BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF034A07

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg           89.4    6e-33   Prunus persica
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9         87.8    1e-32   Prunus mume [ume]
emb|CDP02673.1|  unnamed protein product                              82.8    9e-31   Coffea canephora [robusta coffee]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9         84.0    1e-30   Pyrus x bretschneideri [bai li]
gb|ADL36578.1|  ARF domain class transcription factor                 84.0    2e-30   Malus domestica [apple tree]
gb|KDP32156.1|  hypothetical protein JCGZ_12617                       79.7    4e-29   Jatropha curcas
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like    82.4    5e-28   Citrus sinensis [apfelsine]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg           82.4    5e-28   Citrus clementina [clementine]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...  82.0    7e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                    76.6    8e-26   
ref|XP_007047687.1|  Transcription factor, putative isoform 1         80.5    1e-25   Theobroma cacao [chocolate]
ref|XP_007047688.1|  Transcription factor, putative isoform 2         80.5    1e-25   Theobroma cacao [chocolate]
ref|XP_007047690.1|  Transcription factor, putative isoform 4         80.5    2e-25   
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...  82.0    2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9         75.1    3e-25   Fragaria vesca subsp. vesca
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...  82.0    5e-25   Nelumbo nucifera [Indian lotus]
ref|XP_008357957.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...  79.7    4e-23   
gb|KJB18140.1|  hypothetical protein B456_003G035700                  81.6    5e-23   Gossypium raimondii
gb|KJB18136.1|  hypothetical protein B456_003G035700                  82.0    6e-23   Gossypium raimondii
gb|KJB18142.1|  hypothetical protein B456_003G035700                  82.0    6e-23   Gossypium raimondii
gb|KJB18143.1|  hypothetical protein B456_003G035700                  81.6    7e-23   Gossypium raimondii
ref|XP_002528895.1|  transcription factor, putative                   71.2    2e-22   Ricinus communis
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like    72.0    5e-22   Sesamum indicum [beniseed]
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein           75.9    8e-22   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    83.6    9e-22   Nelumbo nucifera [Indian lotus]
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                   82.0    6e-21   Gossypium arboreum [tree cotton]
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like    67.0    7e-21   Cucumis melo [Oriental melon]
gb|ACJ84551.1|  unknown                                               72.4    9e-21   Medicago truncatula
gb|AFK49626.1|  unknown                                               72.0    1e-20   Medicago truncatula
ref|XP_007047689.1|  Transcription factor, putative isoform 3         80.5    2e-20   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...  71.2    2e-20   Cicer arietinum [garbanzo]
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...  65.1    2e-20   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...  65.1    2e-20   Eucalyptus grandis [rose gum]
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                   65.1    3e-20   Eucalyptus grandis [rose gum]
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g           68.9    3e-20   Phaseolus vulgaris [French bean]
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative         77.0    4e-20   
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                   63.5    6e-20   Gossypium arboreum [tree cotton]
gb|ACU19961.1|  unknown                                               64.7    7e-20   Glycine max [soybeans]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9         64.7    9e-20   Glycine max [soybeans]
gb|AAM12952.1|  auxin-regulated protein                               64.7    2e-19   Zinnia elegans [garden zinnia]
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like    67.4    6e-19   Cucumis sativus [cucumbers]
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg              72.8    7e-19   Erythranthe guttata [common monkey flower]
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...  65.1    7e-19   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg              72.4    9e-19   Erythranthe guttata [common monkey flower]
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...  64.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like    62.0    2e-18   Sesamum indicum [beniseed]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g           62.4    4e-18   Phaseolus vulgaris [French bean]
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...  59.3    9e-18   
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    60.8    9e-18   Tarenaya hassleriana [spider flower]
ref|XP_002862301.1|  hypothetical protein ARALYDRAFT_920936           62.4    1e-17   Arabidopsis lyrata subsp. lyrata
emb|CAN77436.1|  hypothetical protein VITISV_007399                   66.2    2e-17   Vitis vinifera
ref|NP_001275473.1|  Aux/IAA protein                                  66.6    2e-17   Solanum tuberosum [potatoes]
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1            65.9    2e-17   Vitis vinifera
ref|NP_001268170.1|  Aux/IAA protein                                  65.9    2e-17   Vitis vinifera
gb|KHN46011.1|  Auxin-responsive protein IAA9                         59.3    3e-17   Glycine soja [wild soybean]
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg           62.0    3e-17   Capsella rubella
gb|ADL70577.1|  indole-3-acetic acid inducible 9                      62.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68170.1|  BnaCnng57860D                                        60.1    3e-17   Brassica napus [oilseed rape]
gb|ABD98054.1|  auxin-regulated protein                               73.9    3e-17   Striga asiatica [witchweed]
ref|XP_002864969.1|  auxin-induced protein IAA9                       62.0    3e-17   
ref|NP_851275.1|  auxin-responsive protein IAA9                       62.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10673.1|  auxin-induced protein IAA9                           61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_569017.2|  auxin-responsive protein IAA9                       62.0    4e-17   
gb|ADC29395.2|  indole-3-acetic acid inducible 9                      61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29394.1|  indole-3-acetic acid inducible 9                      61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29398.1|  indole-3-acetic acid inducible 9                      61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70583.1|  indole-3-acetic acid inducible 9                      61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70586.1|  indole-3-acetic acid inducible 9                      61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70578.1|  indole-3-acetic acid inducible 9                      61.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64650.1|  auxin-induced protein IAA9                            62.0    5e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ABB55368.1|  Aux/IAA protein-like                                  67.0    5e-17   Solanum tuberosum [potatoes]
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg              67.0    6e-17   Erythranthe guttata [common monkey flower]
gb|ADL70579.1|  indole-3-acetic acid inducible 9                      61.6    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB58782.1|  hypothetical protein B456_009G226000                  63.9    9e-17   Gossypium raimondii
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...  62.8    9e-17   Glycine max [soybeans]
gb|KHN22187.1|  Auxin-responsive protein IAA9                         62.8    1e-16   Glycine soja [wild soybean]
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...  62.8    1e-16   
gb|KJB58777.1|  hypothetical protein B456_009G226000                  63.2    1e-16   Gossypium raimondii
gb|AAL92850.1|  Aux/IAA protein                                       63.5    1e-16   Vitis vinifera
gb|KJB58781.1|  hypothetical protein B456_009G226000                  63.2    1e-16   Gossypium raimondii
gb|AAB70005.1|  GH1 protein                                           57.8    1e-16   Glycine max [soybeans]
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...  65.1    2e-16   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                        65.5    3e-16   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)               65.5    4e-16   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like    62.0    6e-16   Glycine max [soybeans]
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like    60.8    7e-16   Prunus mume [ume]
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg           62.0    1e-15   Prunus persica
ref|XP_007225723.1|  hypothetical protein PRUPE_ppa006744mg           62.0    1e-15   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like               62.0    2e-15   Malus domestica [apple tree]
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg           62.0    2e-15   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                       65.1    2e-15   Jatropha curcas
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...  61.6    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like    60.8    3e-15   
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg           56.2    4e-15   Eutrema salsugineum [saltwater cress]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg           56.2    4e-15   Eutrema salsugineum [saltwater cress]
gb|KCW68554.1|  hypothetical protein EUGRSUZ_F02172                   54.7    4e-15   Eucalyptus grandis [rose gum]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                   57.8    4e-15   Gossypium arboreum [tree cotton]
gb|ACU23129.1|  unknown                                               57.8    5e-15   Glycine max [soybeans]
gb|AEI70507.1|  auxin-responsive protein                              58.2    5e-15   Gossypium hirsutum [American cotton]
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9         57.8    6e-15   Camelina sativa [gold-of-pleasure]
gb|KCW68553.1|  hypothetical protein EUGRSUZ_F02172                   54.3    6e-15   Eucalyptus grandis [rose gum]
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like    54.3    6e-15   Eucalyptus grandis [rose gum]
emb|CDY18679.1|  BnaA09g07160D                                        55.1    8e-15   Brassica napus [oilseed rape]
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9         57.8    9e-15   Glycine max [soybeans]
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...  60.1    1e-14   
gb|KJB64034.1|  hypothetical protein B456_010G031600                  58.5    1e-14   Gossypium raimondii
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...  60.1    1e-14   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    54.7    1e-14   Cicer arietinum [garbanzo]
gb|KJB64027.1|  hypothetical protein B456_010G031600                  57.8    2e-14   Gossypium raimondii
gb|KJB64033.1|  hypothetical protein B456_010G031600                  57.8    2e-14   Gossypium raimondii
gb|ADL70574.1|  indole-3-acetic acid inducible 9                      61.2    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001267710.1|  auxin-responsive protein IAA9-like               55.5    4e-14   Cucumis sativus [cucumbers]
gb|AFK38170.1|  unknown                                               58.5    4e-14   Lotus japonicus
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9         57.8    4e-14   Beta vulgaris subsp. vulgaris [field beet]
gb|AGV54485.1|  auxin-responsive protein                              62.8    5e-14   Phaseolus vulgaris [French bean]
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like    60.1    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  53.1    7e-14   Brassica rapa
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  52.8    8e-14   Brassica rapa
gb|KHN09036.1|  Auxin-responsive protein IAA8                         57.8    8e-14   Glycine soja [wild soybean]
gb|KDO81312.1|  hypothetical protein CISIN_1g017824mg                 55.8    1e-13   Citrus sinensis [apfelsine]
gb|KDO81311.1|  hypothetical protein CISIN_1g017824mg                 56.2    1e-13   Citrus sinensis [apfelsine]
ref|NP_001241389.1|  uncharacterized protein LOC100783314             55.8    1e-13   Glycine max [soybeans]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like    55.5    1e-13   Cucumis melo [Oriental melon]
emb|CAC84706.1|  aux/IAA protein                                      60.1    1e-13   Populus tremula x Populus tremuloides
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...  57.8    1e-13   Brassica rapa
gb|KHN08222.1|  Auxin-responsive protein IAA8                         55.8    1e-13   Glycine soja [wild soybean]
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...  58.2    1e-13   Brassica rapa
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                 55.8    1e-13   Citrus sinensis [apfelsine]
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                 55.8    2e-13   Citrus sinensis [apfelsine]
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg           55.1    3e-13   Citrus clementina [clementine]
gb|AFZ78618.1|  hypothetical protein                                  58.5    3e-13   Populus tomentosa [Chinese white poplar]
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg           55.1    3e-13   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like    61.2    3e-13   Nicotiana tomentosiformis
ref|XP_010104556.1|  Auxin-responsive protein IAA9                    58.2    3e-13   
emb|CAJ13716.1|  auxin induced protein                                55.1    3e-13   Capsicum chinense [bonnet pepper]
emb|CDY08767.1|  BnaA06g24570D                                        56.6    3e-13   Brassica napus [oilseed rape]
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like    61.2    3e-13   Nicotiana sylvestris
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g           53.9    4e-13   Phaseolus vulgaris [French bean]
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...  55.8    1e-12   Citrus sinensis [apfelsine]
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...  58.9    1e-12   Fragaria vesca subsp. vesca
emb|CDP00957.1|  unnamed protein product                              50.1    2e-12   Coffea canephora [robusta coffee]
emb|CAD10639.1|  IAA9 protein                                         61.2    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_002302351.1|  auxin-responsive family protein                  58.5    2e-12   Populus trichocarpa [western balsam poplar]
gb|KHN04889.1|  Auxin-responsive protein IAA8                         57.4    3e-12   Glycine soja [wild soybean]
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like    59.7    3e-12   Populus euphratica
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8         57.8    3e-12   Tarenaya hassleriana [spider flower]
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like    61.6    3e-12   
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...  70.5    1e-11   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               52.0    2e-11   Medicago truncatula
gb|ABY48132.1|  GH1 protein                                           52.0    2e-11   Medicago truncatula
ref|NP_001237053.1|  uncharacterized protein LOC100500373             59.7    3e-11   
gb|AID60626.1|  auxin-responsive protein IAA8                         52.4    3e-11   Dimocarpus longan [longan]
gb|AFK49555.1|  unknown                                               50.8    8e-11   Medicago truncatula
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...  52.4    1e-10   Fragaria vesca subsp. vesca
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like    52.4    3e-10   Tarenaya hassleriana [spider flower]
gb|AFK38538.1|  unknown                                               45.4    6e-10   Lotus japonicus
emb|CBI19314.3|  unnamed protein product                              50.1    6e-10   Vitis vinifera
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like    49.3    7e-10   Cicer arietinum [garbanzo]
gb|AFK43616.1|  unknown                                               45.1    1e-09   Lotus japonicus
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like    53.1    1e-09   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAP94244.1|  auxin-responsive protein IAA homolog                 46.2    2e-09   Rubus grayanus
gb|EPS59988.1|  auxin-regulated protein                               53.5    3e-09   Genlisea aurea
emb|CAI77628.1|  Aux/IAA protein                                      46.6    3e-09   Solanum lycopersicum
dbj|BAP94262.1|  auxin-responsive protein IAA homolog                 45.8    3e-09   Rubus sp. MM-2014
dbj|BAP94276.1|  auxin-responsive protein IAA homolog                 45.8    3e-09   Rubus sp. MM-2014
ref|XP_003615390.1|  Auxin-responsive protein IAA5                    45.8    5e-09   Medicago truncatula
gb|KEH28135.1|  auxin response factor                                 45.4    6e-09   Medicago truncatula
gb|KJB71171.1|  hypothetical protein B456_011G109000                  62.8    2e-08   Gossypium raimondii
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8         45.8    2e-08   Camelina sativa [gold-of-pleasure]
gb|KJB71166.1|  hypothetical protein B456_011G109000                  62.8    3e-08   Gossypium raimondii
gb|KJB71165.1|  hypothetical protein B456_011G109000                  62.8    3e-08   Gossypium raimondii
gb|KJB71172.1|  hypothetical protein B456_011G109000                  62.8    3e-08   Gossypium raimondii
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like    45.8    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg           44.7    5e-08   Eutrema salsugineum [saltwater cress]
ref|XP_002878628.1|  indoleacetic acid-induced protein 8              43.9    1e-07   Arabidopsis lyrata subsp. lyrata
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      44.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189579.1|  auxin-responsive protein IAA8                    44.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70572.1|  indole-3-acetic acid inducible 8                      44.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      44.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      44.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      44.7    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70567.1|  indole-3-acetic acid inducible 8                      44.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70573.1|  indole-3-acetic acid inducible 8                      44.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      44.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      44.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850028.1|  auxin-responsive protein IAA8                       44.7    2e-07   
gb|ADL70569.1|  indole-3-acetic acid inducible 8                      44.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179852.1|  auxin-responsive protein IAA8                       44.7    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70571.1|  indole-3-acetic acid inducible 8                      44.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29390.2|  indole-3-acetic acid inducible 8                      44.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70570.1|  indole-3-acetic acid inducible 8                      44.3    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg           42.0    2e-07   
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg           42.0    2e-07   
gb|ADL70562.1|  indole-3-acetic acid inducible 8                      43.9    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29389.2|  indole-3-acetic acid inducible 8                      43.9    3e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      42.4    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010463453.1|  PREDICTED: auxin-responsive protein IAA9-lik...  43.5    9e-07   Camelina sativa [gold-of-pleasure]
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      41.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29392.2|  indole-3-acetic acid inducible 8                      41.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like    40.8    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDY66936.1|  BnaC02g47310D                                        42.0    2e-06   Brassica napus [oilseed rape]
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540        44.7    3e-06   Amborella trichopoda
emb|CDY45607.1|  BnaCnng13150D                                        57.0    3e-06   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8         43.1    1e-05   Brassica rapa
gb|AAM76222.1|  putative IAA-responsive protein 9                     50.8    4e-05   Gossypium hirsutum [American cotton]
gb|AAM76220.1|  putative IAA-responsive protein 9                     50.8    4e-05   Gossypium herbaceum [Arabian cotton]
emb|CDY25617.1|  BnaA04g13090D                                        40.8    6e-05   Brassica napus [oilseed rape]
emb|CDX89499.1|  BnaC04g35180D                                        40.4    8e-05   
gb|AAM76223.1|  putative IAA-responsive protein 9                     50.1    9e-05   Gossypium hirsutum [American cotton]
gb|AAM76221.1|  putative IAA-responsive protein 9                     48.9    3e-04   Gossypium raimondii
gb|AAM76224.1|  putative IAA-responsive protein 9                     48.1    4e-04   Gossypioides kirkii
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...  49.7    9e-04   Tarenaya hassleriana [spider flower]



