQAIGLLDELDKELNT  180

Query  637  YAMRVREWYGWHFP  678
            YAMRVREWYGWHFP
Sbjct  181  YAMRVREWYGWHFP  194



>ref|XP_005306283.1| PREDICTED: nucleolar protein 58 isoform X1 [Chrysemys picta bellii]
Length=526

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVLDE KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETAAGYAVFKVLDEKKLQEVDSLWREFETPEKANKIVKLKHFEKFQDTTEALAAC  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LA+AD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAIADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_004378293.1| PREDICTED: nucleolar protein 58 [Trichechus manatus latirostris]
Length=533

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 151/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFLR-----SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L++ L+     +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKRVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>gb|EGW06124.1| Nucleolar protein 58 [Cricetulus griseus]
Length=219

 Score =   235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_005511378.1| PREDICTED: nucleolar protein 58 [Columba livia]
Length=527

 Score =   244 bits (624),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_010563232.1| PREDICTED: nucleolar protein 58 isoform X1 [Haliaeetus leucocephalus]
Length=527

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_009836884.1| hypothetical protein H257_11594 [Aphanomyces astaci]
 gb|ETV73458.1| hypothetical protein H257_11594 [Aphanomyces astaci]
Length=510

 Score =   244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 148/194 (76%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K F+TAD A   VKLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLTNVDDIHKHFATADKANSFVKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKSMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  181  YSMRVREWFGWHFP  194



>ref|XP_002189225.1| PREDICTED: nucleolar protein 58 [Taeniopygia guttata]
Length=527

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 152/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IKEKL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKEKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LI GL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQVEGLIAGLPSREMAAMRLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_005144700.1| PREDICTED: nucleolar protein 58 [Melopsittacus undulatus]
Length=528

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A+
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTTEALAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K SK L+K L+     D    LAVAD+KLG  IK+KL + C+H+  V ELMRG+
Sbjct  61   TALVEGKLSKNLKKILKKIVAKDAHEQLAVADAKLGGVIKDKLNLSCIHSPMVTELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            R+Q+  LITGL  +++A M LGL+HSLSRYKLKFSPDKVDTMI+QAISLLDDLDKELN Y
Sbjct  121  RSQIEGLITGLPSREMAAMCLGLAHSLSRYKLKFSPDKVDTMIIQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>ref|XP_008872332.1| hypothetical protein H310_08394 [Aphanomyces invadans]
 gb|ETV98904.1| hypothetical protein H310_08394 [Aphanomyces invadans]
Length=494

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 149/194 (77%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DEGKL+ V+D+ K+F+TAD A   +KLKAF+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEGKLANVDDIHKQFATADKANSFLKLKAFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCD----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
               +D+   K L+KFL+ H       D LAV D   G  IKEKL I CVH++++ EL+RG
Sbjct  61   ADCVDNTVGKSLKKFLKKHVKDAGLSDKLAVVDKAFGGVIKEKLGIQCVHDASIQELLRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LI+GL  QDL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRTHMNSLISGLDDQDLKNMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  181  YSMRVREWFGWHFP  194



>ref|XP_002903084.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
 gb|EEY55508.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
Length=519

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 150/194 (77%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE KL+  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  24   MLVLFETAAGHALFKVQDEAKLANADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  83

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +       D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  84   TDMVDGKMGKTLKKFLKKNVVDVGLKDKLAVSDKALGSLIKEKLSIACVNDSAVNEVMRG  143

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  144  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  203

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  204  YSMRVREWFGWHFP  217



>ref|XP_003743589.1| PREDICTED: nucleolar protein 58 [Metaseiulus occidentalis]
Length=545

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFE+PAGFA+FKVLDE K+ K E+L+KEF  A  A K++KLK F KFE+ ++ALSAA
Sbjct  1    MLVLFESPAGFAVFKVLDEKKIQKSENLFKEFEDASDASKILKLKHFQKFEDMTQALSAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T  I+ K +K L+K L+     +TLAVAD+KLGN IKEK+ I CV NS++ ELMR +R+Q
Sbjct  61   TGAIEGKLTKPLKKILKKLEATETLAVADAKLGNIIKEKMDISCVANSSIQELMRCIRSQ  120

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
               LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKELN Y MR
Sbjct  121  QEALITGLSQKEVTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKELNNYVMR  180

