BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033O21

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011008112.1|  PREDICTED: D-xylose-proton symporter-like 2        212   6e-62   Populus euphratica
gb|ABK95072.1|  unknown                                                 210   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002325479.2|  hypothetical protein POPTR_0019s08330g             207   1e-60   
gb|KDP21779.1|  hypothetical protein JCGZ_00566                         207   4e-60   Jatropha curcas
ref|XP_008376911.1|  PREDICTED: D-xylose-proton symporter-like 2        206   1e-59   Malus domestica [apple tree]
ref|XP_002520022.1|  sugar transporter, putative                        205   2e-59   
ref|XP_009361176.1|  PREDICTED: D-xylose-proton symporter-like 2        205   2e-59   Pyrus x bretschneideri [bai li]
gb|KJB26762.1|  hypothetical protein B456_004G258400                    202   4e-59   Gossypium raimondii
gb|KJB26763.1|  hypothetical protein B456_004G258400                    203   7e-59   Gossypium raimondii
gb|KJB26764.1|  hypothetical protein B456_004G258400                    202   2e-58   Gossypium raimondii
ref|XP_009351838.1|  PREDICTED: D-xylose-proton symporter-like 2        202   2e-58   Pyrus x bretschneideri [bai li]
gb|KDO39946.1|  hypothetical protein CISIN_1g0102391mg                  198   3e-58   Citrus sinensis [apfelsine]
gb|KDO39947.1|  hypothetical protein CISIN_1g0102391mg                  199   4e-58   Citrus sinensis [apfelsine]
gb|KDO39945.1|  hypothetical protein CISIN_1g0102391mg                  199   1e-57   Citrus sinensis [apfelsine]
gb|KDO39944.1|  hypothetical protein CISIN_1g0102391mg                  200   2e-57   Citrus sinensis [apfelsine]
ref|XP_008234574.1|  PREDICTED: D-xylose-proton symporter-like 2        199   3e-57   Prunus mume [ume]
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...    199   5e-57   Solanum tuberosum [potatoes]
ref|XP_007029560.1|  Major facilitator superfamily protein              198   9e-57   
ref|XP_008362818.1|  PREDICTED: D-xylose-proton symporter-like 2        198   9e-57   Malus domestica [apple tree]
ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like              198   1e-56   Solanum lycopersicum
ref|XP_010063233.1|  PREDICTED: D-xylose-proton symporter-like 2        197   2e-56   Eucalyptus grandis [rose gum]
ref|XP_006443190.1|  hypothetical protein CICLE_v10019791mg             196   2e-56   
ref|XP_006443191.1|  hypothetical protein CICLE_v10019791mg             197   4e-56   Citrus clementina [clementine]
ref|XP_004170091.1|  PREDICTED: D-xylose-proton symporter-like 2-...    194   1e-55   
ref|XP_004137173.1|  PREDICTED: D-xylose-proton symporter-like 2-...    195   2e-55   Cucumis sativus [cucumbers]
ref|XP_007219039.1|  hypothetical protein PRUPE_ppa004602mg             194   5e-55   Prunus persica
ref|XP_009777282.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    190   7e-54   Nicotiana sylvestris
ref|XP_011075803.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    190   9e-54   Sesamum indicum [beniseed]
ref|XP_011075802.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    191   1e-53   
ref|XP_009777280.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    191   1e-53   Nicotiana sylvestris
ref|XP_009777281.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    189   3e-53   Nicotiana sylvestris
ref|XP_008455657.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    186   3e-52   Cucumis melo [Oriental melon]
ref|XP_004505609.1|  PREDICTED: D-xylose-proton symporter-like 2-...    184   2e-51   Cicer arietinum [garbanzo]
ref|XP_003607412.1|  D-xylose-proton symporter-like protein             183   3e-51   Medicago truncatula
gb|AFK39030.1|  unknown                                                 182   9e-51   Medicago truncatula
gb|KHN05527.1|  D-xylose-proton symporter-like 2                        181   4e-50   Glycine soja [wild soybean]
ref|XP_003537722.1|  PREDICTED: D-xylose-proton symporter-like 2-...    181   4e-50   Glycine max [soybeans]
ref|XP_007131530.1|  hypothetical protein PHAVU_011G020700g             181   4e-50   Phaseolus vulgaris [French bean]
ref|XP_010495236.1|  PREDICTED: D-xylose-proton symporter-like 2        174   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002277076.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    178   4e-49   Vitis vinifera