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score = 89.4 bits (220),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 53/76 (70%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMFTI  614
            S+GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+G      SV TE NWMF  
Sbjct  92   SSGKLDEKPLFPLLPSKDGICSSSQKNVVSGNKRGFADTMDGYSEVKSSVYTEGNWMFHA  151

Query  615  PKSDSHTPQSAGQGNF  662
              SDS +P+S GQG F
Sbjct  152  AGSDSESPESVGQGKF  167


 Score = 79.0 bits (193),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 70/88 (80%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K++LN +ATELRLGLPGSQ+P+R+ ++
Sbjct  61   KKNKLNFQATELRLGLPGSQTPEREPDL  88



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score = 87.8 bits (216),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 52/76 (68%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMFTI  614
            S+GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+G      +V TE NWMF  
Sbjct  92   SSGKLDEKPLFPLLPSKDGICSSSQKNVVSGNKRGFADTMDGFSEVKSAVYTEGNWMFHA  151

Query  615  PKSDSHTPQSAGQGNF  662
              SDS  P+S GQG F
Sbjct  152  AGSDSEAPESVGQGKF  167


 Score = 79.3 bits (194),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 67/84 (80%), Gaps = 4/84 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKR  438
             K++LN +ATELRLGLPGSQSP+R
Sbjct  61   KKNKLNFQATELRLGLPGSQSPER  84



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score = 82.8 bits (203),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 66/87 (76%), Gaps = 3/87 (3%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG   EGQGN SVMASS ++DC+S  G  LKERNYLGLSDSS   +S ++    +
Sbjct  1    MSPPLLGIEGEGQGNVSVMASSKSVDCVSNNGLGLKERNYLGLSDSSEESTSMSTVSKEK  60

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKAT+LRLGLPGSQSP+R+ E+
Sbjct  61   KSSLNLKATDLRLGLPGSQSPERESEL  87


 Score = 78.2 bits (191),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 52/80 (65%), Gaps = 7/80 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            S+ KFDEKPLFPLLPSKDGI SS+ K+  +GNKR F DT++       S   E NWMF+ 
Sbjct  91   SSDKFDEKPLFPLLPSKDGICSSIHKSVVSGNKRVFSDTIDEYSTVKASTFNERNWMFSA  150

Query  615  PKSDSHTPQSAGQGNFGSSA  674
              S+S T QS GQG F   A
Sbjct  151  AGSNSETHQSIGQGKFSGKA  170



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score = 84.0 bits (206),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 8/75 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------SVTTEANWMFTIP  617
            ++GK DEKPLFPLLPSKDGI SS + +  GNKRGF DTM+G      +  TE NWMF   
Sbjct  92   NSGKLDEKPLFPLLPSKDGICSSSQKN--GNKRGFADTMDGFSEVKSNAYTEGNWMFHAA  149

Query  618  KSDSHTPQSAGQGNF  662
             SDS +P+S GQG F
Sbjct  150  GSDSESPESVGQGKF  164


 Score = 77.0 bits (188),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvVN  366
            MSP +LG   EGQ NGS++A S ++DCIS  GS LKERNYLGLSD SS   S+ ++    
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LN KATELRLGLPGSQSP+R+ ++
Sbjct  61   TKNNLNFKATELRLGLPGSQSPEREPDL  88



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score = 84.0 bits (206),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 52/75 (69%), Gaps = 8/75 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------SVTTEANWMFTIP  617
            ++GK DEKPLFPLLPSKDGI SS + +  GNKRGF DTM+G      +  TE NWMF   
Sbjct  92   NSGKLDEKPLFPLLPSKDGICSSSQKN--GNKRGFADTMDGFSEVKSNAYTEGNWMFHAA  149

Query  618  KSDSHTPQSAGQGNF  662
             SDS +P+S GQG F
Sbjct  150  GSDSESPESVGQGKF  164


 Score = 75.9 bits (185),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvVN  366
            MSP +LG   EGQ NGS++A S ++DCISQ  S LKERNYLGLSD SS   S+ ++    
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISQNSSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LN KATELRLGLPGSQSP+R+ ++
Sbjct  61   TKNNLNFKATELRLGLPGSQSPEREPDL  88



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score = 79.7 bits (195),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            STGK DEKPLFPLLP KDGI  SS K   +GNKRGF DTM+      GSV +E NW+F  
Sbjct  92   STGKLDEKPLFPLLPLKDGICSSSQKHVVSGNKRGFSDTMDGFSEVKGSVYSEKNWLFHS  151

Query  615  PKSDSHTPQSAGQGNF  662
              +D+ + QS GQG F
Sbjct  152  AGTDTDSLQSLGQGKF  167


 Score = 75.9 bits (185),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG   EG+ N S++ASS ++DCISQ G  L ERNYLGLSD SSVDSSA   +  E
Sbjct  1    MSPPLLGVEEEGENNVSLVASSPSIDCISQNGCGLTERNYLGLSDCSSVDSSAVPSLSKE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LNLKATELRLGLPGSQSP+R+ ++
Sbjct  61   TKNNLNLKATELRLGLPGSQSPERETDV  88



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score = 82.4 bits (202),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 8/76 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            S+GK DEKPLFPLLPSKDGI   S K   +GNKRGF DTM+       SV TE NWMF++
Sbjct  92   SSGKLDEKPLFPLLPSKDGICPGSQKNVVSGNKRGFSDTMDRFSEVKSSVYTEKNWMFSV  151

Query  615  PKSDSHTPQSAGQGNF  662
               DS +PQS GQG F
Sbjct  152  -GPDSESPQSVGQGKF  166


 Score = 69.3 bits (168),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +1

Query  196  MMSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvV  363
            M  P +LG   EGQ N S+MASS + DCISQ  S L+ERNYLGLSD SS   S+A+S  V
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            + K++LNLKATELRLGLPGS+SP+R+ ++
Sbjct  60   DNKNKLNLKATELRLGLPGSESPEREPDL  88



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score = 82.4 bits (202),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 52/76 (68%), Gaps = 8/76 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            S+GK DEKPLFPLLPSKDGI   S K   +GNKRGF DTM+       SV TE NWMF++
Sbjct  92   SSGKLDEKPLFPLLPSKDGICPGSQKNVVSGNKRGFSDTMDRFSEVKSSVYTEKNWMFSV  151

Query  615  PKSDSHTPQSAGQGNF  662
               DS +PQS GQG F
Sbjct  152  -GPDSESPQSVGQGKF  166


 Score = 69.3 bits (168),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 5/89 (6%)
 Frame = +1

Query  196  MMSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvV  363
            M  P +LG   EGQ N S+MASS + DCISQ  S L+ERNYLGLSD SS   S+A+S  V
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            + K++LNLKATELRLGLPGS+SP+R+ ++
Sbjct  60   DNKNKLNLKATELRLGLPGSESPEREPDL  88



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score = 82.0 bits (201),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI+ SS KA  TGNKRGF D M+       +V TE NWMF    
Sbjct  114  GKLDEKPLFPLLPSKDGIYSSSQKAVVTGNKRGFSDAMDNFSEVKSAVFTEGNWMFPTVG  173

Query  621  SDSHTPQSAGQGNF  662
            SDS T QS  QG F
Sbjct  174  SDSETSQSKPQGKF  187


 Score = 62.8 bits (151),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +1

Query  160  SRLRDELEFLYDMMSPTILGEGQGNGSVMASSSTLDCIS-QTGSALKERNYlglsdsssv  336
            SRL  +L    ++MSP +LG G+G  +V   SS     S Q GS LKERNY+GLSD SSV
Sbjct  10   SRLGGKLLSSGNLMSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSV  69

Query  337  dssaasgvVNE-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            DSSA SG+  E K  LNLKATELRLGLPGSQSP+RD E+
Sbjct  70   DSSAISGLAEENKSSLNLKATELRLGLPGSQSPERDPEL  108



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 76.6 bits (187),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 2/86 (2%)
 Frame = +1

Query  199  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-K  372
            MSP +LG E +G+ S++ASS T+DCISQ GS LKE NYLGLSD SSVDSSA S +  E K
Sbjct  1    MSPPLLGGEEEGHSSLVASSPTIDCISQNGSGLKEWNYLGLSDCSSVDSSAVSSLSEENK  60

Query  373  DRLNLKATELRLGLPGSQSPKRDLEM  450
            + LN KATELRLGLPGSQSP+R+ E+
Sbjct  61   NNLNFKATELRLGLPGSQSPEREPEL  86


 Score = 67.8 bits (164),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 45/73 (62%), Gaps = 8/73 (11%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFLDTMEG------SVTTEANWMFTIPKS  623
            K DEK LFPLLPSKDGI SS + +   GNKRGF DTM+G      SV  E NW +T   S
Sbjct  93   KLDEKQLFPLLPSKDGICSSSQKNVVLGNKRGFSDTMDGFSEVKTSVYGEGNWRYTA-GS  151

Query  624  DSHTPQSAGQGNF  662
            D  +PQS  QG  
Sbjct  152  DPDSPQSVAQGKI  164



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score = 80.5 bits (197),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            ++GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+      GSV TE  WMF  
Sbjct  88   NSGKLDEKPLFPLLPSKDGICSSSQKTVVSGNKRGFSDTMDGFSEVKGSVYTEKIWMFPG  147

Query  615  PKSDSHTPQSAGQGNF  662
              SDS +PQ+ G G +
Sbjct  148  AGSDSESPQTVGHGKY  163


 Score = 63.2 bits (152),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 8/88 (9%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LNLKATELRLGLPGSQSP+R+ E+
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPEL  84



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score = 80.5 bits (197),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            ++GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+      GSV TE  WMF  
Sbjct  88   NSGKLDEKPLFPLLPSKDGICSSSQKTVVSGNKRGFSDTMDGFSEVKGSVYTEKIWMFPG  147

Query  615  PKSDSHTPQSAGQGNF  662
              SDS +PQ+ G G +
Sbjct  148  AGSDSESPQTVGHGKY  163


 Score = 63.2 bits (152),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 8/88 (9%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LNLKATELRLGLPGSQSP+R+ E+
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPEL  84



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score = 80.5 bits (197),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            ++GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+      GSV TE  WMF  
Sbjct  88   NSGKLDEKPLFPLLPSKDGICSSSQKTVVSGNKRGFSDTMDGFSEVKGSVYTEKIWMFPG  147

Query  615  PKSDSHTPQSAGQGNF  662
              SDS +PQ+ G G +
Sbjct  148  AGSDSESPQTVGHGKY  163


 Score = 63.2 bits (152),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 8/88 (9%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LNLKATELRLGLPGSQSP+R+ E+
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPEL  84



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score = 82.0 bits (201),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI+ SS KA  TGNKRGF D M+       +V TE NWMF    
Sbjct  113  GKLDEKPLFPLLPSKDGIYSSSQKAVVTGNKRGFSDAMDNFSEVKSAVFTEGNWMFPTVG  172

Query  621  SDSHTPQSAGQGNF  662
            SDS T QS  QG F
Sbjct  173  SDSETSQSKPQGKF  186


 Score = 61.2 bits (147),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 65/88 (74%), Gaps = 2/88 (2%)
 Frame = +1

Query  193  DMMSPTILGEGQGNGSVMASSSTLDCIS-QTGSALKERNYlglsdsssvdssaasgvVNE  369
            ++MSP +LG G+G  +V   SS     S Q GS LKERNY+GLSD SSVDSSA SG+  E
Sbjct  20   NLMSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEE  79

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K  LNLKATELRLGLPGSQSP+RD E+
Sbjct  80   NKSSLNLKATELRLGLPGSQSPERDPEL  107



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score = 75.1 bits (183),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 47/73 (64%), Gaps = 8/73 (11%)
 Frame = +3

Query  468  FDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMF-TIPKS  623
             DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+G      SV  E  WMF     S
Sbjct  91   LDEKPLFPLLPSKDGICSSSQKNVVSGNKRGFSDTMDGFSEVKSSVYNEGKWMFPAAAGS  150

Query  624  DSHTPQSAGQGNF  662
            DS +P+S GQG F
Sbjct  151  DSESPESVGQGKF  163


 Score = 67.4 bits (163),  Expect(2) = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG   EG+ NGS++A S +++ I Q  S LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEGEGKSNGSMVACSPSMEMIPQNSSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K + N KATELRLGLPGSQSP+R  E+
Sbjct  61   NKSKFNFKATELRLGLPGSQSPERQSEL  88



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score = 82.0 bits (201),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI+ SS KA  TGNKRGF D M+       +V TE NWMF    
Sbjct  92   GKLDEKPLFPLLPSKDGIYSSSQKAVVTGNKRGFSDAMDNFSEVKSAVFTEGNWMFPTVG  151

Query  621  SDSHTPQSAGQGNF  662
            SDS T QS  QG F
Sbjct  152  SDSETSQSKPQGKF  165


 Score = 60.1 bits (144),  Expect(2) = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 63/86 (73%), Gaps = 2/86 (2%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCIS-QTGSALKERNYlglsdsssvdssaasgvVNE-K  372
            MSP +LG G+G  +V   SS     S Q GS LKERNY+GLSD SSVDSSA SG+  E K
Sbjct  1    MSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEENK  60

Query  373  DRLNLKATELRLGLPGSQSPKRDLEM  450
              LNLKATELRLGLPGSQSP+RD E+
Sbjct  61   SSLNLKATELRLGLPGSQSPERDPEL  86



>ref|XP_008357957.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA9-like 
[Malus domestica]
Length=216

 Score = 79.7 bits (195),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 49/76 (64%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            S+GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+       S  T   WMF  
Sbjct  85   SSGKLDEKPLFPLLPSKDGIXSSSQKDGVSGNKRGFADTMDRFSEVKSSAYTXKEWMFHA  144

Query  615  PKSDSHTPQSAGQGNF  662
              SDS +P+S GQG F
Sbjct  145  AGSDSESPESVGQGKF  160


 Score = 55.5 bits (132),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 54/88 (61%), Gaps = 11/88 (13%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvVN  366
            MSP + G   EG+ NGS       +DCIS  GS LKE NY GLSD SS   S  ++    
Sbjct  1    MSPPLXGGEEEGKSNGS-------MDCISHNGSGLKELNYHGLSDCSSVNSSXVSNLSEG  53

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
             K+ LN KA ELRLGLP SQSP+R+ ++
Sbjct  54   NKNNLNFKAPELRLGLPASQSPERESDL  81



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score = 81.6 bits (200),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI  SS K   TGNKRGF DTM+      G V TE +WMF    
Sbjct  83   GKLDEKPLFPLLPSKDGICSSSQKNVVTGNKRGFSDTMDGFSEVKGYVYTEKSWMFHEAG  142

Query  621  SDSHTPQSAGQGNF  662
            SDS +PQS G G +
Sbjct  143  SDSESPQSVGHGKY  156


 Score = 53.5 bits (127),  Expect(2) = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 7/84 (8%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDS            
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDS------SGVSSN  53

Query  379  LNLKATELRLGLPGSQSPKRDLEM  450
            LNLKATELRLGLPGSQSP+R+ E+
Sbjct  54   LNLKATELRLGLPGSQSPERETEL  77



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score = 82.0 bits (201),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI  SS K   TGNKRGF DTM+      G V TE +WMF    
Sbjct  83   GKLDEKPLFPLLPSKDGICSSSQKNVVTGNKRGFSDTMDGFSEVKGYVYTEKSWMFHEAG  142

Query  621  SDSHTPQSAGQGNF  662
            SDS +PQS G G +
Sbjct  143  SDSESPQSVGHGKY  156


 Score = 52.8 bits (125),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 58/84 (69%), Gaps = 7/84 (8%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS  S        
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSSGVSS------N  53

Query  379  LNLKATELRLGLPGSQSPKRDLEM  450
            LNLKATELRLGLPGSQSP+R+ E+
Sbjct  54   LNLKATELRLGLPGSQSPERETEL  77



>gb|KJB18142.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=296

 Score = 82.0 bits (201),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI  SS K   TGNKRGF DTM+      G V TE +WMF    
Sbjct  83   GKLDEKPLFPLLPSKDGICSSSQKNVVTGNKRGFSDTMDGFSEVKGYVYTEKSWMFHEAG  142

Query  621  SDSHTPQSAGQGNF  662
            SDS +PQS G G +
Sbjct  143  SDSESPQSVGHGKY  156


 Score = 52.8 bits (125),  Expect(2) = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 57/84 (68%), Gaps = 7/84 (8%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSSG------VSSN  53