Query  649  VREWYGWHFP  678
             +EWYGWHFP
Sbjct  181  CKEWYGWHFP  190



>gb|ETL31667.1| hypothetical protein L916_15560 [Phytophthora parasitica]
 gb|ETL84897.1| hypothetical protein L917_15383 [Phytophthora parasitica]
Length=496

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  181  YSMRVREWFGWHFP  194



>gb|ETI38018.1| hypothetical protein F443_16119 [Phytophthora parasitica P1569]
 gb|ETK78232.1| hypothetical protein L915_15665 [Phytophthora parasitica]
 gb|ETM38080.1| hypothetical protein L914_15515 [Phytophthora parasitica]
 gb|ETO66787.1| hypothetical protein F444_16104 [Phytophthora parasitica P1976]
 gb|ETP07908.1| hypothetical protein F441_15948 [Phytophthora parasitica CJ01A1]
 gb|ETP35975.1| hypothetical protein F442_15972 [Phytophthora parasitica P10297]
Length=496

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  181  YSMRVREWFGWHFP  194



>ref|XP_008911207.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
 gb|ETN03434.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
Length=496

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE K++  +D++K FST + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKVASADDVFKHFSTPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IKEKL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKEKLNIACVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  181  YSMRVREWFGWHFP  194



>ref|XP_004367446.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20421.1| matrix attachment region binding protein [Acanthamoeba castellanii 
str. Neff]
Length=525

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 153/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFKV +EGKL +  ++ K+F+T + A+KVV LKAF KF NT+EAL+A 
Sbjct  1    MLVLFETPAGYALFKVHNEGKLQEA-NIAKDFATLEGAQKVVSLKAFQKFGNTTEALAAT  59

Query  289  TLLIDSKPSKGLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRNQ  468
            T +++SK  K L+KFL+    G+ L V+D KL   IK+K+ + C+HNS V EL+RG+R Q
Sbjct  60   TAIVESKLGKDLKKFLKKQAKGEQLGVSDPKLAGIIKDKIGVQCLHNSMVNELLRGIRLQ  119

Query  469  LTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAMR  648
            +T+LITGLG  +L+ M LGLSHSL RYKLKFSPDKVD MI+QAI+LLDDLDKE NTYAMR
Sbjct  120  MTDLITGLGEGELSNMVLGLSHSLCRYKLKFSPDKVDHMIIQAIALLDDLDKESNTYAMR  179

Query  649  VREWYGWHFP  678
            V+EWYGWHFP
Sbjct  180  VKEWYGWHFP  189



>ref|XP_008187145.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Acyrthosiphon 
pisum]
Length=487

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 145/191 (76%), Gaps = 1/191 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATSKIIKLKHFQKFDDTTEALASA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  646  RVREWYGWHFP  678
            R REWYGWHFP
Sbjct  181  RCREWYGWHFP  191



>ref|XP_009530825.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
 gb|EGZ13396.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
Length=489

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 151/194 (78%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG ALFKV DE KL+  +D++K F+T + A KV+KLK F+ F++T+EA++AA
Sbjct  1    MLVLFETAAGHALFKVQDEAKLANADDVFKHFATPEKAAKVLKLKGFNAFKDTTEAVAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHC-DG---DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T ++D K  K L+KFL+ +  D    D LAV+D  LG+ IK+KL I CV++S V E+MRG
Sbjct  61   TDMVDGKMGKTLKKFLKKNVVDAGLKDKLAVSDKALGSLIKDKLSISCVNDSAVNEVMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R  +  LITGL   DL  M+LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRANMDTLITGLEDDDLKAMTLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            Y+MRVREW+GWHFP
Sbjct  181  YSMRVREWFGWHFP  194



>emb|CBJ32359.1| conserved unknown protein [Ectocarpus siliculosus]
Length=559

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 150/194 (77%), Gaps = 4/194 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+ALFK+ +E  L   + ++ EFST + A + VKLKAF  F +T++A++A+
Sbjct  1    MLVLFETPAGYALFKMTNESILKDADGIYDEFSTPEKAAESVKLKAFMTFADTADAVAAS  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG----DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRG  456
            T +IDSK  K L+KFL  +       D LAV+DSKL NAIK+KL I CV++S VMELMRG
Sbjct  61   TEMIDSKMGKSLKKFLTKNIVKKELKDKLAVSDSKLANAIKDKLSIKCVNDSGVMELMRG  120