gb|EYU43459.1|  hypothetical protein MIMGU_mgv1a004913mg                177   9e-49   Erythranthe guttata [common monkey flower]
ref|XP_006400240.1|  hypothetical protein EUTSA_v10013319mg             176   3e-48   Eutrema salsugineum [saltwater cress]
ref|XP_004307871.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    175   4e-48   Fragaria vesca subsp. vesca
ref|XP_010671130.1|  PREDICTED: D-xylose-proton symporter-like 2        175   4e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010087486.1|  D-xylose-proton symporter-like 2                   174   1e-47   
gb|KFK37751.1|  hypothetical protein AALP_AA3G025300                    174   2e-47   Arabis alpina [alpine rockcress]
ref|XP_011470132.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    173   2e-47   Fragaria vesca subsp. vesca
ref|XP_010420407.1|  PREDICTED: D-xylose-proton symporter-like 2        173   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010920045.1|  PREDICTED: D-xylose-proton symporter-like 2        173   3e-47   Elaeis guineensis
ref|XP_010453878.1|  PREDICTED: D-xylose-proton symporter-like 2        173   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010506301.1|  PREDICTED: D-xylose-proton symporter-like 1        172   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_009126155.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    172   4e-47   Brassica rapa
ref|XP_009126154.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    172   4e-47   Brassica rapa
ref|NP_001190323.1|  D-xylose-proton symporter-like 2                   171   6e-47   
ref|NP_850835.2|  D-xylose-proton symporter-like 2                      171   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KHN46451.1|  D-xylose-proton symporter-like 2                        171   2e-46   Glycine soja [wild soybean]
ref|XP_003540611.1|  PREDICTED: D-xylose-proton symporter-like 2-...    171   2e-46   Glycine max [soybeans]
emb|CDY28736.1|  BnaCnng06220D                                          171   2e-46   Brassica napus [oilseed rape]
emb|CDY38076.1|  BnaC02g06970D                                          170   2e-46   Brassica napus [oilseed rape]
ref|XP_010662115.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    169   7e-46   Vitis vinifera
ref|XP_002873804.1|  sugar transporter family protein                   169   1e-45   Arabidopsis lyrata subsp. lyrata
emb|CDX85478.1|  BnaA02g03350D                                          168   2e-45   
ref|XP_006287575.1|  hypothetical protein CARUB_v10000784mg             168   2e-45   
ref|XP_009613870.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    167   3e-45   Nicotiana tomentosiformis
ref|XP_002884358.1|  sugar transporter family protein                   166   8e-45   
ref|XP_006297488.1|  hypothetical protein CARUB_v10013506mg             166   1e-44   Capsella rubella
ref|XP_009130331.1|  PREDICTED: D-xylose-proton symporter-like 1        166   1e-44   Brassica rapa
gb|KFK25925.1|  hypothetical protein AALP_AA8G181200                    166   2e-44   Arabis alpina [alpine rockcress]
ref|XP_010933397.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    165   2e-44   
gb|EPS57619.1|  hypothetical protein M569_17198                         161   2e-44   Genlisea aurea
ref|XP_010933396.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    165   3e-44   Elaeis guineensis
ref|XP_010558647.1|  PREDICTED: D-xylose-proton symporter-like 2        165   3e-44   Tarenaya hassleriana [spider flower]
emb|CDY43152.1|  BnaA05g32340D                                          165   3e-44   Brassica napus [oilseed rape]
emb|CDP04938.1|  unnamed protein product                                164   6e-44   Coffea canephora [robusta coffee]
ref|NP_186959.2|  vacuolar glucose transporter 1                        164   6e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KDO39943.1|  hypothetical protein CISIN_1g0102391mg                  161   3e-43   Citrus sinensis [apfelsine]
ref|XP_004309072.1|  PREDICTED: D-xylose-proton symporter-like 2        162   3e-43   Fragaria vesca subsp. vesca
ref|XP_010463755.1|  PREDICTED: D-xylose-proton symporter-like 1        162   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009134719.1|  PREDICTED: D-xylose-proton symporter-like 1        159   2e-42   Brassica rapa
ref|XP_008809219.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    158   7e-42   
emb|CDX92030.1|  BnaC03g33320D                                          157   2e-41   