Query  379  LNLKATELRLGLPGSQSPKRDLEM  450
            LNLKATELRLGLPGSQSP+R+ E+
Sbjct  54   LNLKATELRLGLPGSQSPERETEL  77



>gb|KJB18143.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=255

 Score = 81.6 bits (200),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI  SS K   TGNKRGF DTM+      G V TE +WMF    
Sbjct  83   GKLDEKPLFPLLPSKDGICSSSQKNVVTGNKRGFSDTMDGFSEVKGYVYTEKSWMFHEAG  142

Query  621  SDSHTPQSAGQGNF  662
            SDS +PQS G G +
Sbjct  143  SDSESPQSVGHGKY  156


 Score = 52.8 bits (125),  Expect(2) = 7e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 57/84 (68%), Gaps = 7/84 (8%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSSG------VSSN  53

Query  379  LNLKATELRLGLPGSQSPKRDLEM  450
            LNLKATELRLGLPGSQSP+R+ E+
Sbjct  54   LNLKATELRLGLPGSQSPERETEL  77



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score = 71.2 bits (173),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 49/77 (64%), Gaps = 9/77 (12%)
 Frame = +3

Query  459  TGKFDEKPLFPLLPSKD--GIFS-SVKASFTGNKRGFLDTME------GSVTTEANWMFT  611
            +GK DEKPLFPLLP KD  GI S   K   +GNKRGF DTM+      GS  +E NW+F 
Sbjct  93   SGKLDEKPLFPLLPLKDGHGICSLPQKHVVSGNKRGFSDTMDGFSEVKGSAYSEKNWLFH  152

Query  612  IPKSDSHTPQSAGQGNF  662
               ++S +PQS GQG F
Sbjct  153  SAGTESDSPQSVGQGKF  169


 Score = 62.0 bits (149),  Expect(2) = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgvVN  366
            MSP +LG    GQ   S++ASS ++DCISQ G  LKERNYLGLSD SS   S+  S    
Sbjct  1    MSPPLLGVEDGGQSKVSLVASSPSVDCISQNGCRLKERNYLGLSDCSSVDSSAVPSLSEE  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
              + LNLKATELRLGLPGS SP+RD E+
Sbjct  61   NNNNLNLKATELRLGLPGSLSPERDTEV  88



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score = 72.0 bits (175),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 4/85 (5%)
 Frame = +1

Query  199  MSPTILG-EGQG--NGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG EGQ   N S+MASS+++D +SQ G  LKERNYLGLSD SSVDSS  S V  E
Sbjct  1    MSPPLLGVEGQDQCNVSLMASSASVDTVSQNGLGLKERNYLGLSDCSSVDSSGVSSVPEE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRD  441
             K+ LNLKATELRLGLPGSQSP+RD
Sbjct  61   NKNNLNLKATELRLGLPGSQSPERD  85


 Score = 60.1 bits (144),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 7/65 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEG------SVTTEANWMFTI  614
            S+ K DEK LFPL+PSKDGI   S K   +GNKRGF DT++G      ++ TE NW+F  
Sbjct  92   SSVKLDEKQLFPLVPSKDGICLLSPKTVVSGNKRGFADTVDGFLESKSTIFTEGNWIFNA  151

Query  615  PKSDS  629
              SD+
Sbjct  152  AGSDT  156



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score = 75.9 bits (185),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 72/95 (76%), Gaps = 6/95 (6%)
 Frame = +1

Query  184  FLYDMMSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssa  348
             ++++MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS 
Sbjct  4    HIWNLMSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSST  63

Query  349  asgvVNEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
               + +EK + LNLKATELRLGLPGSQSP+RDL++
Sbjct  64   VPSLSDEKKENLNLKATELRLGLPGSQSPERDLDL  98


 Score = 55.1 bits (131),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            K DEKPLFPLLP+KDGI S S K   +GNKRGF DT+E
Sbjct  105  KLDEKPLFPLLPTKDGICSLSQKTVVSGNKRGFADTLE  142



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score = 83.6 bits (205),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 50/76 (66%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG------SVTTEANWMFTI  614
            S GK DEKPLFPLLPSKDGI  SS KA  +GNKRGF D M+G      +V TE NWMF  
Sbjct  91   SPGKLDEKPLFPLLPSKDGICSSSQKAVVSGNKRGFSDAMDGFSEMKSAVFTEGNWMFPA  150

Query  615  PKSDSHTPQSAGQGNF  662
              SDS T QS  QG F
Sbjct  151  AGSDSETTQSVAQGKF  166


 Score = 47.4 bits (111),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 3/87 (3%)
 Frame = +1

Query  199  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  369
            MSP +L   E   N +++ SS ++D   Q  S L+ERNY+GLSD SSVDSSA SG+  E 
Sbjct  1    MSPPLLNVVERPSNVTLVPSSPSVDSSCQNVSGLRERNYMGLSDCSSVDSSAISGLSEEN  60

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   KSSLNLKATELRLGLPGSQSPERGSEL  87



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score = 82.0 bits (201),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTIPK  620
            GK DEKPLFPLLPSKDGI  SS K   TGNKRGF DTM+      G V TE +WMF    
Sbjct  82   GKLDEKPLFPLLPSKDGICSSSQKNVVTGNKRGFSDTMDGFSEVKGYVYTEKSWMFHEAG  141

Query  621  SDSHTPQSAGQGNF  662
            SDS +PQS G G +
Sbjct  142  SDSESPQSVGHGKY  155


 Score = 46.2 bits (108),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 54/84 (64%), Gaps = 8/84 (10%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDS            
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGMGLKERNYLGLSDCSSVDS------SGVSSN  53

Query  379  LNLKATELRLGLPGSQSPKRDLEM  450
            LNL ATELRLGLPGSQSP+R+ E 
Sbjct  54   LNL-ATELRLGLPGSQSPERETEF  76



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score = 67.0 bits (162),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +L    E  GN  V+A+S ++DC SQ G+  +ERNYL LS  SSVDSSA S +  E
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K  LNLKATELRLGLPGS SP+RD E 
Sbjct  61   NKSNLNLKATELRLGLPGSLSPERDQEF  88


 Score = 60.8 bits (146),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEGS------VTTEANWMFTI  614
            S+G+ DEK L  LLPS DG   +S K    G+KRGF DTMEG       + TE NWMF  
Sbjct  92   SSGEPDEKTLLQLLPSTDGYSVASQKNIIAGSKRGFSDTMEGYSEVKGPLYTERNWMFHA  151

Query  615  PKSDSHTPQSAGQGNFGSSA  674
              SD  +P    QG F +S+
Sbjct  152  ASSDPESPYPVSQGKFHASS  171



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score = 72.4 bits (176),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  364  NEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
            +EK + LNLKATELRLGLPGSQSP+RDL++
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDLDL  90


 Score = 55.1 bits (131),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            K DEKPLFPLLP+KDGI S S K   +GNKRGF DT+E
Sbjct  97   KLDEKPLFPLLPTKDGICSLSQKTVVSGNKRGFADTLE  134



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score = 72.0 bits (175),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 68/90 (76%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  364  NEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
            +EK + LNLKATELRLGLPGSQSP+RDL++
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDLDL  90


 Score = 55.1 bits (131),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            K DEKPLFPLLP+KDGI S S K   +GNKRGF DT+E
Sbjct  97   KLDEKPLFPLLPTKDGICSLSQKTVVSGNKRGFADTLE  134



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score = 80.5 bits (197),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 7/76 (9%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            ++GK DEKPLFPLLPSKDGI  SS K   +GNKRGF DTM+      GSV TE  WMF  
Sbjct  57   NSGKLDEKPLFPLLPSKDGICSSSQKTVVSGNKRGFSDTMDGFSEVKGSVYTEKIWMFPG  116

Query  615  PKSDSHTPQSAGQGNF  662
              SDS +PQ+ G G +
Sbjct  117  AGSDSESPQTVGHGKY  132


 Score = 45.8 bits (107),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            + K+ LNLKATELRLGLPGSQSP+R+ E+
Sbjct  25   DNKNNLNLKATELRLGLPGSQSPEREPEL  53



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score = 71.2 bits (173),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    E Q N S +AS+S  +LDC SQ G+ LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  364  NEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
            +EK + LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDPDL  90


 Score = 55.1 bits (131),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPLLP+KDGI S S K   +GNKRGF D M+G
Sbjct  94   SSTKLDEKPLFPLLPTKDGICSLSQKNVVSGNKRGFSDAMDG  135



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score = 65.1 bits (157),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS--VKASFTGNKRGFLDT------MEGSVTTEANWMFT  611
            S+GK DEKPLFPLLP KDGI SS   K   +GNKRGF DT      ++ S   + NWMF 
Sbjct  91   SSGKLDEKPLFPLLPLKDGICSSSLQKNIASGNKRGFSDTIDEFSELKSSKYPDGNWMFH  150

Query  612  IPKSDSHTPQSAGQGNFGSSA  674
                   T Q  GQG F  +A
Sbjct  151  ATGPAPETAQCGGQGKFPGNA  171


 Score = 60.8 bits (146),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +1

Query  199  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  369
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATEL LGLPGSQSP+R+ ++
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKL  87



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score = 65.1 bits (157),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS--VKASFTGNKRGFLDT------MEGSVTTEANWMFT  611
            S+GK DEKPLFPLLP KDGI SS   K   +GNKRGF DT      ++ S   + NWMF 
Sbjct  91   SSGKLDEKPLFPLLPLKDGICSSSLQKNIASGNKRGFSDTIDEFSELKSSKYPDGNWMFH  150

Query  612  IPKSDSHTPQSAGQGNFGSSA  674
                   T Q  GQG F  +A
Sbjct  151  ATGPAPETAQCGGQGKFPGNA  171


 Score = 60.8 bits (146),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +1

Query  199  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  369
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATEL LGLPGSQSP+R+ ++
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKL  87



>gb|KCW59655.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=345

 Score = 65.1 bits (157),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 46/81 (57%), Gaps = 8/81 (10%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS--VKASFTGNKRGFLDT------MEGSVTTEANWMFT  611
            S+GK DEKPLFPLLP KDGI SS   K   +GNKRGF DT      ++ S   + NWMF 
Sbjct  91   SSGKLDEKPLFPLLPLKDGICSSSLQKNIASGNKRGFSDTIDEFSELKSSKYPDGNWMFH  150

Query  612  IPKSDSHTPQSAGQGNFGSSA  674
                   T Q  GQG F  +A
Sbjct  151  ATGPAPETAQCGGQGKFPGNA  171


 Score = 60.8 bits (146),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 64/87 (74%), Gaps = 3/87 (3%)
 Frame = +1

Query  199  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  369
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATEL LGLPGSQSP+R+ ++
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKL  87



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score = 68.9 bits (167),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    EGQ N S++AS+S+  ++C S   +  KERNYLG SD SSV+SS    + 
Sbjct  1    MSPPLLVTEDEGQSNASMVASASSPSMECFSPHEARFKERNYLGFSDCSSVESSTVPSLS  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            NEK  LNLKATELRLGLPGSQSP+R+ ++
Sbjct  61   NEKKNLNLKATELRLGLPGSQSPERNPDL  89


 Score = 57.0 bits (136),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            ++ K DEKPLFPLLP+KDGIF+ S K   +GNKRGF DTM+
Sbjct  93   TSSKLDEKPLFPLLPTKDGIFALSQKTVVSGNKRGFADTMD  133



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score = 77.0 bits (188),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP ++G   EGQ N +V+ASS++ + I Q GS LKERNY+GLSD SSVDSS A    +E
Sbjct  1    MSPPLIGVVEEGQSNVTVLASSTSAESICQNGSKLKERNYMGLSDCSSVDSSIAPSSSDE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K RLNLKATELRLGLPGSQSP+R+ E+
Sbjct  61   SKTRLNLKATELRLGLPGSQSPQRNSEL  88


 Score = 48.1 bits (113),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMEG  578
            +FDEKP FPL PS DG +SS  K   +GNKRGF D M+G
Sbjct  95   QFDEKPFFPLNPSNDGHYSSTQKNVVSGNKRGFSDAMDG  133



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score = 63.5 bits (153),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEGSVTTEANWM--FTIPKSD  626
            ++GK DEK LFPLLPSKDGI  SS K+  TGNKRGF + ++G++ TE  WM    +P S 
Sbjct  85   NSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNKRGFSE-VKGTIYTEKKWMGHGAVPDSQ  143

Query  627  SHTPQSAGQ  653
            S  P S G+
Sbjct  144  SLQPVSHGK  152


 Score = 60.8 bits (146),  Expect(2) = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 5/84 (6%)
 Frame = +1

Query  199  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKD  375
            MSP +LG E +G   V  SS +++CISQ G  ++ERNYLGLSD  SVDSS      +  +
Sbjct  1    MSPPLLGVEEEGQSRV--SSPSVECISQNGLGIRERNYLGLSDFCSVDSSGVPD--DNGN  56

Query  376  RLNLKATELRLGLPGSQSPKRDLE  447
             LNLKATELRLGLPGSQSP+R+ E
Sbjct  57   NLNLKATELRLGLPGSQSPERETE  80



>gb|ACU19961.1| unknown [Glycine max]
Length=235

 Score = 64.7 bits (156),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +1

Query  196  MMSPTILGEGQGNGSVMASSS-TLDCISQTGSALKERNYlglsdsssvdssaasgvV---  363
            M  PT++ E +G  +V + SS +LDC SQ G+ LKERNYLGLSD SSVDS A++      
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             +K+ +NLKATELRLGLPG QSP+R+ ++
Sbjct  61   EKKENMNLKATELRLGLPGFQSPEREPDL  89


 Score = 60.1 bits (144),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS-VKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPLLP+KDGI SS  KA  +GNKRGF DTM+G
Sbjct  93   SSPKLDEKPLFPLLPTKDGICSSGQKAVVSGNKRGFADTMDG  134



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score = 64.7 bits (156),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 4/89 (4%)
 Frame = +1

Query  196  MMSPTILGEGQGNGSVMASSS-TLDCISQTGSALKERNYlglsdsssvdssaasgvV---  363
            M  PT++ E +G  +V + SS +LDC SQ G+ LKERNYLGLSD SSVDS A++      
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             +K+ +NLKATELRLGLPG QSP+R+ ++
Sbjct  61   EKKENMNLKATELRLGLPGFQSPEREPDL  89


 Score = 59.7 bits (143),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS-VKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPLLP+KDGI SS  KA  +GNKRGF DTM+G
Sbjct  93   SSPKLDEKPLFPLLPTKDGICSSGQKAVVSGNKRGFADTMDG  134



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score = 64.7 bits (156),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN-  366
            M P +LG   +G GN S+M S+ST++ I Q  + L ERNYLGLSD SS DS+A SG+   
Sbjct  1    MPPPLLGVEGDGLGNVSLMTSASTMESIFQKNAELTERNYLGLSDCSSFDSTAVSGISEV  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
            +++ LNLKATELRLGLPGSQSP+RD+++
Sbjct  61   KRNNLNLKATELRLGLPGSQSPERDVDV  88


 Score = 57.8 bits (138),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 6/68 (9%)
 Frame = +3

Query  468  FDEKPLFPLLPSKDGIFSSVKASF-TGNKRGFLDTMEGSVTTEANWMFTIPKSDSHTPQS  644
             DEKPLFPLLPSKDGI S+ +  F +GNKRGF D ++     E  WMF    +DS T   
Sbjct  96   LDEKPLFPLLPSKDGICSNSQKVFVSGNKRGFSDAID-----EGKWMFGSSGTDSETSNM  150

Query  645  AGQGNFGS  668
             G+ + G+
Sbjct  151  NGKISSGA  158



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 ref|XP_004160925.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score = 67.4 bits (163),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +L    E  GN  V+A+S ++DC SQ G+  +ERNYL LS  SSVDSSA S +  E
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  370  -KDRLNLKATELRLGLPGSQSPKRDLEM  450
             K  LNLKATELRLGLPGS SP+RD E 
Sbjct  61   NKSNLNLKATELRLGLPGSLSPERDQEF  88


 Score = 53.9 bits (128),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASF-TGNKRGFLDTMEGS------VTTEANWMFTIPKSDS  629
            DEK L  LLPS DG   S++ +  +G+KR F DTMEG       + TE NWMF    SD 
Sbjct  97   DEKTLLQLLPSTDGYSVSLQKNIVSGSKRVFSDTMEGYSEVKGPLYTERNWMFHAASSDP  156