Query  457  LRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNT  636
            +R QL  L+T +G  +L  M LGLSHSLSRYKLKFS DKVDTMIVQAI LLD+LDKE+NT
Sbjct  121  IRGQLDGLLTSVGDDNLKAMRLGLSHSLSRYKLKFSADKVDTMIVQAIGLLDELDKEINT  180

Query  637  YAMRVREWYGWHFP  678
            YAMRV+EW+GWHFP
Sbjct  181  YAMRVKEWFGWHFP  194



>gb|ESA16249.1| hypothetical protein GLOINDRAFT_158776 [Rhizophagus irregularis 
DAOM 181602]
Length=430

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/195 (59%), Positives = 146/195 (75%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+ALF+VL EGKL + ++LWK+F T + A+K VKL  F KFEN SEA+++ 
Sbjct  1    MLVLFETAAGYALFEVLKEGKLREPDELWKDFETPEAAKKTVKLVDFQKFENMSEAVASV  60

Query  289  TLLIDSKPSKGLRKFLRS-----HCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            + L++ K SK L+KFL+          + LAV + K+G  I +K  I  + N TV+EL R
Sbjct  61   SDLLEGKLSKDLKKFLKESFEKIEVSSEKLAVMEPKIGATISKKFGIQVISNETVVELYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G++ QL  LITG+   D++ MSLGLSHSLSR+KLKFSPDKVD MI+QAI LLDDLDKELN
Sbjct  121  GIKQQLDSLITGIKSDDISQMSLGLSHSLSRHKLKFSPDKVDNMIIQAIGLLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TYAMRV+EWYGWHFP
Sbjct  181  TYAMRVKEWYGWHFP  195



>dbj|BAJ91724.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=607

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 145/191 (76%), Gaps = 1/191 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FK+LDE KL  V DL+  F + +   K++KLK F KF++T+EAL++A
Sbjct  1    MLVLFETSAGYAIFKLLDENKLKNVSDLYSHFESPEATTKIIKLKHFQKFDDTTEALASA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG-DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLRN  465
              LI+ K  K L+K ++SH +  D+L VAD KLG AIKEK  I CV +S+  +L+R +R+
Sbjct  61   ASLIEGKLCKSLKKVIKSHVNSSDSLMVADPKLGAAIKEKFNISCVSSSSAADLLRCIRS  120

Query  466  QLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYAM  645
            Q   L+ GL  +DL  MSLGL+HSLSRYKLKFSPDK+DTMIVQAI LLD+LDKE+N Y M
Sbjct  121  QFENLLVGLPKKDLTAMSLGLAHSLSRYKLKFSPDKIDTMIVQAIGLLDELDKEVNNYIM  180

Query  646  RVREWYGWHFP  678
            R REWYGWHFP
Sbjct  181  RCREWYGWHFP  191



>ref|XP_003907873.1| PREDICTED: nucleolar protein 58 isoform X1 [Papio anubis]
Length=423

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_011308274.1| PREDICTED: nucleolar protein 58 [Fopius arisanus]
Length=568

 Score =   241 bits (615),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 152/192 (79%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL+K E+L+ +F T + A K++KLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLAKTENLYHDFETPEAASKLLKLKHFEKFADTTEALAAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+++ ELMR +R
Sbjct  61   TAAVEGKLCKSLKKMLKKHCSEVQEQLAVADAKLGNAIKDKLSLSCVSNTSIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +QL  L+ GL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQLDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MRVREWYGWHFP  678
            MR REWYGWHFP
Sbjct  181  MRCREWYGWHFP  192



>ref|XP_001641027.1| predicted protein [Nematostella vectensis]
 gb|EDO48964.1| predicted protein [Nematostella vectensis]
Length=514

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL  V+DL+K+F + D A KVVKLK F KFE+T+EAL+AA
Sbjct  1    MLVLFETPAGYAVFKLLDEKKLKNVDDLYKDFESPDAASKVVKLKHFHKFEDTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLRSHCDGDT---LAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T  I+ K SKGL+K L+     D    LAV+D+KLGN IKEKL ++CV ++ V ELMRG+
Sbjct  61   TAAIEGKMSKGLKKLLKKVVAKDAHEQLAVSDAKLGNIIKEKLSVNCVASTAVHELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMNNLITGLQDREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  VMRCREWYGWHFP  193



>gb|AAH87637.1| Nol5 protein [Rattus norvegicus]
Length=444

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_005574023.1| PREDICTED: nucleolar protein 58 isoform X4 [Macaca fascicularis]
Length=431