emb|CDY49922.1|  BnaCnng18320D                                          156   3e-41   Brassica napus [oilseed rape]
ref|XP_008791055.1|  PREDICTED: D-xylose-proton symporter-like 2        155   6e-41   
ref|XP_009119042.1|  PREDICTED: D-xylose-proton symporter-like 1        156   6e-41   Brassica rapa
ref|XP_003574402.1|  PREDICTED: D-xylose-proton symporter-like 2        155   7e-41   Brachypodium distachyon [annual false brome]
ref|XP_006408343.1|  hypothetical protein EUTSA_v10020565mg             154   3e-40   Eutrema salsugineum [saltwater cress]
ref|XP_009382608.1|  PREDICTED: D-xylose-proton symporter-like 2        154   3e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008644912.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    154   3e-40   Zea mays [maize]
dbj|BAJ88105.1|  predicted protein                                      153   4e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55132.1|  D-xylose-proton symporter-like 2                        153   7e-40   Triticum urartu
ref|XP_006662109.1|  PREDICTED: D-xylose-proton symporter-like 2-...    153   7e-40   Oryza brachyantha
ref|XP_008644913.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    152   1e-39   Zea mays [maize]
ref|XP_002464862.1|  hypothetical protein SORBIDRAFT_01g027800          152   1e-39   Sorghum bicolor [broomcorn]
ref|NP_001065505.1|  Os10g0579200                                       152   2e-39   
gb|EMT10196.1|  D-xylose-proton symporter-like protein 2                151   3e-39   
emb|CDX92028.1|  BnaC03g33300D                                          150   4e-39   
ref|XP_004983521.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    149   1e-38   
ref|XP_010489652.1|  PREDICTED: D-xylose-proton symporter-like 1        148   4e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006854111.1|  hypothetical protein AMTR_s00048p00147550          146   2e-37   Amborella trichopoda
gb|ADP37177.1|  putative vacuolar glucose transporter                   144   5e-37   Vitis vinifera
emb|CAN72732.1|  hypothetical protein VITISV_037854                     144   5e-37   Vitis vinifera
ref|XP_001773171.1|  predicted protein                                  141   1e-35   
ref|XP_003563522.2|  PREDICTED: D-xylose-proton symporter-like 3,...    137   3e-34   Brachypodium distachyon [annual false brome]
ref|XP_010261641.1|  PREDICTED: D-xylose-proton symporter-like 2        136   3e-34   Nelumbo nucifera [Indian lotus]
gb|ABK24923.1|  unknown                                                 136   5e-34   Picea sitchensis
ref|XP_004981232.1|  PREDICTED: D-xylose-proton symporter-like 3,...    136   7e-34   Setaria italica
gb|EMT28553.1|  D-xylose-proton symporter-like protein 3                134   7e-34   
ref|XP_006651969.1|  PREDICTED: D-xylose-proton symporter-like 3,...    135   8e-34   Oryza brachyantha
ref|XP_004953925.1|  PREDICTED: D-xylose-proton symporter-like 3,...    129   8e-34   
ref|XP_008222102.1|  PREDICTED: D-xylose-proton symporter-like 3,...    136   8e-34   Prunus mume [ume]
ref|NP_197203.1|  D-xylose-proton symporter-like 2                      135   9e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007016339.1|  Major facilitator superfamily protein isoform 4    134   1e-33   
dbj|BAJ95036.1|  predicted protein                                      135   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006590767.1|  PREDICTED: D-xylose-proton symporter-like 2-...    134   2e-33   
ref|XP_007207311.1|  hypothetical protein PRUPE_ppa003611mg             135   2e-33   Prunus persica
ref|XP_007016338.1|  Major facilitator superfamily protein isoform 3    134   2e-33   
ref|XP_010256836.1|  PREDICTED: D-xylose-proton symporter-like 3,...    135   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_007016337.1|  Major facilitator superfamily protein isoform 2    134   3e-33   
ref|XP_007016336.1|  Major facilitator superfamily protein isoform 1    134   3e-33   
ref|XP_008222111.1|  PREDICTED: D-xylose-proton symporter-like 3,...    134   4e-33   Prunus mume [ume]
ref|XP_008681531.1|  PREDICTED: uncharacterized protein LOC100274...    134   7e-33   
ref|XP_011035266.1|  PREDICTED: D-xylose-proton symporter-like 3,...    133   8e-33   Populus euphratica
ref|XP_011035268.1|  PREDICTED: D-xylose-proton symporter-like 3,...    133   8e-33   Populus euphratica
ref|XP_001760396.1|  predicted protein                                  132   2e-32   