Query  630  HTPQSAGQGNFGSSA  674
             +P    QG F +++
Sbjct  157  ESPYPVSQGKFHANS  171



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score = 72.8 bits (177),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  363
            MSP +LG     Q N S MASSS+ DC+SQ  S LKERNYLGLSD SSVDSS     V  
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            + K  LNLKATELRLGLPGS SP R+ E 
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEF  89


 Score = 48.1 bits (113),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 6/37 (16%)
 Frame = +3

Query  468  FDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             DEK LFPL+PSKDGIFSS      GNKRGF DT+  
Sbjct  93   IDEKQLFPLIPSKDGIFSS------GNKRGFADTVNA  123



>ref|XP_010547581.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score = 65.1 bits (157),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 47/78 (60%), Gaps = 12/78 (15%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  ++GK DEKPLFPL PSKDGI S S K S TGNKRGF DTM+       S  TE +WM
Sbjct  89   NTLTSGKLDEKPLFPLAPSKDGICSQSQKNSGTGNKRGFSDTMDQFAEVKSSEFTEKSWM  148

Query  606  F-----TIPKSDSHTPQS  644
            F     T P +    PQS
Sbjct  149  FHGTGTTQPVTRKEAPQS  166


 Score = 56.2 bits (134),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-N  366
            MSP +     E Q N SV +SS T +C+S+  S  KE NYLGLS+ SSV SS   G+  +
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
            +K+ ++LKATELRLGLPGSQSP+R+ + 
Sbjct  61   DKNSISLKATELRLGLPGSQSPERETDF  88



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score = 72.4 bits (176),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  363
            MSP +LG     Q N S MASSS+ DC+SQ  S LKERNYLGLSD SSVDSS     V  
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            + K  LNLKATELRLGLPGS SP R+ E 
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEF  89


 Score = 48.1 bits (113),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 6/37 (16%)
 Frame = +3

Query  468  FDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             DEK LFPL+PSKDGIFSS      GNKRGF DT+  
Sbjct  93   IDEKQLFPLIPSKDGIFSS------GNKRGFADTVNA  123



>ref|XP_010547580.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score = 64.7 bits (156),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 47/78 (60%), Gaps = 12/78 (15%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  ++GK DEKPLFPL PSKDGI S S K S TGNKRGF DTM+       S  TE +WM
Sbjct  89   NTLTSGKLDEKPLFPLAPSKDGICSQSQKNSGTGNKRGFSDTMDQFAEVKSSEFTEKSWM  148

Query  606  F-----TIPKSDSHTPQS  644
            F     T P +    PQS
Sbjct  149  FHGTGTTQPVTRKEAPQS  166


 Score = 55.8 bits (133),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-N  366
            MSP +     E Q N SV +SS T +C+S+  S  KE NYLGLS+ SSV SS   G+  +
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
            +K+ ++LKATELRLGLPGSQSP+R+ + 
Sbjct  61   DKNSISLKATELRLGLPGSQSPERETDF  88



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score = 62.0 bits (149),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------SVTTEANWMFTIP  617
            S  K DEK LFPL+PSKDGI  S K   +GNKRGF DT++G      +V  + +WMF   
Sbjct  74   SPSKLDEKQLFPLIPSKDGILLSQKTVVSGNKRGFSDTVDGFSESKSTVFNDGSWMFNPA  133

Query  618  KSDSHTPQSAGQG  656
             SDS   + AG  
Sbjct  134  GSDSGQTKLAGNA  146


 Score = 57.0 bits (136),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 54/67 (81%), Gaps = 1/67 (1%)
 Frame = +1

Query  244  MASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEK-DRLNLKATELRLGLPG  420
            MASS++ D ++Q G  LKERNYLGLSD SSVDSSA S V  EK   LNLKATELRLGLPG
Sbjct  1    MASSASADRVAQNGLGLKERNYLGLSDCSSVDSSAVSSVPEEKKSNLNLKATELRLGLPG  60

Query  421  SQSPKRD  441
            SQSP+R+
Sbjct  61   SQSPERE  67



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score = 62.4 bits (150),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = +1

Query  196  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNY---lglsdsssvdssaa  351
            M  P ++ E  G   V +     SS +LDC SQ G+ LKERNY      S   S  S+  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  352  sgvVNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
                 +K+ +NLKATELRLGLPGSQSP+RD ++
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDL  93


 Score = 55.8 bits (133),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL P+KDGIF SS K   +GNKRGF DTM+ 
Sbjct  97   SSAKIDEKPLFPLGPTKDGIFLSSQKTVVSGNKRGFADTMDA  138



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score = 59.3 bits (142),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 65/93 (70%), Gaps = 8/93 (9%)
 Frame = +1

Query  196  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNYlglsdsssvdssaasgv  360
            M  P ++ E +G  +V +     SS +LD  SQ G+ LKERNYLGLSD SSVDSSA++  
Sbjct  2    MSPPAVVTEEEGRSNVSSTVASGSSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTVP  61

Query  361  V---NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
                 +K+ +NLKATELRLGLPGSQSP+R+ ++
Sbjct  62   SLCDEKKENMNLKATELRLGLPGSQSPEREPDL  94


 Score = 57.8 bits (138),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEG  578
            S  K DEKPLFPLLP+KDGI  S+ K   +GNKRGF DTM+G
Sbjct  98   SPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNKRGFADTMDG  139



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score = 60.8 bits (146),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP I     E Q N SV +SS   +C+S+  S LKE NYLGLSD SS     +    ++
Sbjct  1    MSPPIAEVEEELQSNVSVASSSPISECLSRNTSGLKEHNYLGLSDCSSTLPDLSE---DD  57

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEMGQAP  462
            K  ++LKATELRLGLPGSQSP+RD ++ + P
Sbjct  58   KSGISLKATELRLGLPGSQSPERDTDLNEKP  88


 Score = 56.6 bits (135),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 31/47 (66%), Gaps = 7/47 (15%)
 Frame = +3

Query  468  FDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMF  608
             +EKP FPL+PSKDGI S       GNKRGF DT+E S   E NW+F
Sbjct  84   LNEKPFFPLVPSKDGICS-------GNKRGFSDTVEASAYIEKNWIF  123



>ref|XP_002862301.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38559.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
Length=238

 Score = 62.4 bits (150),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  85   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  144

Query  606  F  608
            F
Sbjct  145  F  145


 Score = 54.7 bits (130),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEMG  453
            TEL LGLPGSQSP RD E+ 
Sbjct  66   TELTLGLPGSQSPARDTELN  85



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score = 66.2 bits (160),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGS SP R+ E+
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPEL  89


 Score = 50.4 bits (119),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL PSKD  + SS K   +GNKRGF D M G
Sbjct  93   SSTKLDEKPLFPLHPSKDLTYTSSQKTVVSGNKRGFADAMNG  134



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score = 66.6 bits (161),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++L  I + GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGSQSP+R  E
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEE  89


 Score = 49.7 bits (117),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            S+ K DEK LFPL P+KD  FS S K   TGNKRGF DTM+G
Sbjct  94   SSTKVDEKLLFPLHPAKDTAFSVSQKTVVTGNKRGFSDTMDG  135



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score = 65.9 bits (159),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGS SP R+ E+
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPEL  89


 Score = 50.4 bits (119),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL PSKD  + SS K   +GNKRGF D M G
Sbjct  93   SSTKLDEKPLFPLHPSKDLTYTSSQKTVVSGNKRGFADAMNG  134



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score = 65.9 bits (159),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGS SP R+ E+
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPEL  89


 Score = 50.4 bits (119),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL PSKD  + SS K   +GNKRGF D M G
Sbjct  93   SSTKLDEKPLFPLHPSKDLTYTSSQKTVVSGNKRGFADAMNG  134



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score = 59.3 bits (142),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    EGQ + S++AS+S+  L+C S   +  KE NYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  364  NEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
            +EK + LNLKATELRLGLPGSQSP+R+ E+
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERETEL  90


 Score = 56.2 bits (134),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            S+ K DEKPLFPLLP+KDGI S S K   +GNKRGF DTM+
Sbjct  94   SSTKLDEKPLFPLLPTKDGICSLSQKTVVSGNKRGFADTMD  134



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 47/79 (59%), Gaps = 16/79 (20%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF-----  608
            K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF     
Sbjct  92   KLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEVAA  151

Query  609  --TIPKSDSHTPQSAGQGN  659
              ++ K D   PQS  +G+
Sbjct  152  TQSVTKKD--VPQSTPKGH  168


 Score = 53.5 bits (127),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvVNEKDR--LNLK  390
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SS   S+    + + D+  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRSTVGGLKEHNYLGLSDCSSSVGSSTLSGLADDDKATISLK  65

Query  391  ATELRLGLPGSQSPKRDLEM  450
            ATEL LGLPGSQSP RD ++
Sbjct  66   ATELTLGLPGSQSPARDTDL  85



>gb|ADL70577.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=292

 Score = 62.4 bits (150),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  88   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  145


 Score = 53.1 bits (126),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score = 60.1 bits (144),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 42/69 (61%), Gaps = 7/69 (10%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASF-TGNKRGFLDTMEGSVTTEANWMFTIPKSDSHTPQ  641
            + DEKP FPLLP+KD IFSS   +   GNKRGF DTM     TE NWMF  P+ +    Q
Sbjct  81   ELDEKPFFPLLPTKDEIFSSSHKNIGPGNKRGFSDTM----YTEKNWMF--PEVNKEVTQ  134

Query  642  SAGQGNFGS  668
            +  +G  G+
Sbjct  135  NIPKGQLGT  143


 Score = 55.5 bits (132),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 58/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKAT  396
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S  V ++K  ++LKAT
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSRNVEDDKATISLKAT  64

Query  397  ELRLGLPGSQSPKRDLEMGQAP  462
            EL LGLPGSQSP R+ E+ + P
Sbjct  65   ELTLGLPGSQSPARETELDEKP  86



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score = 73.9 bits (180),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +1

Query  211  ILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNL  387
            I G+ Q N  +MASSS+ DCI+Q    LKERNYLGLSD SSVDSS  S   +E K  LNL
Sbjct  8    IEGQNQFNAHLMASSSSADCITQNTLGLKERNYLGLSDCSSVDSSTVSSSPDEGKTNLNL  67

Query  388  KATELRLGLPGSQSPKRDLEM  450
            KATELRLGLPGSQSPKRDL+ 
Sbjct  68   KATELRLGLPGSQSPKRDLDF  88


 Score = 41.2 bits (95),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 17/63 (27%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSHT  635
            S  K DEK LFPL+P+            +GNKRGF DT+       ANWMF    +DS  
Sbjct  93   SVNKLDEKQLFPLVPN--------TVIVSGNKRGFSDTV------NANWMFN---ADSGL  135

Query  636  PQS  644
            P++
Sbjct  136  PKT  138



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score = 62.0 bits (149),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  85   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  144

Query  606  F  608
            F
Sbjct  145  F  145


 Score = 53.5 bits (127),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score = 62.0 bits (149),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  85   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  144

Query  606  F  608
            F
Sbjct  145  F  145


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>dbj|BAB10673.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=333

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  85   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  144

Query  606  F  608
            F
Sbjct  145  F  145


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score = 62.0 bits (149),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  85   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  144

Query  606  F  608
            F
Sbjct  145  F  145


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>gb|ADC29395.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29396.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70575.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70576.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70580.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70581.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  88   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  145


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>gb|ADC29394.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29397.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  85   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  142


 Score = 53.1 bits (126),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  3    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  62

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  63   TELTLGLPGSQSPARDTEL  81



>gb|ADC29398.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  82   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  141

Query  606  F  608
            F
Sbjct  142  F  142


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  3    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  62

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  63   TELTLGLPGSQSPARDTEL  81



>gb|ADL70583.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70584.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  87   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  144


 Score = 53.1 bits (126),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  65   TELTLGLPGSQSPARDTEL  83



>gb|ADL70586.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  87   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  144


 Score = 53.1 bits (126),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  65   TELTLGLPGSQSPARDTEL  83



>gb|ADL70578.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70582.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score = 61.6 bits (148),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  88   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  145


 Score = 53.5 bits (127),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score = 62.0 bits (149),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWM
Sbjct  85   NLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWM  144

Query  606  F  608
            F
Sbjct  145  F  145


 Score = 53.1 bits (126),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQTNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  66   TELTLGLPGSQSPARDTEL  84



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score = 67.0 bits (162),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 64/89 (72%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++L  I + GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGSQSP+R  E
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEE  89


 Score = 47.8 bits (112),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            S+ K DEK LFPL P+KD  FS S K   TGNKRGF D M+G
Sbjct  94   SSTKVDEKLLFPLHPAKDTAFSVSQKTVVTGNKRGFSDAMDG  135



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score = 67.0 bits (162),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 59/78 (76%), Gaps = 2/78 (3%)
 Frame = +1

Query  211  ILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE--KDRLN  384
            + G+ Q N S+MASS++ DCI+Q GS+LKERNYLGLSD SSVDSSA S   +   K  LN
Sbjct  8    VEGQSQCNVSLMASSASADCITQNGSSLKERNYLGLSDCSSVDSSAVSCGADTEIKSNLN  67

Query  385  LKATELRLGLPGSQSPKR  438
            LKATEL LGLPGSQSP  
Sbjct  68   LKATELTLGLPGSQSPHH  85


 Score = 47.8 bits (112),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 35/57 (61%), Gaps = 11/57 (19%)
 Frame = +3

Query  459  TGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEA-------NWMF  608
            T   DEK LFPL+PSKD    + K+  +GNKRGF DT++G   +++       NWMF
Sbjct  91   TALLDEKQLFPLIPSKD----AQKSVVSGNKRGFADTVDGFSDSKSAMLGEGKNWMF  143



>gb|ADL70579.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score = 61.6 bits (148),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  87   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  144


 Score = 52.8 bits (125),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 2/79 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  393
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  394  TELRLGLPGSQSPKRDLEM  450
            TEL LGLPGSQSP RD E+
Sbjct  65   TELTLGLPGSQSPVRDTEL  83



>gb|KJB58782.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58783.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=334

 Score = 63.9 bits (154),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  370  KD-RLNLKATELRLGLPGSQSPKRDLEM  450
             +  LNLKATELRLGLPGSQSP+R+ E+
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSEL  88


 Score = 50.1 bits (118),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F S K   +GNKRGF D M+G
Sbjct  92   SSAQLDEKPLFPLHPSSDGHCFPSQKTVVSGNKRGFSDAMDG  133



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score = 62.8 bits (151),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 7/91 (8%)
 Frame = +1

Query  199  MSPTIL----GEGQGNGSVMASSSTL--DCISQTGSALKERNYlglsdsssvdssaasgv  360
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  361  VNEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
             +EK + LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDL  91


 Score = 50.8 bits (120),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            S+ K DEKPLF LLP+KDGI S S K   +GNKRGF DT++
Sbjct  95   SSTKLDEKPLFSLLPTKDGICSLSQKTVVSGNKRGFADTID  135



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score = 62.8 bits (151),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 7/91 (8%)
 Frame = +1

Query  199  MSPTIL----GEGQGNGSVMASSSTL--DCISQTGSALKERNYlglsdsssvdssaasgv  360
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  361  VNEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
             +EK + LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDL  91


 Score = 50.8 bits (120),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            S+ K DEKPLF LLP+KDGI S S K   +GNKRGF DT++
Sbjct  95   SSTKLDEKPLFSLLPTKDGICSLSQKTVVSGNKRGFADTID  135



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score = 62.8 bits (151),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 66/91 (73%), Gaps = 7/91 (8%)
 Frame = +1

Query  199  MSPTIL----GEGQGNGSVMASSSTL--DCISQTGSALKERNYlglsdsssvdssaasgv  360
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  361  VNEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
             +EK + LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDL  91


 Score = 50.8 bits (120),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 1/41 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            S+ K DEKPLF LLP+KDGI S S K   +GNKRGF DT++
Sbjct  95   SSTKLDEKPLFSLLPTKDGICSLSQKTVVSGNKRGFADTID  135



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score = 63.2 bits (152),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  370  KD-RLNLKATELRLGLPGSQSPKRDLEM  450
             +  LNLKATELRLGLPGSQSP+R+ E+
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSEL  88


 Score = 50.4 bits (119),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F S K   +GNKRGF D M+G
Sbjct  92   SSAQLDEKPLFPLHPSSDGHCFPSQKTVVSGNKRGFSDAMDG  133



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score = 63.5 bits (153),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 64/89 (72%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPG  SP R+ E+
Sbjct  61   GNKSSLNLKATELRLGLPGFLSPGREPEL  89