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_007190607.1| PREDICTED: nucleolar protein 58 isoform X6 [Balaenoptera acutorostrata 
scammoni]
Length=432

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPLVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_003701979.1| PREDICTED: nucleolar protein 58-like [Megachile rotundata]
Length=589

 Score =   241 bits (615),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 152/192 (79%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL++VE+L+ +F T + A ++VKLK F KF +T+EAL+A 
Sbjct  1    MLVLFETPAGYAIFKLLDEQKLAEVENLYHDFETPEAASQIVKLKHFEKFADTTEALAAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCD--GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K  K L+K L+ HC    + LAVAD+KLGNAIK+KL + CV N+ + ELMR +R
Sbjct  61   TAAVEGKLCKSLKKILKKHCSELQEQLAVADTKLGNAIKDKLSLSCVSNTAIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L+ GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMI+QA+ LLDDLDKELN Y 
Sbjct  121  SQIDSLLAGLPKKEMTAMALGLAHSLSRYKLKFSPDKIDTMIIQAVCLLDDLDKELNNYV  180

Query  643  MRVREWYGWHFP  678
            MR REWYGWHFP
Sbjct  181  MRCREWYGWHFP  192



>ref|XP_006636806.1| PREDICTED: nucleolar protein 58-like [Lepisosteus oculatus]
Length=527

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 154/193 (80%), Gaps = 3/193 (2%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET AG+A+FKVL+E KL +V+ LW+EF T + A K+VKLK F KF++T+EAL+AA
Sbjct  1    MLVLFETAAGYAIFKVLNEKKLQEVDKLWEEFQTPERANKIVKLKHFEKFQDTTEALAAA  60

Query  289  TLLIDSKPSKGLRKFLR---SHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGL  459
            T L++ K  K L+K L+   +    + LA++D+KLG  IK+KL + CVH+  V ELMRG+
Sbjct  61   TALVEGKIGKSLKKVLKRVVAKEAHEQLAISDAKLGGVIKDKLNLSCVHSPAVAELMRGI  120

Query  460  RNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTY  639
            RNQ+  LITGL  ++++ M+LGL+HSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN Y
Sbjct  121  RNQMEGLITGLPPREMSAMALGLAHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNY  180

Query  640  AMRVREWYGWHFP  678
             MR REWYGWHFP
Sbjct  181  IMRCREWYGWHFP  193



>gb|AAC23535.1| unknown, partial [Rattus sp.]
Length=461

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_002407966.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
 gb|EEC12380.1| ribosome biogenesis protein - Nop58p/Nop5p, putative [Ixodes 
scapularis]
Length=515

 Score =   239 bits (609),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 154/196 (79%), Gaps = 9/196 (5%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFE+PAG+A+FKVLDE KL + ++L+K+F T D A +VVKLK F KFE+ ++AL+AA
Sbjct  1    MLVLFESPAGYAIFKVLDEKKLQQTDNLFKDFETPDKASRVVKLKHFEKFEDMTQALAAA  60

Query  289  TLLIDSKPSKGLRKFL------RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELM  450
            T  I+ K SK L+K L       +H   ++LAVAD+KLGN IK+K  I CV NS++ ELM
Sbjct  61   TSAIEGKMSKTLKKVLKKVVAKEAH---ESLAVADAKLGNVIKDKFDISCVANSSIQELM  117

Query  451  RGLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKEL  630
            R +R+Q+  LITGL  +++  M+LGL+HSLSRYKLKFSPDKVDTMI+QA+SLLDDLDKEL
Sbjct  118  RCIRSQVDGLITGLPRKEMTAMALGLAHSLSRYKLKFSPDKVDTMIIQAVSLLDDLDKEL  177

Query  631  NTYAMRVREWYGWHFP  678
            N Y MR +EWYGWHFP
Sbjct  178  NNYIMRCKEWYGWHFP  193



>dbj|BAE21954.1| unnamed protein product [Mus musculus]
Length=455

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 147/195 (75%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSK-----GLRKFLRSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K       +    +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_008556600.1| PREDICTED: nucleolar protein 58 [Microplitis demolitor]
Length=600

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 154/192 (80%), Gaps = 2/192 (1%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFETPAG+A+FK+LDE KL K ++L+++F T + A K++KLK F KF +T+EAL A 
Sbjct  1    MLVLFETPAGYAIFKLLDENKLEKTDNLFRDFETPEAANKILKLKHFHKFADTTEALEAT  60