ref|XP_006846330.1|  hypothetical protein AMTR_s00012p00255880          132   3e-32   Amborella trichopoda
ref|XP_007132040.1|  hypothetical protein PHAVU_011G061800g             131   5e-32   Phaseolus vulgaris [French bean]
gb|AFK37407.1|  unknown                                                 131   5e-32   Lotus japonicus
gb|KHN32151.1|  D-xylose-proton symporter-like 3, chloroplastic         131   5e-32   Glycine soja [wild soybean]
ref|XP_003539594.1|  PREDICTED: D-xylose-proton symporter-like 3,...    131   6e-32   Glycine max [soybeans]
gb|ACU20080.1|  unknown                                                 127   6e-32   Glycine max [soybeans]
ref|XP_010685696.1|  PREDICTED: D-xylose-proton symporter-like 3,...    130   8e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010907806.1|  PREDICTED: D-xylose-proton symporter-like 3,...    130   8e-32   Elaeis guineensis
gb|KDP42213.1|  hypothetical protein JCGZ_02943                         130   8e-32   Jatropha curcas
ref|XP_009605730.1|  PREDICTED: D-xylose-proton symporter-like 3,...    130   9e-32   Nicotiana tomentosiformis
ref|XP_009605737.1|  PREDICTED: D-xylose-proton symporter-like 3,...    130   1e-31   Nicotiana tomentosiformis
gb|KHN21925.1|  D-xylose-proton symporter-like 3, chloroplastic         130   1e-31   Glycine soja [wild soybean]
ref|XP_003537973.1|  PREDICTED: D-xylose-proton symporter-like 3,...    130   1e-31   Glycine max [soybeans]
gb|KHG28803.1|  hypothetical protein F383_00413                         130   2e-31   Gossypium arboreum [tree cotton]
gb|KJB20002.1|  hypothetical protein B456_003G129000                    129   2e-31   Gossypium raimondii
ref|XP_004163808.1|  PREDICTED: D-xylose-proton symporter-like 3,...    128   2e-31   
ref|XP_009381068.1|  PREDICTED: D-xylose-proton symporter-like 3,...    129   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB20003.1|  hypothetical protein B456_003G129000                    129   2e-31   Gossypium raimondii
ref|XP_008457451.1|  PREDICTED: D-xylose-proton symporter-like 3,...    129   2e-31   Cucumis melo [Oriental melon]
ref|XP_004294661.1|  PREDICTED: D-xylose-proton symporter-like 3,...    129   2e-31   Fragaria vesca subsp. vesca
gb|KJB20000.1|  hypothetical protein B456_003G129000                    129   3e-31   Gossypium raimondii
emb|CBI16087.3|  unnamed protein product                                128   4e-31   Vitis vinifera
ref|XP_003606724.1|  D-xylose-proton symporter-like protein             128   4e-31   
ref|XP_008777375.1|  PREDICTED: D-xylose-proton symporter-like 3,...    129   4e-31   Phoenix dactylifera
gb|AES88921.2|  sugar transporter                                       128   4e-31   Medicago truncatula
ref|XP_002280634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    128   5e-31   Vitis vinifera
ref|XP_004145283.1|  PREDICTED: D-xylose-proton symporter-like 3,...    128   7e-31   
ref|XP_010535453.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   7e-31   Tarenaya hassleriana [spider flower]
ref|XP_010535452.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   8e-31   Tarenaya hassleriana [spider flower]
ref|XP_010106537.1|  D-xylose-proton symporter-like 3                   127   9e-31   
ref|XP_009779937.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   1e-30   Nicotiana sylvestris
ref|XP_008349595.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   1e-30   
ref|XP_008384924.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   2e-30   
ref|XP_009779936.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   2e-30   Nicotiana sylvestris
ref|XP_009375941.1|  PREDICTED: D-xylose-proton symporter-like 3,...    127   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_011089518.1|  PREDICTED: D-xylose-proton symporter-like 3,...    126   3e-30   Sesamum indicum [beniseed]
gb|EYU45952.1|  hypothetical protein MIMGU_mgv1a003885mg                126   4e-30   Erythranthe guttata [common monkey flower]
ref|XP_006342314.1|  PREDICTED: D-xylose-proton symporter-like 3,...    125   5e-30   Solanum tuberosum [potatoes]
ref|XP_006401006.1|  hypothetical protein EUTSA_v10013139mg             125   7e-30   Eutrema salsugineum [saltwater cress]
gb|ABB17074.1|  putative sugar transporter                              125   1e-29   Nicotiana langsdorffii x Nicotiana sanderae
emb|CDX74227.1|  BnaA03g28200D                                          124   2e-29   
ref|XP_002992213.1|  hypothetical protein SELMODRAFT_134982             123   2e-29   