 Score = 50.1 bits (118),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL PSKD  + SS K   +GNKRGF D M G
Sbjct  93   SSTKLDEKPLFPLHPSKDLTYTSSQKTVVSGNKRGFADAMNG  134



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score = 63.2 bits (152),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  370  KD-RLNLKATELRLGLPGSQSPKRDLEM  450
             +  LNLKATELRLGLPGSQSP+R+ E+
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSEL  88


 Score = 50.4 bits (119),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F S K   +GNKRGF D M+G
Sbjct  92   SSAQLDEKPLFPLHPSSDGHCFPSQKTVVSGNKRGFSDAMDG  133



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score = 57.8 bits (138),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEG  578
            S  K DEKPLFPLLP+KDGI  S+ K   +GNKRGF DTM+G
Sbjct  78   SPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNKRGFADTMDG  119


 Score = 55.8 bits (133),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = +1

Query  247  ASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV---NEKDRLNLKATELRLGLP  417
             SS +LD  SQ G+ LKERNYLGLSD SSVDSSA++       +K+ +NLKATELRLGLP
Sbjct  4    GSSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTVPSLCDEKKENMNLKATELRLGLP  63

Query  418  GSQSPKRDLEM  450
            GSQSP+R+ ++
Sbjct  64   GSQSPEREPDL  74



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score = 65.1 bits (157),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++L  I   GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGSQSP+R  E
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEE  89


 Score = 47.4 bits (111),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            S+ K DEK LFPL PSKD  FS S K   +GNKRGF D M+G
Sbjct  94   SSTKVDEKLLFPLHPSKDTAFSVSQKTVVSGNKRGFSDAMDG  135



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score = 65.5 bits (158),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG     GQ N + + SS ++D + Q  + LKERNY+GLSD SSVDSS  S V  
Sbjct  1    MSPPLLGVEEEGGQSNVTCLGSSGSMDSVCQNSAELKERNYMGLSDCSSVDSSVGSPVSE  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            E K  LNLKATELRLGLPGSQSPKR+ E+
Sbjct  61   ESKGNLNLKATELRLGLPGSQSPKRNPEL  89


 Score = 47.0 bits (110),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  S S K   +GNKRGF D M+G
Sbjct  93   SSPQLDEKPLFPLHPSSDGHCSASQKTVVSGNKRGFSDAMDG  134



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score = 65.5 bits (158),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 63/89 (71%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ASS++L  I   GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGSQSP+R  E
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEE  89


 Score = 46.6 bits (109),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            K DEK LFPL PSKD  FS S K   +GNKRGF D M+G
Sbjct  97   KVDEKLLFPLHPSKDTAFSVSQKTVVSGNKRGFSDAMDG  135



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score = 62.0 bits (149),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSS-TLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MS  +LG    EGQ N +++ SSS T++ +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIAEEEGQSNVTLLVSSSATMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   ETKSNLNLKATELRLGLPGSQSPERDSDL  89


 Score = 48.9 bits (115),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            S+ +FDEKPLFPL P+ D   SS K +  GNKRGF D M G
Sbjct  93   SSIQFDEKPLFPLHPATDEHHSSSKPAVLGNKRGFSDVMSG  133



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score = 60.8 bits (146),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 60/90 (67%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgv  360
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SS   S  ++  
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
               K  LNLKAT+LRLGLPGSQSP+RD E+
Sbjct  61   GGSKSSLNLKATDLRLGLPGSQSPERDSEL  90


 Score = 50.1 bits (118),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMEG  578
            + DEKPLFPL P KDG +SS+ K   +GNKRGF D M+G
Sbjct  96   QLDEKPLFPLHPIKDGNYSSLQKTVVSGNKRGFSDAMDG  134



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score = 62.0 bits (149),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgv  360
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SS   S  ++  
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
               K+ LNLKAT+LRLGLPGSQSP+RD E+
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSEL  90


 Score = 47.8 bits (112),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMEGSVTTEANWMF  608
            + DEKPLFPL P  DG +SS+ K   +GNKRGF D M+G +  +   ++
Sbjct  96   QLDEKPLFPLHPIMDGNYSSLQKTVVSGNKRGFSDAMDGFLEVKTTSLY  144



>ref|XP_007225723.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26922.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=293

 Score = 62.0 bits (149),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgv  360
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SS   S  ++  
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
               K+ LNLKAT+LRLGLPGSQSP+RD E+
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSEL  90


 Score = 48.1 bits (113),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMEG  578
            + DEKPLFPL P  DG +SS+ K   +GNKRGF D M+G
Sbjct  96   QLDEKPLFPLHPIMDGNYSSLQKTVVSGNKRGFSDAMDG  134



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score = 62.0 bits (149),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 5/88 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ + +++ASS +++ + Q    LKERNY+GLSD SSVDSS  S V +
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLE  447
              +  L+LKATELRLGLPGSQSP+RD E
Sbjct  61   GSRSSLHLKATELRLGLPGSQSPERDSE  88


 Score = 48.1 bits (113),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME  575
            + DEKPLFPL P KDG +SS+ K   +GNKRGF D M+
Sbjct  95   QLDEKPLFPLHPLKDGHYSSLQKTVVSGNKRGFSDAMD  132



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score = 62.0 bits (149),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 61/90 (68%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsd-sssvdssaasgv  360
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SS   S  ++  
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
               K+ LNLKAT+LRLGLPGSQSP+RD E+
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSEL  90


 Score = 47.8 bits (112),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMEG  578
            + DEKPLFPL P  DG +SS+ K   +GNKRGF D M+G
Sbjct  96   QLDEKPLFPLHPIMDGNYSSLQKTVVSGNKRGFSDAMDG  134



>gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score = 65.1 bits (157),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 65/89 (73%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MS  +LG    EGQ N +++ASS++ +   QTGS L+ERNY+GLSD SSVDSS      +
Sbjct  1    MSSPLLGAVEEEGQSNVTLLASSTSAESTCQTGSELRERNYMGLSDCSSVDSSVIPAACD  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            + K RL LKATELRLGLPGSQSP+R+ E+
Sbjct  61   QNKTRLILKATELRLGLPGSQSPERNSEL  89


 Score = 44.3 bits (103),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTMEG  578
            S+ + DEKP FPL PS +   SSV K   +GNKRGF D M+G
Sbjct  93   SSAQLDEKPFFPLHPSNERHCSSVQKNVVSGNKRGFSDAMDG  134



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score = 61.6 bits (148),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 46/79 (58%), Gaps = 16/79 (20%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF-----  608
            K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF     
Sbjct  92   KLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAA  151

Query  609  --TIPKSDSHTPQSAGQGN  659
              ++ K D   PQS  +G 
Sbjct  152  TKSVTKKD--VPQSIPKGQ  168


 Score = 47.0 bits (110),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 11/91 (12%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ-TGSALKERNY---lglsdsssvdssaasgvVNEKDRLNL  387
            E Q N SV +SS T +CIS+ T  ALKE NY      S S    + +A    ++K  ++L
Sbjct  6    ELQSNVSVASSSPTSNCISRGTTVALKEHNYLGLSDCSSSVGSSTLSAGLTEDDKASISL  65

Query  388  KATELRLGLPGSQSPKRDLEMGQAPENLMKS  480
            KATEL LGLPGSQ+   DL       NLMK+
Sbjct  66   KATELTLGLPGSQARDTDL-------NLMKN  89



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score = 60.8 bits (146),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ + +++ASS +++ + Q    LKERNY+GLSD SSVDSS  S V +
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLE  447
                 L+LKATELRLGLPGSQSP+RD E
Sbjct  61   GSXSSLHLKATELRLGLPGSQSPERDSE  88


 Score = 47.8 bits (112),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME  575
            + DEKPLFPL P KDG +SS+ K   +GNKRGF D M+
Sbjct  95   QLDEKPLFPLHPLKDGHYSSLQKTVVSGNKRGFSDAMD  132



>ref|XP_006394001.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 ref|XP_006394002.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 dbj|BAJ33783.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31287.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31288.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=339

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEK  FPLLPSKD I SS + +   GNKRGF D M+       SV TE NWM
Sbjct  86   NLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRGFSDAMDQFSEAKSSVYTEKNWM  145

Query  606  F  608
            F
Sbjct  146  F  146


 Score = 52.4 bits (124),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ--TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLK  390
            E Q N SV +SS T +CIS+   G  LKE NYLGLSD SSV SS  SG+  ++K  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKATISLK  65

Query  391  ATELRLGLPGSQSPKRDLEM  450
            ATEL LGLPG QSP RD ++
Sbjct  66   ATELTLGLPGPQSPARDTDL  85



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 36/61 (59%), Gaps = 7/61 (11%)
 Frame = +3

Query  447  NGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFLDTME------GSVTTEANWM  605
            N  S  K DEK  FPLLPSKD I SS + +   GNKRGF D M+       SV TE NWM
Sbjct  86   NLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRGFSDAMDQFSEAKSSVYTEKNWM  145

Query  606  F  608
            F
Sbjct  146  F  146


 Score = 52.4 bits (124),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQ--TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLK  390
            E Q N SV +SS T +CIS+   G  LKE NYLGLSD SSV SS  SG+  ++K  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKATISLK  65

Query  391  ATELRLGLPGSQSPKRDLEM  450
            ATEL LGLPG QSP RD ++
Sbjct  66   ATELTLGLPGPQSPARDTDL  85



>gb|KCW68554.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
 gb|KCW68555.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=321

 Score = 54.7 bits (130),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWM  605
            S+ K DEKP FPL PS DG +SS K   +GNKRGF D M G   +EA +M
Sbjct  92   SSAKLDEKPFFPLHPSNDGHYSSQKIVVSGNKRGFADAMGGD--SEAKFM  139


 Score = 53.9 bits (128),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILGEGQ----GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +L  G+     N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNL+ATELRLGLPGSQSP+RD + 
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADF  88



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score = 57.8 bits (138),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            E K  LNLKATELRLGLPG QSP+R+ E+
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPEL  89


 Score = 50.4 bits (119),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  93   SSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  134



>gb|ACU23129.1| unknown [Glycine max]
Length=210

 Score = 57.8 bits (138),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTL-DCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MS  +LG    EGQ N +++ SSS + + +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPG QSP+RD ++
Sbjct  61   ETKSNLNLKATELRLGLPGLQSPERDSDL  89


 Score = 50.8 bits (120),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------SVTTEANWMFT  611
            S+ +FDEKPLFPL P+ D   SS K +  GNKRGF D M G       V++E N + +
Sbjct  93   SSIQFDEKPLFPLHPATDDHHSSSKPAVLGNKRGFSDVMSGFAEEKLLVSSEVNTILS  150



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score = 58.2 bits (139),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            E K  LNLKATELRLGLPG QSP+R+ E+
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPEL  89


 Score = 50.1 bits (118),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  93   SSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  134



>ref|XP_010484401.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
 ref|XP_010484402.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
Length=343

 Score = 57.8 bits (138),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 36/55 (65%), Gaps = 7/55 (13%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV T  NWMF
Sbjct  96   KLDEKPFFPLLPSKDEICSSSQKINASGNKRGFSDTMDQFAEAKSSVYTGKNWMF  150


 Score = 50.1 bits (118),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 6/83 (7%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQT---GSALKERNY---lglsdsssvdssaasgvVNEKDRL  381
            E Q N SV +SS T +CIS+    G  LKE NY      S S    + +     ++K  +
Sbjct  6    ELQSNVSVASSSPTSNCISRGTTLGGGLKEHNYLGLSDCSSSVGSSTLSTGLTEDDKASI  65

Query  382  NLKATELRLGLPGSQSPKRDLEM  450
            +LKATEL LGLPGS+SP RD ++
Sbjct  66   SLKATELTLGLPGSRSPARDTDL  88



>gb|KCW68553.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=330

 Score = 54.3 bits (129),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWM  605
            S+ K DEKP FPL PS DG +SS K   +GNKRGF D M G   +EA +M
Sbjct  92   SSAKLDEKPFFPLHPSNDGHYSSQKIVVSGNKRGFADAMGGD--SEAKFM  139


 Score = 53.5 bits (127),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILGEGQ----GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +L  G+     N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNL+ATELRLGLPGSQSP+RD + 
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADF  88



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score = 54.3 bits (129),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWM  605
            S+ K DEKP FPL PS DG +SS K   +GNKRGF D M G   +EA +M
Sbjct  92   SSAKLDEKPFFPLHPSNDGHYSSQKIVVSGNKRGFADAMGGD--SEAKFM  139


 Score = 53.5 bits (127),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILGEGQ----GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +L  G+     N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNL+ATELRLGLPGSQSP+RD + 
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADF  88



>emb|CDY18679.1| BnaA09g07160D [Brassica napus]
Length=312

 Score = 55.1 bits (131),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = +1

Query  226  QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELR  405
            Q N S+ +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATEL 
Sbjct  8    QSNVSLASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATELT  66

Query  406  LGLPGSQSPKRDLEMGQAP  462
            LGLPGSQSP RD ++ + P
Sbjct  67   LGLPGSQSPARDTKLDEKP  85


 Score = 52.4 bits (124),  Expect(2) = 8e-15, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 30/48 (63%), Gaps = 8/48 (17%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMF  608
            K DEKP FPLLPSKD I SS       NKRGF DT    + TE NWMF
Sbjct  80   KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDT----IYTEKNWMF  119



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score = 57.8 bits (138),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTL-DCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MS  +LG    EGQ N +++ SSS + + +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPG QSP+RD ++
Sbjct  61   ETKSNLNLKATELRLGLPGLQSPERDSDL  89


 Score = 49.3 bits (116),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------SVTTEANWMFT  611
            S+ +FDEKPLFPL P+ D   SS K +  GNKRGF D M G       V++E N + +
Sbjct  93   SSIQFDEKPLFPLHPATDDHHSSSKPAVLGNKRGFSDVMSGFAEEKLLVSSEVNTILS  150



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score = 60.1 bits (144),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ + + ++SS +++ + Q  S LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRD  441
                 LNLKATELRLGLPGSQSP RD
Sbjct  61   GSNSSLNLKATELRLGLPGSQSPXRD  86


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME  575
            + DEKPLFPL P KDG +SS  K   +GNKRGF D M+
Sbjct  95   QLDEKPLFPLHPLKDGHYSSXQKXVVSGNKRGFSDAMD  132



>gb|KJB64034.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64035.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=303

 Score = 58.5 bits (140),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            E K  LNLKATELRLGLPG QSP+R+ E+
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPEL  89


 Score = 48.5 bits (114),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKP FPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  93   SSSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  134



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score = 60.1 bits (144),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ + + ++SS +++ + Q  S LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRD  441
                 LNLKATELRLGLPGSQSP RD
Sbjct  61   GSNSSLNLKATELRLGLPGSQSPXRD  86


 Score = 47.0 bits (110),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME  575
            + DEKPLFPL P KDG +SS  K   +GNKRGF D M+
Sbjct  95   QLDEKPLFPLHPLKDGHYSSXQKXVVSGNKRGFSDAMD  132



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score = 54.7 bits (130),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 58/87 (67%), Gaps = 6/87 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  363
            MSP ++    EG+   S    S++    SQ G+ LKERNYLGLSD SSVDS  ++     
Sbjct  1    MSPAVVVTEEEGRNKLSSTVVSASSQSFSQIGADLKERNYLGLSDCSSVDSCDSTVPSLC  60

Query  364  -NEKDRLNLKATELRLGLPGSQSPKRD  441
              +K+ LNLKATELRLGLPGSQSP+RD
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERD  87


 Score = 52.0 bits (123),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 3/38 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            K DEKPLFPL+P+KDGI  +V    +GNKRGF DT++G
Sbjct  94   KLDEKPLFPLVPTKDGIQKNV---VSGNKRGFADTVDG  128



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score = 57.8 bits (138),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            E K  LNLKATELRLGLPG QSP+R+ E+
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPEL  89


 Score = 48.1 bits (113),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKP FPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  93   SSSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  134



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score = 57.8 bits (138),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLEM  450
            E K  LNLKATELRLGLPG QSP+R+ E+
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPEL  89


 Score = 48.1 bits (113),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKP FPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  93   SSSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  134



>gb|ADL70574.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70585.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=286

 Score = 61.2 bits (147),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 38/58 (66%), Gaps = 7/58 (12%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF  608
            S  K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF
Sbjct  71   SPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMF  128


 Score = 44.7 bits (104),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  259  TLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKATELRLGLPGSQSP  432
            T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKATEL LGLPGSQSP
Sbjct  2    TSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKATELTLGLPGSQSP  61

Query  433  KRDLEM  450
             RD E+
Sbjct  62   ARDTEL  67



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score = 55.5 bits (132),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 12/100 (12%)
 Frame = +1

Query  199  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L      E + N +++ASS++++ +S      +ERNY+GLSDSSS DS   +   
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLEFEERNYMGLSDSSSEDSCMTATKS  60

Query  364  N-EKDRLNLKATELRLGLPGSQSPKRDLEMGQAPENLMKS  480
            +  K  LNLKATELRLGLPGS+SP+RD      P+N ++S
Sbjct  61   DGNKPSLNLKATELRLGLPGSESPERD------PDNCLRS  94


 Score = 49.7 bits (117),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 1/40 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS-VKASFTGNKRGFLDTM  572
            S+ + DEKPLFPL PS DG++SS  K   +GNKRGF D M
Sbjct  94   SSSQLDEKPLFPLHPSSDGLYSSPQKTVVSGNKRGFSDAM  133



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score = 58.5 bits (140),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            K DEKPLFPLLP+KDGI S S KA  +GNKRGF DTM+G
Sbjct  98   KLDEKPLFPLLPTKDGISSTSQKAVVSGNKRGFADTMDG  136


 Score = 46.6 bits (109),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
            +K  LNLKATELRLGLPGSQSP+RD E+
Sbjct  62   KKGNLNLKATELRLGLPGSQSPERDPEL  89



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score = 57.8 bits (138),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 39/70 (56%), Gaps = 8/70 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH  632
            S  K DEKPLFPL P KDGI  SS KA+ +G+KRGF D       TEA W F     DS 
Sbjct  89   SASKLDEKPLFPLTPLKDGISSSSQKAAVSGSKRGFSD-------TEAKWTFKSTGLDSD  141

Query  633  TPQSAGQGNF  662
             P+   QG  
Sbjct  142  APKPGAQGKL  151


 Score = 47.4 bits (111),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 57/90 (63%), Gaps = 11/90 (12%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  369
            MSP +LG    GQ N   +  S T  C     S LKE NY GLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGLEGGGQSNDHSLVPSPT--CAE---SGLKELNYFGLSDCSSVDSSNVSSLSEE  55

Query  370  -KDRLNL--KATELRLGLPGSQSPKRDLEM  450
             KD LNL  KATELRLGLPGSQSP+RD ++
Sbjct  56   NKDSLNLNFKATELRLGLPGSQSPERDSDL  85



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score = 62.8 bits (151),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 8/93 (9%)
 Frame = +1

Query  196  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNY---lglsdsssvdssaa  351
            M  P ++ E  G   V +     SS +LDC SQ G+ LKERNY      S   S  S+  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  352  sgvVNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
                 +K+ +NLKATELRLGLPGSQSP+RD ++
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDL  93


 Score = 42.0 bits (97),  Expect(2) = 5e-14, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 27/43 (63%), Gaps = 2/43 (5%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVK--ASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL P+KDGIF S +    F   ++   DTM+ 
Sbjct  97   SSAKIDEKPLFPLGPTKDGIFLSSRKNCCFRQTRKVLPDTMDA  139



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score = 60.1 bits (144),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ + + ++SS +++ + Q    LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSLELKEQNYMGLSDCSSVGSSKVSTASD  60

Query  367  -EKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   GSKSSLNLKATELRLGLPGSQSPERDSDL  89


 Score = 44.3 bits (103),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +3

Query  459  TGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME  575
            T + DEK LFPL P KDG + SS K   +GNKRGF D M+
Sbjct  93   TTQLDEKSLFPLHPLKDGHYSSSQKIVVSGNKRGFSDAMD  132



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score = 53.1 bits (126),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 30/48 (63%), Gaps = 8/48 (17%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMF  608
            K DEKP FPLLPSKD I SS       NKRGF DT    V TE NWMF
Sbjct  80   KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDT----VYTEKNWMF  119


 Score = 51.2 bits (121),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  399
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  400  LRLGLPGSQSPKRDLEMGQAP  462
            L LGLPGSQS  R+ ++ + P
Sbjct  65   LTLGLPGSQSHARETKLDEKP  85



>ref|XP_009112194.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=278

 Score = 52.8 bits (125),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 30/48 (63%), Gaps = 8/48 (17%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMF  608
            K DEKP FPLLPSKD I SS       NKRGF DT    V TE NWMF
Sbjct  80   KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDT----VYTEKNWMF  119


 Score = 51.2 bits (121),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +1

Query  226  QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELR  405
            Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATEL 
Sbjct  8    QSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATELT  66

Query  406  LGLPGSQSPKRDLEMGQAP  462
            LGLPGSQS  R+ ++ + P
Sbjct  67   LGLPGSQSHARETKLDEKP  85



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score = 57.8 bits (138),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 60/89 (67%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTIL--GEGQGNGSV---MASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L  GE +G  +V   ++SS+T++ +       KERNY+GLSD SSVDSS  S   
Sbjct  1    MSPPVLSIGEEEGKSNVTLLVSSSTTMESVCLKSLEFKERNYMGLSDCSSVDSSVPSFSE  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGSQSP RD ++
Sbjct  61   ETKSNLNLKATELRLGLPGSQSPDRDSDL  89


 Score = 46.2 bits (108),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            S+ +FDEK LFPL P  D   SS K +  GNKRGF D M G
Sbjct  93   SSTQFDEKTLFPLRPLTDDHHSSAKTAVLGNKRGFSDAMNG  133



>gb|KDO81312.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=210

 Score = 55.8 bits (133),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 47.8 bits (112),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            + DEKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  97   QLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDG  134



>gb|KDO81311.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=288

 Score = 56.2 bits (134),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 47.4 bits (111),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             + DEKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  96   AQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDG  134



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score = 55.8 bits (133),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L     EG+ N +++ SSST ++ +       KERNY+G SD SSVDSS  S   
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   ECKSNLNLKATELRLGLPGSQSPERDSDL  89


 Score = 47.8 bits (112),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMFTI  614
            S+ + DEKPLFPL P  D   SS K +  GNKRGF D M G +++E  ++  +
Sbjct  93   SSTQLDEKPLFPLHPLTDDHHSSAKTAVLGNKRGFSDAMNG-LSSEGKFLVDL  144



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score = 55.5 bits (132),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 65/100 (65%), Gaps = 12/100 (12%)
 Frame = +1

Query  199  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L      E + N +++ASS++++ +S      +ERNY+GLSDSSS DS   +   
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLGFEERNYMGLSDSSSEDSCMTATKS  60

Query  364  N-EKDRLNLKATELRLGLPGSQSPKRDLEMGQAPENLMKS  480
            +  K  LNLKATELRLGLPGS+SP+RD      P+N ++S
Sbjct  61   DGNKPSLNLKATELRLGLPGSESPERD------PDNCLRS  94


 Score = 47.8 bits (112),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 1/40 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSS-VKASFTGNKRGFLDTM  572
            S+ + DEKPLFPL PS DG +SS  K   +GNKRGF D M
Sbjct  94   SSSQLDEKPLFPLHPSSDGHYSSPQKTVVSGNKRGFSDAM  133



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score = 60.1 bits (144),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 63/88 (72%), Gaps = 5/88 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGQSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLE  447
            E K  LNLKATELRLGLPGSQSP+R+ E
Sbjct  61   ERKASLNLKATELRLGLPGSQSPERNHE  88


 Score = 43.5 bits (101),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            DEKP FPL PS DG +S+ K   +GNKR F D M+
Sbjct  98   DEKPFFPLHPSNDGHYSTQKNVVSGNKRVFSDAMD  132



>ref|XP_009150655.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=332

 Score = 57.8 bits (138),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTMEGS-VTTEANWMF  608
             K DEKP FPLLPSKD + SS   K   +GNKRGF DTM+   V TE NWMF
Sbjct  83   AKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSDTMDKVPVYTEKNWMF  134


 Score = 45.4 bits (106),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 53/78 (68%), Gaps = 7/78 (9%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  396
            E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  397  ELRLGLPGSQSPKRDLEM  450
            EL LGLPGSQSP RD E+
Sbjct  60   ELTLGLPGSQSPARDTEL  77



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score = 55.8 bits (133),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/89 (53%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L     EG+ N +++ SSST ++ +       KERNY+G SD SSVDSS  S   
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
              K  LNLKATELRLGLPGSQSP+RD ++
Sbjct  61   ECKSNLNLKATELRLGLPGSQSPERDSDL  89


 Score = 47.4 bits (111),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEGSVTTEANWMFTI  614
            S+ + DEKPLFPL P  D   SS K +  GNKRGF D M G +++E  ++  +
Sbjct  93   SSTQLDEKPLFPLHPLTDDHHSSAKIAVLGNKRGFSDAMNG-LSSEGKFLVDL  144



>ref|XP_009150656.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=330

 Score = 58.2 bits (139),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTMEGS-VTTEANWMF  608
             K DEKP FPLLPSKD + SS   K   +GNKRGF DTM+   V TE NWMF
Sbjct  83   AKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSDTMDKVPVYTEKNWMF  134


 Score = 45.4 bits (106),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 53/78 (68%), Gaps = 7/78 (9%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  396
            E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  397  ELRLGLPGSQSPKRDLEM  450
            EL LGLPGSQSP RD E+
Sbjct  60   ELTLGLPGSQSPARDTEL  77



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score = 55.8 bits (133),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 47.0 bits (110),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             + DEKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  96   AQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDG  134



>gb|KDO81310.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=333

 Score = 55.8 bits (133),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 47.0 bits (110),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             + DEKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  96   AQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDG  134



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score = 55.1 bits (131),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPGVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 47.4 bits (111),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             + DEKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  96   AQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDG  134



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score = 58.5 bits (140),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EG  N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLE  447
            E K  LNLKATELRLGLPGSQSP+R+ E
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERNHE  88


 Score = 43.5 bits (101),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            DEKP FPL PS DG +S+ K   +GNKR F D M+
Sbjct  98   DEKPFFPLHPSNDGHYSTQKNVVSGNKRVFSDAMD  132



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score = 55.1 bits (131),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPGVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 47.4 bits (111),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             + DEKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  96   AQLDEKPLFPLHPTSDSHYPSQKNVVSGNKRGFSDAMDG  134



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score = 61.2 bits (147),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGS SP+R +E
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIE  89


 Score = 40.8 bits (94),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            +EK LFPL P+KD   + S K   TGNKRGF D M+G
Sbjct  96   NEKLLFPLHPAKDSALAVSQKTVVTGNKRGFSDAMDG  132



>ref|XP_010104556.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC01157.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 58.2 bits (139),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 11/86 (13%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP + G    EGQ N +V+ SS +++      S LKERNY+GLSD SS D S  S   +
Sbjct  1    MSPPLHGVGEDEGQSNVTVLTSSPSME------SELKERNYMGLSDCSSGDCSVVSPASD  54

Query  367  EKDR-LNLKATELRLGLPGSQSPKRD  441
            E  R LNLKATELRLGLPGSQSP+RD
Sbjct  55   ESKRTLNLKATELRLGLPGSQSPERD  80


 Score = 43.9 bits (102),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            S+ + DEK LFPL PS D  ++ S+K   +GNKRGF D M G
Sbjct  86   SSAQLDEKKLFPLHPSNDVHYNHSLKTVVSGNKRGFSDAMNG  127



>emb|CAJ13716.1| auxin induced protein [Capsicum chinense]
Length=210

 Score = 55.1 bits (131),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 64/94 (68%), Gaps = 10/94 (11%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N +++ SSS+L  I Q G ALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLGSSSSLGSICQKGLALKERNYMGLSDCSSVDSCNISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLEMGQAP  462
            + +   LNLKATELRLGLPGSQSP+R    G AP
Sbjct  61   DNNGVGLNLKATELRLGLPGSQSPER----GTAP  90


 Score = 47.0 bits (110),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            K DEK LFPL P+KD  FS S K   TGNKRGF D M+G
Sbjct  97   KVDEKLLFPLHPAKDTAFSVSQKTVVTGNKRGFSDAMDG  135



>emb|CDY08767.1| BnaA06g24570D [Brassica napus]
Length=332

 Score = 56.6 bits (135),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTMEGS-VTTEANWMF  608
             K DEKP FPLLPSKD + SS   K   +GNKRGF DTM+   + TE NWMF
Sbjct  83   AKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSDTMDKVPLYTEKNWMF  134


 Score = 45.4 bits (106),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 53/78 (68%), Gaps = 7/78 (9%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  396
            E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  397  ELRLGLPGSQSPKRDLEM  450
            EL LGLPGSQSP RD E+
Sbjct  60   ELTLGLPGSQSPARDTEL  77



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score = 61.2 bits (147),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSG  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGS SP+R +E
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIE  89


 Score = 40.8 bits (94),  Expect(2) = 3e-13, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 1/37 (3%)
 Frame = +3

Query  471  DEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            +EK LFPL P+KD  +  S K   TGNKRGF D M+G
Sbjct  96   NEKLLFPLHPAKDSDLVVSQKTVVTGNKRGFSDAMDG  132



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score = 53.9 bits (128),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/88 (55%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +1

Query  199  MSPTILG---EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG   EG+ N +++ SSST ++ +      LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGIGEEGKSNVTLLVSSSTTMESVCLKTLELKERNYMGLSDCSSVDSSVPSVSEE  60

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLEM  450
             K  LNLKATEL LGLPGSQS +RD ++
Sbjct  61   TKSNLNLKATELTLGLPGSQSSERDSDL  88


 Score = 47.4 bits (111),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 31/54 (57%), Gaps = 6/54 (11%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------SVTTEAN  599
            S+ +FDEK LFPL P  D   SS K +  GNKRGF D M G       V +EAN
Sbjct  92   SSTQFDEKALFPLCPLADDHHSSTKTAVLGNKRGFSDAMNGFSEGKFLVDSEAN  145



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score = 55.8 bits (133),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = +1

Query  196  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  360
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  361  VNEKDRLNLKATELRLGLPGSQSPKRDLEM  450
             + K  LNLKATELRLGLPGSQSP+R  E+
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSEL  90


 Score = 44.3 bits (103),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
             +  EKPLFPL P+ D  + S K   +GNKRGF D M+G
Sbjct  96   AQLGEKPLFPLHPTNDSHYPSQKNVVSGNKRGFSDAMDG  134



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score = 58.9 bits (141),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +1

Query  217  GEGQGNGSVMASSSTL--DCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLK  390
            GE +G+  V A SS+L  D +    S LKERNY+GLSD SSVDSS  S V   K RLNL 
Sbjct  9    GEEEGSSDVTALSSSLSMDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDGSKSRLNLM  68

Query  391  ATELRLGLPGSQSPKRDLEM  450
            ATELRLGLPGSQSP+R+ E+
Sbjct  69   ATELRLGLPGSQSPERNSEL  88


 Score = 40.8 bits (94),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            DEKPLFPL P KD +  ++    +GNKRGF D M+
Sbjct  96   DEKPLFPLHPVKDSLQKTI---VSGNKRGFSDAMD  127



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score = 50.1 bits (118),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFLDTMEG  578
            S+ K DEKPLFPL P KDG  S+++ + T GNKRGF D M+G
Sbjct  94   SSTKLDEKPLFPLHPLKDGNCSNLQRTITSGNKRGFSDAMDG  135


 Score = 49.3 bits (116),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MS  +LG    EGQ N S++ SSS+LD   Q GS  KERNY+GLS+ SSVDSS  S +  
Sbjct  1    MSTPLLGVGEEEGQSNVSLLTSSSSLDSSRQNGSVFKERNYMGLSECSSVDSSTISNISG  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLEM  450
              +   LNLKATELRLGLPGSQSP+RD E+
Sbjct  61   GSNGSCLNLKATELRLGLPGSQSPERDSEL  90



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score = 61.2 bits (147),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 6/89 (7%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  367  EKDR--LNLKATELRLGLPGSQSPKRDLE  447
            + +   LNLKATELRLGLPGS SP+R +E
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIE  89


 Score = 38.1 bits (87),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 1/37 (3%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            +EK LFPL P+KD   + S K   TGNKR F D M+G
Sbjct  96   NEKLLFPLHPAKDSALAVSQKTVVTGNKRRFSDAMDG  132



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score = 58.5 bits (140),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 5/88 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EG  N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLE  447
            E K  LNLKATELRLGLPGSQSP+R+ E
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERNHE  88