Query  289  TLLIDSKPSKGLRKFLRSHCDG--DTLAVADSKLGNAIKEKLQIDCVHNSTVMELMRGLR  462
            T  ++ K SK L+K L+ H     D+LAVAD+KLGNAIKEKL + CV N+++ ELMR +R
Sbjct  61   TAAVEGKLSKTLKKTLKKHFGDLQDSLAVADAKLGNAIKEKLNLSCVSNTSIQELMRCIR  120

Query  463  NQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELNTYA  642
            +Q+  L++GL  +++  M+LGL+HSLSRYKLKFSPDK+DTMIVQA+ LLD+LDKELN Y 
Sbjct  121  SQMDSLLSGLPKREMTAMALGLAHSLSRYKLKFSPDKIDTMIVQAVGLLDELDKELNNYI  180

Query  643  MRVREWYGWHFP  678
            MRVREWYGWHFP
Sbjct  181  MRVREWYGWHFP  192



>emb|CAH91951.1| hypothetical protein [Pongo abelii]
Length=472

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_005574021.1| PREDICTED: nucleolar protein 58 isoform X2 [Macaca fascicularis]
Length=471

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>gb|KFH64217.1| hypothetical protein MVEG_10042 [Mortierella verticillata NRRL 
6337]
Length=507

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 153/195 (78%), Gaps = 5/195 (3%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            ML+L+E+PAG+ALF +LD+GKL K + +WK+F T + A K VKL+AFSKFENT++ALSA 
Sbjct  1    MLILYESPAGYALFNLLDDGKLEKPDSIWKDFETPEQANKTVKLRAFSKFENTTDALSAV  60

Query  289  TLLIDSKPSKGLRKFLRSHCD-----GDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K SK L++FL S         ++L V D+KLG AI +KL +  + +ST ++L R
Sbjct  61   TALVEGKLSKNLKEFLSSEISEKEMKKESLIVGDAKLGGAIAKKLNMKVISDSTTLDLYR  120

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R QL  L++GL   DL+ M LGLSHSLSRYKLKFSPDKVDTMIVQAI+LLDDLDKELN
Sbjct  121  GIRTQLDSLLSGLSSSDLSAMVLGLSHSLSRYKLKFSPDKVDTMIVQAIALLDDLDKELN  180

Query  634  TYAMRVREWYGWHFP  678
            TYAMRV+EWYGWHFP
Sbjct  181  TYAMRVKEWYGWHFP  195



>ref|XP_004701594.1| PREDICTED: nucleolar protein 58 [Echinops telfairi]
Length=530

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+QL  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQLDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>dbj|BAE22082.1| unnamed protein product [Mus musculus]
Length=499

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>gb|AAH09306.1| NOP58 protein, partial [Homo sapiens]
Length=522

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_003483763.1| PREDICTED: nucleolar protein 58 [Sus scrofa]
Length=540

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A KVVKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKVVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_007520557.1| PREDICTED: nucleolar protein 58 [Erinaceus europaeus]
Length=531

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVSELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



>ref|XP_009236281.1| PREDICTED: nucleolar protein 58 [Pongo abelii]
Length=495

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 120/195 (62%), Positives = 150/195 (77%), Gaps = 8/195 (4%)
 Frame = +1

Query  109  MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSTADTARKVVKLKAFSKFENTSEALSAA  288
            MLVLFET  G+A+FKVL+E KL +V+ LWKEF T + A K+VKLK F KF++T+EAL+A 
Sbjct  1    MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF  60

Query  289  TLLIDSKPSKGLRKFL-----RSHCDGDTLAVADSKLGNAIKEKLQIDCVHNSTVMELMR  453
            T L++ K +K L+K L      +H   + LAVAD+KLG  IKEKL + C+H+  V ELMR
Sbjct  61   TALMEGKINKQLKKVLKKIVKEAH---EPLAVADAKLGGVIKEKLNLSCIHSPVVNELMR  117

Query  454  GLRNQLTELITGLGVQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAISLLDDLDKELN  633
            G+R+Q+  LI G+  +++A M LGL+HSLSRY+LKFS DKVDTMIVQAISLLDDLDKELN
Sbjct  118  GIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELN  177

Query  634  TYAMRVREWYGWHFP  678
             Y MR REWYGWHFP
Sbjct  178  NYIMRCREWYGWHFP  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520