ref|XP_002982112.1|  hypothetical protein SELMODRAFT_115745             123   2e-29   
ref|XP_002866311.1|  hypothetical protein ARALYDRAFT_919128             122   6e-29   Arabidopsis lyrata subsp. lyrata
ref|NP_001287653.1|  D-xylose-proton symporter-like 3, chloroplas...    122   9e-29   Solanum lycopersicum
ref|XP_010443656.1|  PREDICTED: D-xylose-proton symporter-like 3,...    122   9e-29   Camelina sativa [gold-of-pleasure]
ref|NP_200733.2|  Major facilitator superfamily protein                 122   9e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KDO66624.1|  hypothetical protein CISIN_1g008624mg                   121   9e-29   Citrus sinensis [apfelsine]
dbj|BAE98379.1|  D-xylose-H+ symporter - like protein                   122   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279761.1|  hypothetical protein CARUB_v10027739mg             122   1e-28   Capsella rubella
ref|XP_010454633.1|  PREDICTED: D-xylose-proton symporter-like 3,...    122   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010483521.1|  PREDICTED: D-xylose-proton symporter-like 3,...    122   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006488378.1|  PREDICTED: D-xylose-proton symporter-like 3,...    122   1e-28   Citrus sinensis [apfelsine]
gb|KDO66619.1|  hypothetical protein CISIN_1g008624mg                   122   1e-28   Citrus sinensis [apfelsine]
gb|KDO66618.1|  hypothetical protein CISIN_1g008624mg                   121   1e-28   Citrus sinensis [apfelsine]
ref|XP_006488379.1|  PREDICTED: D-xylose-proton symporter-like 3,...    121   2e-28   
ref|XP_006424897.1|  hypothetical protein CICLE_v10028127mg             121   2e-28   Citrus clementina [clementine]
ref|XP_006424895.1|  hypothetical protein CICLE_v10028127mg             121   2e-28   
gb|KDO66623.1|  hypothetical protein CISIN_1g008624mg                   121   2e-28   Citrus sinensis [apfelsine]
gb|EEE60202.1|  hypothetical protein OsJ_13164                          119   6e-28   Oryza sativa Japonica Group [Japonica rice]
gb|AAO18445.1|  putative sugar transporter protein                      119   8e-28   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76432.1|  hypothetical protein OsI_14118                          119   1e-27   Oryza sativa Indica Group [Indian rice]
emb|CDP09100.1|  unnamed protein product                                119   2e-27   Coffea canephora [robusta coffee]
ref|XP_008681530.1|  PREDICTED: uncharacterized protein LOC100274...    119   2e-27   Zea mays [maize]
emb|CAN83894.1|  hypothetical protein VITISV_039113                     118   4e-27   Vitis vinifera
ref|XP_004951635.1|  PREDICTED: D-xylose-proton symporter-like 3,...    106   7e-25   
ref|XP_004951634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    105   1e-24   
ref|XP_008455658.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    105   3e-23   
ref|XP_002300123.2|  hypothetical protein POPTR_0001s25100g             107   3e-23   
gb|KDO66622.1|  hypothetical protein CISIN_1g008624mg                   104   7e-23   Citrus sinensis [apfelsine]
ref|XP_002520519.1|  sugar transporter, putative                        105   9e-23   
ref|XP_009120413.1|  PREDICTED: D-xylose-proton symporter-like 3,...    102   9e-22   Brassica rapa
emb|CDY33006.1|  BnaA10g12120D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_005845570.1|  hypothetical protein CHLNCDRAFT_25635              101   2e-21   Chlorella variabilis
emb|CDY54245.1|  BnaC09g53840D                                          100   4e-21   Brassica napus [oilseed rape]
ref|XP_010043498.1|  PREDICTED: D-xylose-proton symporter-like 3,...  99.0    2e-20   Eucalyptus grandis [rose gum]
gb|KJB20004.1|  hypothetical protein B456_003G129000                  95.5    3e-19   Gossypium raimondii
gb|ABF99614.1|  sugar transporter family protein, putative, expre...  92.8    3e-18   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH19966.1|  AT5G59250                                            89.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011400947.1|  D-xylose-proton symporter-like 3, chloroplastic  90.5    2e-17   Auxenochlorella protothecoides
gb|KHN18956.1|  D-xylose-proton symporter-like 3, chloroplastic       84.0    3e-17   Glycine soja [wild soybean]
gb|EPS59382.1|  hypothetical protein M569_15426                       85.9    4e-16   Genlisea aurea
emb|CBJ33077.1|  conserved unknown protein                            86.3    4e-16   Ectocarpus siliculosus