 Score = 40.8 bits (94),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (67%), Gaps = 1/36 (3%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME  575
            DEKP FPL PS DG +SS  K   +GNKR F D M+
Sbjct  98   DEKPFFPLHPSNDGHYSSTQKNVVSGNKRVFSDAMD  133



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score = 57.4 bits (137),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEG  578
            S  K DEKPLFPLLP+KDGI  S+ K   +GNKRGF DTM+G
Sbjct  28   SPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNKRGFADTMDG  69


 Score = 41.6 bits (96),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = +1

Query  379  LNLKATELRLGLPGSQSPKRDLEM  450
            +NLKATELRLGLPGSQSP+R+ ++
Sbjct  1    MNLKATELRLGLPGSQSPEREPDL  24



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score = 59.7 bits (143),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 61/88 (69%), Gaps = 5/88 (6%)
 Frame = +1

Query  199  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  366
            MSP +LG    EGQ N ++++S  + +     G  LKERNY+GLSD SSVDSSA S   N
Sbjct  1    MSPPLLGVVEEEGQSNVTLLSSPVSAESACLNGLELKERNYMGLSDCSSVDSSAVSAASN  60

Query  367  E-KDRLNLKATELRLGLPGSQSPKRDLE  447
            E K  LNLKATELRLGLPGSQSP+R  E
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERHHE  88


 Score = 38.9 bits (89),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 1/36 (3%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME  575
            DEKP FPL PS DG ++S  K   +GNKR F D M+
Sbjct  98   DEKPFFPLHPSIDGHYTSTQKNVVSGNKRVFSDAMD  133



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score = 57.8 bits (138),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 44/77 (57%), Gaps = 7/77 (9%)
 Frame = +3

Query  453  PSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME------GSVTTEANWMFTI  614
            PS    DEK LFPL PSKD   +  K   + NKRGF DT++      GSV  E NWMF  
Sbjct  72   PSPRTPDEKLLFPLAPSKDPA-TGHKNVVSRNKRGFSDTLDEFSEVKGSVFPEKNWMFNW  130

Query  615  PKSDSHTPQSAGQGNFG  665
             +S+  TPQSA QG  G
Sbjct  131  AESNPETPQSARQGKPG  147


 Score = 41.2 bits (95),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 1/62 (2%)
 Frame = +1

Query  271  ISQTGSALKERNYlglsd-sssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLE  447
            I Q+  +LKERNYLGLSD SS   S+  +   +EK  LN+KATELRLGLPGS+S + + +
Sbjct  9    IPQSALSLKERNYLGLSDCSSVDSSTVPNVPDDEKGNLNVKATELRLGLPGSRSSEGESD  68

Query  448  MG  453
             G
Sbjct  69   FG  70



>ref|XP_010444576.1| PREDICTED: auxin-responsive protein IAA9-like [Camelina sativa]
Length=341

 Score = 61.6 bits (148),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 46/79 (58%), Gaps = 16/79 (20%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTME------GSVTTEANWMF-----  608
            K DEKP FPLLPSKD I  SS K + +GNKRGF DTM+       SV TE NWMF     
Sbjct  94   KLDEKPFFPLLPSKDDICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAA  153

Query  609  --TIPKSDSHTPQSAGQGN  659
              ++ K D   PQS  +G 
Sbjct  154  TQSVTKKD--VPQSIPKGQ  170


 Score = 37.0 bits (84),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 48/92 (52%), Gaps = 10/92 (11%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSA-----LKERNY---lglsdsssvdssaasgvVNEKD  375
            E Q N SV +SS T +CIS+  +      LKE NY      S S    + +A  V ++K 
Sbjct  6    ELQSNVSVASSSPTSNCISRGTTVSVCGGLKEHNYLGLSDCSSSVGSSTLSAGLVEDDKA  65

Query  376  RLNLKATELRLGLPGSQSPKRDLEMGQAPENL  471
              +LKATEL LGLPGS+    DL +   P  L
Sbjct  66   TFSLKATELTLGLPGSRD--TDLNLMTPPVKL  95



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score = 70.5 bits (171),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 65/87 (75%), Gaps = 6/87 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    E Q N S +AS+S  +LDC SQ G+ LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  364  NEK-DRLNLKATELRLGLPGSQSPKRD  441
            +EK + LNLKATELRLGLPGSQSP+RD
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERD  87


 Score = 26.6 bits (57),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (63%), Gaps = 2/27 (7%)
 Frame = +3

Query  498  PSKDGIFSSVKASFTGNKRGFLDTMEG  578
            P +D +  S K   +GNKRGF D M+G
Sbjct  84   PERDPV--SQKNVVSGNKRGFSDAMDG  108



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score = 52.0 bits (123),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 3/38 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            K DEKPLFPLLP+KDG+  +V    +GNKRGF DT++G
Sbjct  80   KLDEKPLFPLLPAKDGLQKNV---VSGNKRGFADTVDG  114


 Score = 43.9 bits (102),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLE  447
            +K  LNLKATELRLGLPGSQSP+R+++
Sbjct  47   KKVNLNLKATELRLGLPGSQSPEREMD  73



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score = 52.0 bits (123),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 3/38 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            K DEKPLFPLLP+KDG+  +V    +GNKRGF DT++G
Sbjct  80   KLDEKPLFPLLPAKDGLQKNV---VSGNKRGFADTVDG  114


 Score = 43.9 bits (102),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLE  447
            +K  LNLKATELRLGLPGSQSP+R+++
Sbjct  47   KKVNLNLKATELRLGLPGSQSPEREMD  73



>ref|NP_001237053.1| uncharacterized protein LOC100500373 [Glycine max]
 gb|ACU15430.1| unknown [Glycine max]
Length=193

 Score = 59.7 bits (143),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +1

Query  199  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +L    EGQ + S++AS+S+  L+C S   +  KE NYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  364  NEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
            +EK + LNLKATELRLGLPGSQSP+R+ E+
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERETEL  90


 Score = 36.2 bits (82),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (66%), Gaps = 1/35 (3%)
 Frame = +3

Query  474  EKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTME  575
            E  LF L  +KDGI S S K   +GNKRGF DTM+
Sbjct  87   ETELFSLSSTKDGICSLSQKTVVSGNKRGFADTMD  121



>gb|AID60626.1| auxin-responsive protein IAA8 [Dimocarpus longan]
Length=257

 Score = 52.4 bits (124),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 64/89 (72%), Gaps = 8/89 (9%)
 Frame = +1

Query  199  MSPTILG----EGQ-GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  363
            MSP +LG    EG   N +++ASSS+LD I Q    LKERNY+GLSD SSVDSS  S + 
Sbjct  1    MSPPLLGVEEEEGHPSNVTLLASSSSLDSICQNNPELKERNYMGLSDCSSVDSSVISNLS  60

Query  364  NE---KDRLNLKATELRLGLPGSQSPKRD  441
            NE   K  LNLKATELRLGLPGSQSP+RD
Sbjct  61   NETKSKSSLNLKATELRLGLPGSQSPERD  89


 Score = 42.7 bits (99),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 26/41 (63%), Gaps = 4/41 (10%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL P+ DG +   K     NKRGF D M+G
Sbjct  96   SSAQLDEKPLFPLHPTNDGHYPLQK----NNKRGFSDAMDG  132



>gb|AFK49555.1| unknown [Medicago truncatula]
Length=99

 Score = 50.8 bits (120),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 3/38 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            K DEKPLFPLLP+KDG+  +V    +GNKRGF DT++G
Sbjct  61   KLDEKPLFPLLPAKDGLQKNV---VSGNKRGFADTVDG  95


 Score = 43.1 bits (100),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  367  EKDRLNLKATELRLGLPGSQSPKRDLE  447
            +K  LNLKATELRLGLPGSQSP+R+++
Sbjct  28   KKVNLNLKATELRLGLPGSQSPEREMD  54



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score = 52.4 bits (124),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +1

Query  262  LDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRD  441
            +D +    S LKERNY+GLSD SSVDSS  S V   K RLNL ATELRLGLPGSQSP+R+
Sbjct  1    MDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDGSKSRLNLMATELRLGLPGSQSPERN  60

Query  442  LEM  450
             E+
Sbjct  61   SEL  63


 Score = 40.4 bits (93),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            DEKPLFPL P KD +  ++    +GNKRGF D M+
Sbjct  71   DEKPLFPLHPVKDSLQKTI---VSGNKRGFSDAMD  102



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score = 52.4 bits (124),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 38/71 (54%), Gaps = 7/71 (10%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME------GSVTTEANWMFTIPKSDSH  632
            DEK LFPL  SKD      K   +GNKRGF DT++      GSV  E  W     +S+  
Sbjct  86   DEKLLFPLSASKDPAIVH-KNVVSGNKRGFSDTLDEFSVVKGSVYPEKTWTLNESESNPE  144

Query  633  TPQSAGQGNFG  665
            TPQSA QG F 
Sbjct  145  TPQSARQGTFA  155


 Score = 39.7 bits (91),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 34/58 (59%), Gaps = 4/58 (7%)
 Frame = +1

Query  271  ISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKATELRLGLPGSQSPKRD  441
            + Q    LKE NYL  S  SS   S      NE K  LN KATELRLGLPG QSP+R+
Sbjct  20   VHQYAFGLKEHNYLVRSVDSSTLCSVPD---NEGKGNLNFKATELRLGLPGLQSPERE  74



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score = 45.4 bits (106),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRD  441
            K  LNLKATELRLGLPGSQSP+RD
Sbjct  33   KSNLNLKATELRLGLPGSQSPERD  56


 Score = 45.4 bits (106),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3

Query  459  TGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            + +FDEKPLFPL P  D   SS K +  G+KRGF D M G
Sbjct  64   SAQFDEKPLFPLHPVTDDHHSSSKPAVLGSKRGFSDAMNG  103



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score = 50.1 bits (118),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEG  578
            S+ K DEKPLFPL PSKD  + SS K   +GNKRGF D M G
Sbjct  52   SSTKLDEKPLFPLHPSKDLTYTSSQKTVVSGNKRGFADAMNG  93


 Score = 40.8 bits (94),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATELRLGLPGS SP R+ E+
Sbjct  22   KSSLNLKATELRLGLPGSLSPGREPEL  48



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score = 49.3 bits (116),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 52/82 (63%), Gaps = 8/82 (10%)
 Frame = +1

Query  220  EGQGNGSVMASSSTL---DCISQTGSALKERNYlglsdsssvdssaasgvVNE-----KD  375
            EG+ N +++ SSST     C++ + S  KE NY+GLS  SS  S  +S  +       K 
Sbjct  12   EGESNVTLLVSSSTTMESVCLNVSKSKPKEFNYMGLSCDSSSSSVESSVPIQSFSDETKS  71

Query  376  RLNLKATELRLGLPGSQSPKRD  441
             LNLKATELRLG+PGSQSP+RD
Sbjct  72   NLNLKATELRLGIPGSQSPERD  93


 Score = 41.2 bits (95),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTM  572
            S+ KFDEK LFPL P KD    SS K +  G+KRGF D M
Sbjct  102  SSTKFDEKTLFPLHPQKDDHHLSSPKVAVLGSKRGFSDAM  141



>gb|AFK43616.1| unknown [Lotus japonicus]
Length=180

 Score = 45.1 bits (105),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRD  441
            K  LNLKATELRLGLPGSQSP+RD
Sbjct  66   KSNLNLKATELRLGLPGSQSPERD  89


 Score = 45.1 bits (105),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3

Query  459  TGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG  578
            + +FDEKPLFPL P  D   SS K +  G+KRGF D M G
Sbjct  97   SAQFDEKPLFPLHPVTDDHHSSSKPAVLGSKRGFSDAMNG  136



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 53.1 bits (126),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +1

Query  220  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR--LNLKA  393
            +GQ +G++   +S+ + I    S L+E NY+G SD SS   S+A  V + + R   NLKA
Sbjct  9    DGQSSGTLPFPASSAESILHNNSELREVNYMGYSDCSSSVDSSAISVASGESRSNYNLKA  68

Query  394  TELRLGLPGSQSPKRDLEMG  453
            TELRLGLPGSQSP RD E+G
Sbjct  69   TELRLGLPGSQSPGRDTELG  88


 Score = 37.0 bits (84),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +3

Query  450  GPSTG-KFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEG  578
            GP T  K D+KPLFPL P  DG   SS  +  +G+KRGF D + G
Sbjct  88   GPLTSSKLDKKPLFPLYPVSDGTSSSSRISIVSGHKRGFADAVNG  132



>dbj|BAP94244.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94245.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94246.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94247.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94248.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94249.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94250.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94251.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94252.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94253.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94254.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94255.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94256.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94257.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94258.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94259.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94260.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94261.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94263.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94264.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94265.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94266.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94268.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94269.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94270.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94271.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94272.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94273.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94275.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94292.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94293.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94294.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94295.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94296.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94297.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94298.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94299.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94300.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94301.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94303.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94304.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94305.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94306.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94311.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94313.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 46.2 bits (108),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATELRLGLPGSQSP+RD E+
Sbjct  9    KSSLNLKATELRLGLPGSQSPERDSEL  35


 Score = 42.7 bits (99),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            + DEKPLFPL P KD +  +V    +GNKRGF DTM+
Sbjct  41   QLDEKPLFPLHPLKDSLQKTV---VSGNKRGFSDTMD  74



>gb|EPS59988.1| auxin-regulated protein [Genlisea aurea]
Length=317

 Score = 53.5 bits (127),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 54/83 (65%), Gaps = 8/83 (10%)
 Frame = +1

Query  199  MSPTILGEGQG--NGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEK  372
            MSP  L  G G  NGSVMA+SS     S     LKE NYLG SD SSVDSSA     + K
Sbjct  1    MSPPCLTAGIGGSNGSVMAASSG----SVNSLVLKEINYLGFSDCSSVDSSALPE--DNK  54

Query  373  DRLNLKATELRLGLPGSQSPKRD  441
              +NLKATELRLGLPGSQSP RD
Sbjct  55   TTMNLKATELRLGLPGSQSPDRD  77


 Score = 35.4 bits (80),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 8/50 (16%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM----EGSVTTEANWMF  608
            DEK LFPL+PS       V    +GNKRGF DT+    E     + +W+F
Sbjct  77   DEKQLFPLVPSSQKPVIIV----SGNKRGFSDTVDCFTESKCCGDGSWIF  122



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score = 46.6 bits (109),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFS-SVKASFTGNKRGFLDTMEG  578
            K DEK LFPL PSKD  FS S K   +GNKRGF D M+G
Sbjct  56   KVDEKLLFPLHPSKDTAFSVSQKTVVSGNKRGFSDAMDG  94


 Score = 42.0 bits (97),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = +1

Query  379  LNLKATELRLGLPGSQSPKRDLE  447
            LNLKATELRLGLPGSQSP+R  E
Sbjct  26   LNLKATELRLGLPGSQSPERGEE  48



>dbj|BAP94262.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94267.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94274.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94283.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94302.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94307.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94308.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94309.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94310.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94312.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94314.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94315.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 45.8 bits (107),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATELRLGLPGSQSP RD E+
Sbjct  9    KSSLNLKATELRLGLPGSQSPXRDSEL  35


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            + DEKPLFPL P KD +  +V    +GNKRGF DTM+
Sbjct  41   QLDEKPLFPLHPLKDSLQKTV---VSGNKRGFSDTMD  74



>dbj|BAP94276.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94277.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94278.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94279.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94280.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94281.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94282.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94284.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94285.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94286.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94287.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94288.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94289.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94290.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94291.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94316.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94317.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94318.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94319.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94320.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94321.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94322.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94323.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 45.8 bits (107),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEM  450
            K  LNLKATELRLGLPGSQSP RD E+
Sbjct  9    KSSLNLKATELRLGLPGSQSPDRDSEL  35


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  575
            + DEKPLFPL P KD +  +V    +GNKRGF DTM+
Sbjct  41   QLDEKPLFPLHPLKDSLQKTV---VSGNKRGFSDTMD  74



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score = 45.8 bits (107),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  572
            S+ +FDEKPLFPL P KD      K +  GNKRGF D M
Sbjct  93   SSKQFDEKPLFPLHPQKDDHLFESKPAVLGNKRGFSDAM  131


 Score = 42.0 bits (97),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRD  441
            K  LNLKATELRLGLPGS SP+RD
Sbjct  62   KSNLNLKATELRLGLPGSLSPERD  85



>gb|KEH28135.1| auxin response factor [Medicago truncatula]
Length=272

 Score = 45.4 bits (106),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTM  572
            S+ +FDEKPLFPL P KD      K +  GNKRGF D M
Sbjct  93   SSKQFDEKPLFPLHPQKDDHLFESKPAVLGNKRGFSDAM  131