ref|XP_003062688.1|  major facilitator superfamily                    85.5    8e-16   Micromonas pusilla CCMP1545
gb|KIZ01781.1|  hypothetical protein MNEG_6180                        83.2    5e-15   Monoraphidium neglectum
gb|KDO66620.1|  hypothetical protein CISIN_1g008624mg                 79.7    5e-14   Citrus sinensis [apfelsine]
ref|XP_006424896.1|  hypothetical protein CICLE_v10028127mg           79.7    5e-14   
ref|XP_002179486.1|  TRD4                                             80.1    5e-14   Phaeodactylum tricornutum CCAP 1055/1
gb|KDD76485.1|  sugar transporter                                     80.1    6e-14   Helicosporidium sp. ATCC 50920
emb|CDY47336.1|  BnaCnng14730D                                        77.4    8e-14   Brassica napus [oilseed rape]
ref|XP_002501745.1|  sugar transporter                                77.8    4e-13   Micromonas commoda
ref|XP_009036253.1|  general sugar transporter                        77.4    5e-13   Aureococcus anophagefferens
ref|XP_005708849.1|  MFS transporter, SP family, sugar:H+ symporter   75.1    3e-12   Galdieria sulphuraria
ref|XP_005645204.1|  hypothetical protein COCSUDRAFT_67173            73.6    1e-11   Coccomyxa subellipsoidea C-169
emb|CEF97100.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcompl...  71.2    5e-11   Ostreococcus tauri
ref|XP_009032417.1|  hypothetical protein AURANDRAFT_18763            68.2    6e-10   Aureococcus anophagefferens
ref|XP_005831465.1|  hypothetical protein GUITHDRAFT_109605           65.9    2e-09   Guillardia theta CCMP2712
ref|XP_005783754.1|  hypothetical protein EMIHUDRAFT_232111           64.7    6e-09   Emiliania huxleyi CCMP1516
ref|XP_001416926.1|  MFS family transporter: sugar (galactose/glu...  64.7    7e-09   Ostreococcus lucimarinus CCE9901
gb|EWM26836.1|  d-xylose-proton symporter-like protein                63.5    2e-08   Nannochloropsis gaditana
gb|AFK44058.1|  unknown                                               59.7    2e-08   Lotus japonicus
gb|KJF15727.1|  putative metabolite transport protein CsbC            61.2    2e-08   Acidithrix ferrooxidans
ref|XP_009037217.1|  hypothetical protein AURANDRAFT_26890            62.8    3e-08   Aureococcus anophagefferens
ref|WP_007109838.1|  sugar transporter                                62.4    4e-08   
ref|WP_006185197.1|  sugar transporter                                62.4    4e-08   Natrinema pallidum
ref|WP_012945178.1|  major facilitator transporter                    62.4    4e-08   Haloterrigena turkmenica
ref|WP_014862590.1|  major facilitator transporter                    62.0    4e-08   Natrinema sp. J7-2
ref|WP_008455808.1|  sugar transporter                                62.0    5e-08   Natrinema gari
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...  62.0    5e-08   
ref|WP_013879135.1|  major facilitator transporter                    61.6    6e-08   Halopiger xanaduensis
ref|WP_006431848.1|  sugar transporter                                61.2    8e-08   Natrinema versiforme
ref|WP_033375544.1|  major facilitator transporter                    60.8    1e-07   
ref|WP_022906059.1|  major facilitator transporter                    60.8    1e-07   Curtobacterium sp. B18
ref|NP_001289249.1|  polyol transporter 5-like                        60.8    1e-07   Pyrus x bretschneideri [bai li]
ref|WP_030672845.1|  major facilitator transporter                    60.5    2e-07   Streptomyces rimosus
ref|NP_001281038.1|  polyol transporter 5-like                        60.5    2e-07   Malus domestica [apple tree]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like             60.5    2e-07   
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1         60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1         60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like             60.5    2e-07   Malus domestica [apple tree]
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1         60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1         60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|WP_007141639.1|  major facilitator transporter                    60.5    2e-07   Halobiforma lacisalsi
ref|WP_040615275.1|  major facilitator transporter                    60.1    2e-07   
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1         60.5    2e-07   Pyrus x bretschneideri [bai li]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1         60.5    2e-07   Pyrus x bretschneideri [bai li]
gb|EDP46643.1|  D-xylose-proton symporter                             60.1    2e-07   Rickettsiella grylli
ref|WP_006165530.1|  sugar transporter                                59.7    3e-07   Natrialba chahannaoensis
ref|WP_030599418.1|  major facilitator transporter                    59.7    3e-07   Streptomyces
ref|WP_030647441.1|  major facilitator transporter                    59.7    3e-07   Streptomyces rimosus
gb|KDN49529.1|  hypothetical protein RSAG8_02231                      59.7    3e-07   Rhizoctonia solani AG-8 WAC10335
ref|WP_033029764.1|  major facilitator transporter                    59.7    3e-07   Streptomyces rimosus
ref|WP_014112894.1|  major facilitator transporter                    59.7    3e-07   Bacillus
ref|WP_030627424.1|  major facilitator transporter                    59.7    3e-07   Streptomyces rimosus
ref|WP_031188849.1|  MULTISPECIES: major facilitator transporter      59.7    3e-07   Streptomyces
ref|WP_010333222.1|  major facilitator transporter                    59.7    3e-07   Bacillus mojavensis
gb|KDE57191.1|  major facilitator transporter                         59.7    3e-07   
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g           59.7    3e-07   Phaseolus vulgaris [French bean]
gb|ABJ68111.1|  D-xylose proton-symporter                             59.3    4e-07   Pediococcus pentosaceus ATCC 25745
ref|WP_019853934.1|  hypothetical protein                             59.3    4e-07   Actinopolyspora mortivallis
ref|WP_012944770.1|  major facilitator transporter                    59.3    4e-07   Haloterrigena turkmenica
ref|WP_041527006.1|  MFS transporter                                  59.3    4e-07   Pediococcus pentosaceus
ref|WP_010329048.1|  major facilitator transporter                    59.3    4e-07   Bacillus vallismortis
ref|WP_021296816.1|  sugar transporter                                59.3    4e-07   
ref|WP_039076066.1|  major facilitator transporter                    58.9    5e-07   Bacillus sp. MSP13
ref|WP_019713486.1|  major facilitator transporter                    58.9    5e-07   Bacillus subtilis
ref|WP_044444901.1|  major facilitator transporter                    58.9    5e-07   
ref|WP_041904829.1|  MULTISPECIES: major facilitator transporter      58.9    5e-07   Bacillus subtilis
ref|WP_003225652.1|  major facilitator transporter                    58.9    5e-07   Bacillus subtilis
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg           58.9    5e-07   Eutrema salsugineum [saltwater cress]
ref|WP_041017256.1|  major facilitator transporter                    58.9    5e-07   Criblamydia sequanensis
emb|CDR33502.1|  putative D-xylose-proton symporter                   58.9    6e-07   Criblamydia sequanensis CRIB-18
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1         58.9    6e-07   
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1         58.9    6e-07   Pyrus x bretschneideri [bai li]
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1       58.9    6e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1         58.9    6e-07   
ref|WP_006665058.1|  sugar transporter                                58.9    6e-07   
ref|WP_041707434.1|  sugar transporter                                58.5    6e-07   
ref|WP_033271459.1|  major facilitator transporter                    58.9    6e-07   
gb|ACV58590.1|  sugar transporter                                     58.5    6e-07   
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2       58.5    7e-07   
ref|WP_008893404.1|  sugar transporter                                58.5    7e-07   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like             58.5    7e-07   
ref|WP_008420814.1|  sugar transporter                                58.5    7e-07   
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like             58.5    7e-07   
gb|AGA20631.1|  Major myo-inositol transporter iolT                   58.5    7e-07   
gb|KFF56515.1|  major facilitator transporter                         58.5    7e-07   
gb|AFQ56541.1|  Myo-inositol transporter                              58.5    7e-07   
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like             58.5    7e-07   
gb|AGE62486.1|  myo-inositol transporter                              58.5    8e-07   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                  58.5    8e-07   