 Score = 42.0 bits (97),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRD  441
            K  LNLKATELRLGLPGS SP+RD
Sbjct  62   KSNLNLKATELRLGLPGSLSPERD  85



>gb|KJB71171.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=289

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH  632
            ++GK DEK LFPLLPSKDGI  SS K+  TGNKRGF + ++G++ TE  WM +    DS 
Sbjct  85   NSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNKRGFSE-VKGTIYTEKKWMGSGAVPDSQ  143

Query  633  TPQSAGQGNF  662
              Q    G +
Sbjct  144  YLQPVSHGKY  153


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 14/98 (14%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  379  LNLKATELRLGLPGSQSPKRDLEMGQAPENLMKSLCFL  492
            LNLKATELRLGLPGSQSP+R+ E           LCFL
Sbjct  58   LNLKATELRLGLPGSQSPERETE-----------LCFL  84



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score = 45.8 bits (107),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVN--EKDRLNLKATELRLGLPGSQSPKRDLEMG  453
             LKERNYLGLSD SSVDSS     V   EK  LN KATELRLGLP SQSP+R+ + G
Sbjct  19   GLKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFG  75


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   S+    K   +GNKRGF DT
Sbjct  83   DEKLLFPLLPSKDTAASATIGHKNVVSGNKRGFADT  118



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH  632
            ++GK DEK LFPLLPSKDGI  SS K+  TGNKRGF + ++G++ TE  WM +    DS 
Sbjct  85   NSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNKRGFSE-VKGTIYTEKKWMGSGAVPDSQ  143

Query  633  TPQSAGQGNF  662
              Q    G +
Sbjct  144  YLQPVSHGKY  153


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 14/98 (14%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  379  LNLKATELRLGLPGSQSPKRDLEMGQAPENLMKSLCFL  492
            LNLKATELRLGLPGSQSP+R+ E           LCFL
Sbjct  58   LNLKATELRLGLPGSQSPERETE-----------LCFL  84



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH  632
            ++GK DEK LFPLLPSKDGI  SS K+  TGNKRGF + ++G++ TE  WM +    DS 
Sbjct  85   NSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNKRGFSE-VKGTIYTEKKWMGSGAVPDSQ  143

Query  633  TPQSAGQGNF  662
              Q    G +
Sbjct  144  YLQPVSHGKY  153


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 14/98 (14%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  379  LNLKATELRLGLPGSQSPKRDLEMGQAPENLMKSLCFL  492
            LNLKATELRLGLPGSQSP+R+ E           LCFL
Sbjct  58   LNLKATELRLGLPGSQSPERETE-----------LCFL  84



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH  632
            ++GK DEK LFPLLPSKDGI  SS K+  TGNKRGF + ++G++ TE  WM +    DS 
Sbjct  85   NSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNKRGFSE-VKGTIYTEKKWMGSGAVPDSQ  143

Query  633  TPQSAGQGNF  662
              Q    G +
Sbjct  144  YLQPVSHGKY  153


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 14/98 (14%)
 Frame = +1

Query  199  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  378
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  379  LNLKATELRLGLPGSQSPKRDLEMGQAPENLMKSLCFL  492
            LNLKATELRLGLPGSQSP+R+ E           LCFL
Sbjct  58   LNLKATELRLGLPGSQSPERETE-----------LCFL  84



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score = 45.8 bits (107),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 41/57 (72%), Gaps = 2/57 (4%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVN--EKDRLNLKATELRLGLPGSQSPKRDLEMG  453
             LKERNYLGLSD SSVDSS     V   EK  LN KATELRLGLP SQSP+R+ + G
Sbjct  19   GLKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFG  75


 Score = 39.3 bits (90),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 24/36 (67%), Gaps = 3/36 (8%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   S+    K   +GNKRGF DT
Sbjct  83   DEKLLFPLLPSKDIAASATIGHKNVVSGNKRGFADT  118



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score = 44.7 bits (104),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVN---EKDRLNLKATELRLGLPGSQSPKRDLEM  450
            T   LKERNYLGLSD SSVDSS    VV    EK  LN KATELRLGLP SQSP+R+ + 
Sbjct  15   TPPGLKERNYLGLSDCSSVDSSTIPNVVVPEIEKSNLNFKATELRLGLPESQSPERETDF  74

Query  451  G  453
            G
Sbjct  75   G  75


 Score = 39.7 bits (91),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 34/64 (53%), Gaps = 9/64 (14%)
 Frame = +3

Query  471  DEKPLFPLLPSKD---GIFSSVKASFTGNKRGFLDT------MEGSVTTEANWMFTIPKS  623
            DEK LFPLLP KD   G  +  K   +GNKRGF DT      ++GSV      M   PK 
Sbjct  83   DEKLLFPLLPCKDHASGATTVHKNVVSGNKRGFSDTWDEFSAVKGSVRPGGINMMLSPKV  142

Query  624  DSHT  635
             S+T
Sbjct  143  TSNT  146



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 43.9 bits (102),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 47/68 (69%), Gaps = 3/68 (4%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG-QAPE  465
             LKERNYLGLSD SSVDSS    V  EK  LN KATELRLGLP S+SP+R+ + G  +P 
Sbjct  14   GLKERNYLGLSDCSSVDSSTIPNV--EKSNLNFKATELRLGLPESESPERETDFGLLSPR  71

Query  466  NLMKSLCF  489
             L + L F
Sbjct  72   TLDEKLLF  79


 Score = 39.3 bits (90),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 31/59 (53%), Gaps = 8/59 (14%)
 Frame = +3

Query  468  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT------MEGSVTTEANWMFTIPK  620
             DEK LFPLLP KD   ++   K   +GNKRGF DT      ++GSV      M   PK
Sbjct  73   LDEKLLFPLLPCKDNTSATTGHKNVVSGNKRGFADTWDEFSGLKGSVRPGGINMMLSPK  131



>gb|ADL70565.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=247

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  5    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  61


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  69   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  103



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  32   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  88


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  96   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  130



>gb|ADL70572.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  10   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  66


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  74   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  108



>gb|ADL70566.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=251

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  9    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  65


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  73   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  107



>gb|ADC29393.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  9    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  65


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  73   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  107



>gb|ADL70561.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=249

 Score = 44.7 bits (104),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  8    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  64


 Score = 38.1 bits (87),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  72   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  106



>gb|ADL70567.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=259

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  71


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  79   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  113



>gb|ADL70573.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  11   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  67


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  75   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  109



>gb|ADL70564.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  8    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  64


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  72   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  106



>gb|ADL70563.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=250

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  6    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  62


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  70   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  104



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  71


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  79   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  113



>gb|ADL70569.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=263

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  71


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  79   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  113



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score = 44.7 bits (104),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  71


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  79   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  113



>gb|ADL70571.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=262

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  71


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  79   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  113



>gb|ADC29390.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=257

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  13   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  69


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  77   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  111



>gb|ADL70570.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=278

 Score = 44.3 bits (103),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  71


 Score = 38.1 bits (87),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  79   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  113



>ref|XP_006294565.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 ref|XP_006294566.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27463.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27464.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=330

 Score = 42.0 bits (97),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVNEKDRLNL--KATELRLGLPGSQSPKRDLEMG  453
             LKERNYLGLSD SSVDSS     V + ++ NL  KATELRLGLP SQSP+R+ + G
Sbjct  18   GLKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFG  74


 Score = 40.0 bits (92),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   +++  K   +GNKRGF DT
Sbjct  82   DEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADT  116



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score = 42.0 bits (97),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVNEKDRLNL--KATELRLGLPGSQSPKRDLEMG  453
             LKERNYLGLSD SSVDSS     V + ++ NL  KATELRLGLP SQSP+R+ + G
Sbjct  18   GLKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFG  74


 Score = 40.4 bits (93),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   +++  K   +GNKRGF DT
Sbjct  82   DEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADT  116



>gb|ADL70562.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=226

 Score = 43.9 bits (102),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  292  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  53


 Score = 38.1 bits (87),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  61   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  95



>gb|ADC29389.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=221

 Score = 43.9 bits (102),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 41/54 (76%), Gaps = 1/54 (2%)
 Frame = +1

Query  292  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  53


 Score = 38.1 bits (87),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  61   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  95



>gb|ADL70568.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=225

 Score = 42.4 bits (98),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  295  KERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLEMG  453
            KERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ + G
Sbjct  1    KERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFG  52


 Score = 38.1 bits (87),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  60   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  94



>ref|XP_010463453.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Camelina 
sativa]
Length=304

 Score = 43.5 bits (101),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = +1

Query  226  QGNGSVMASSSTLDCISQ-TGSALKERNY---lglsdsssvdssaasgvVNEKDRLNLKA  393
            Q N SV +SS T +CIS+ T  ALKE NY      S S    + +A    ++K  ++LKA
Sbjct  8    QSNVSVASSSPTSNCISRGTTVALKEHNYLGLSDCSSSVGSSTLSAGLTEDDKASISLKA  67

Query  394  TELRLGLPGSQ  426
            TEL LGLPGSQ
Sbjct  68   TELTLGLPGSQ  78


 Score = 36.6 bits (83),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 15/63 (24%)
 Frame = +3

Query  510  GIFSSVKASFTGNKRGFLDTME------GSVTTEANWMF-------TIPKSDSHTPQSAG  650
            G+  S K + +GNKRGF DTM+       SV TE NWMF       ++ K D   PQS  
Sbjct  73   GLPGSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATKSVTKKD--VPQSIP  130

Query  651  QGN  659
            +G 
Sbjct  131  KGQ  133



>gb|ADC29391.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=229

 Score = 41.2 bits (95),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEMG  453
            K  LN KATELRLGLP SQSP+R+ + G
Sbjct  20   KSNLNFKATELRLGLPESQSPERETDFG  47


 Score = 38.5 bits (88),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDT  569
            DEK LFPLLPSKD   ++   K   +GNKRGF DT
Sbjct  55   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADT  89



>gb|ADC29392.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=224

 Score = 41.2 bits (95),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +1

Query  370  KDRLNLKATELRLGLPGSQSPKRDLEMG  453
            K  LN KATELRLGLP SQSP+R+ + G
Sbjct  20   KSNLNFKATELRLGLPESQSPERETDFG  47


 Score = 38.1 bits (87),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  575
            DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  55   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  91



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score = 40.8 bits (94),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVNEKDR---LNLKATELRLGLPGSQSPKRDLEMG  453
             LK RNY GLSD SSVDSS     V + ++   LN KATELRLGLP SQSP+R+ + G
Sbjct  19   GLKVRNYFGLSDCSSVDSSTIHNRVQDGEKTSNLNFKATELRLGLPESQSPERETDFG  76


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 23/36 (64%), Gaps = 3/36 (8%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDT  569
            DEK LFPLLP KD   S+    K   +GNKRGF DT
Sbjct  84   DEKLLFPLLPCKDTAASATTEHKNVVSGNKRGFADT  119



>emb|CDY66936.1| BnaC02g47310D [Brassica napus]
Length=276

 Score = 42.0 bits (97),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 29/53 (55%), Gaps = 10/53 (19%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDGI--FSSVKASFTGNKRGFLDTMEGSVTTEANWMF  608
            S  K DE+P  PL+P KD I  FSS+K   +GNK         SV TE NW F
Sbjct  81   SYAKLDERPFLPLVPLKDEICPFSSLKNIASGNK--------SSVYTEKNWTF  125


 Score = 37.0 bits (84),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +1

Query  364  NEKDRLNLKATELRLGLPGSQSPKRDLEM  450
            ++K  + LKAT+L LGLPGS+SP RD ++
Sbjct  49   DDKAVIRLKATDLTLGLPGSRSPVRDTDL  77



>ref|XP_006850381.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score = 44.7 bits (104),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +1

Query  289  ALKERNYlglsdsssvdssaasgvVNEK-DRLNLKATELRLGLPGSQSPKRDLEM  450
             L+E NY+GLSD+SS++SS  +  + EK D LNLK TELRLGLPGS+SP RD E+
Sbjct  34   GLREHNYMGLSDASSLESSVITCPLEEKEDSLNLKETELRLGLPGSRSPVRDPEL  88


 Score = 33.9 bits (76),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (8%)
 Frame = +3

Query  465  KFDEKPLFPLLPSKDGIFSSVKAS---FTGNKRGFLDTME  575
            K DEK LFPL P K+            F+GNKRGF D ++
Sbjct  95   KLDEKALFPLAPLKENTSEEKNGRNGIFSGNKRGFSDAID  134



>emb|CDY45607.1| BnaCnng13150D [Brassica napus]
Length=329

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 34/51 (67%), Gaps = 2/51 (4%)
 Frame = +3

Query  462  GKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDTMEGS-VTTEANWMF  608
             K DEK  FPLLPSKD I  SS K   +GNKRGF DTM+   V TE NWMF
Sbjct  83   AKLDEKLFFPLLPSKDEICPSSQKNIASGNKRGFADTMDKVPVYTEKNWMF  133



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score = 43.1 bits (100),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 2/59 (3%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDLEMG  453
            T   LKERNY+GLSD SSVDSS     V++K  LN KATELRLGLP  SQSP+R+ + G
Sbjct  15   TSPGLKERNYMGLSDCSSVDSSTIPN-VDKKSSLNFKATELRLGLPESSQSPQRETDFG  72


 Score = 33.1 bits (74),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 19/31 (61%), Gaps = 8/31 (26%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFL  563
            DEK LFPLLP KD          +GNKRG+L
Sbjct  80   DEKLLFPLLPCKDHA--------SGNKRGYL  102



>gb|AAM76222.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  9    SSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  50



>gb|AAM76220.1| putative IAA-responsive protein 9 [Gossypium herbaceum]
Length=122

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  9    SSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  50



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score = 40.8 bits (94),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = +1

Query  280  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDLE  447
            T   LKERNY+GLSD SSVDSS     V++K  LN KATELRLGLP  SQSP+R+ +
Sbjct  15   TSPGLKERNYMGLSDCSSVDSSTIPN-VDKKSSLNFKATELRLGLPESSQSPQRETD  70


 Score = 33.1 bits (74),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 19/31 (61%), Gaps = 8/31 (26%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFL  563
            DEK LFPLLP KD          +GNKRG+L
Sbjct  80   DEKLLFPLLPCKDHA--------SGNKRGYL  102



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score = 40.4 bits (93),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 34/63 (54%), Gaps = 5/63 (8%)
 Frame = +1

Query  280  TGSALKERNY----lglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDL  444
            T + LKERNY       S   S          ++K  LN KATELRLGLP  SQSP+R+ 
Sbjct  15   TATCLKERNYLGLSDCSSSVDSSTVPNLVLDTDKKSSLNFKATELRLGLPESSQSPQRET  74

Query  445  EMG  453
            + G
Sbjct  75   DFG  77


 Score = 33.1 bits (74),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 19/31 (61%), Gaps = 8/31 (26%)
 Frame = +3

Query  471  DEKPLFPLLPSKDGIFSSVKASFTGNKRGFL  563
            DEK LFPLLP KD          +GNKRG+L
Sbjct  85   DEKLLFPLLPCKDHA--------SGNKRGYL  107



>gb|AAM76223.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKP FPL PS DG  F+S K+  +GNKRGF D M+G
Sbjct  9    SSSQLDEKPFFPLHPSSDGHCFASQKSVVSGNKRGFSDAMDG  50



>gb|AAM76221.1| putative IAA-responsive protein 9 [Gossypium raimondii]
Length=122

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKP FPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  9    SSSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  50



>gb|AAM76224.1| putative IAA-responsive protein 9 [Gossypioides kirkii]
Length=122

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  456  STGKFDEKPLFPLLPSKD-GIFSSVKASFTGNKRGFLDTMEG  578
            S+ + DEKPLFPL PS D   F+S K   +GNKRGF D M+G
Sbjct  9    SSSQLDEKPLFPLHPSSDVHCFASQKNVVSGNKRGFSDAMDG  50



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 10/66 (15%)
 Frame = +3

Query  420  ISISQARFRNG----------PSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDT  569
            IS+ +   R G          PS    DEKPLFPL P+ D   +S+K    GNKRGF D 
Sbjct  70   ISLKETELRLGLPGSQPLQREPSPSLLDEKPLFPLHPTGDDHCTSLKNVVFGNKRGFSDA  129

Query  570  MEGSVT  587
            MEG ++
Sbjct  130  MEGKLS  135



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420