ref|WP_019257651.1|  major facilitator transporter                    58.5    8e-07   
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                  58.5    8e-07   
ref|WP_042977954.1|  major facilitator transporter                    58.5    8e-07   
ref|WP_019712787.1|  major facilitator transporter                    58.5    8e-07   
ref|NP_188513.1|  polyol transporter 5                                58.5    8e-07   
ref|WP_029726584.1|  major facilitator transporter                    58.5    8e-07   
ref|WP_014479040.1|  hypothetical protein                             58.5    8e-07   
ref|WP_021481323.1|  MULTISPECIES: major facilitator transporter      58.5    8e-07   
ref|WP_017697441.1|  major facilitator transporter                    58.5    8e-07   
ref|WP_015482889.1|  myo-inositol transporter                         58.5    8e-07   
ref|WP_003234027.1|  major facilitator transporter                    58.5    8e-07   
ref|WP_014476011.1|  major facilitator transporter                    58.5    8e-07   
ref|WP_014663039.1|  MULTISPECIES: major facilitator transporter      58.5    8e-07   
ref|WP_029317394.1|  major facilitator transporter                    58.2    8e-07   
ref|WP_033883858.1|  major facilitator transporter                    58.2    8e-07   
ref|WP_043858011.1|  major facilitator transporter                    58.2    8e-07   
ref|WP_042161078.1|  major facilitator transporter                    58.2    8e-07   
ref|WP_038827713.1|  MULTISPECIES: major facilitator transporter      58.2    8e-07   
ref|WP_019614605.1|  hypothetical protein                             58.2    8e-07   
ref|XP_001770766.1|  predicted protein                                58.5    8e-07   
ref|WP_018548781.1|  hypothetical protein                             58.2    9e-07   
ref|WP_041353098.1|  major facilitator transporter                    58.2    9e-07   
ref|WP_004397750.1|  major myo-inositol transporter IolT              58.2    9e-07   
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1         58.2    9e-07   
ref|WP_039630871.1|  major facilitator transporter                    58.2    9e-07   
ref|WP_044152820.1|  major facilitator transporter                    58.2    9e-07   
ref|WP_040057907.1|  major facilitator transporter                    58.2    9e-07   
ref|WP_019618635.1|  hypothetical protein                             58.2    9e-07   
ref|WP_019395389.1|  major facilitator transporter                    58.2    9e-07   
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1         58.2    9e-07   
emb|CDY61985.1|  BnaC03g73840D                                        58.2    1e-06   
gb|EMS55537.1|  Putative polyol transporter 1                         58.2    1e-06   
emb|CBI28072.3|  unnamed protein product                              58.2    1e-06   
ref|WP_037788820.1|  major facilitator transporter                    58.2    1e-06   
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                  58.2    1e-06   
gb|KHG12832.1|  Polyol transporter 5 -like protein                    55.8    1e-06   
ref|WP_044366898.1|  major facilitator transporter                    58.2    1e-06   
ref|WP_030813067.1|  major facilitator transporter                    58.2    1e-06   
ref|WP_037873465.1|  sugar transporter                                57.8    1e-06   
ref|WP_037069329.1|  MFS transporter                                  57.8    1e-06   
emb|CDI52095.1|  related to myo-inositol transporter                  58.2    1e-06   
ref|XP_005702976.1|  MFS transporter, SP family, sugar:H+ symporter   57.8    1e-06   
gb|EMT15229.1|  Putative polyol transporter 1                         57.8    1e-06   
ref|WP_005555141.1|  sugar transporter                                57.8    1e-06   
ref|WP_003986348.1|  MULTISPECIES: sugar-transport integral membr...  57.8    1e-06   
ref|WP_006826745.1|  sugar transporter                                57.8    1e-06   
ref|WP_029240085.1|  major facilitator transporter                    57.8    1e-06   
ref|WP_042831803.1|  major facilitator transporter                    57.8    1e-06   
ref|WP_030415817.1|  major facilitator transporter                    57.8    1e-06   
dbj|BAK00091.1|  predicted protein                                    57.8    1e-06   
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like             57.8    1e-06   
ref|WP_015321733.1|  MFS transporter, sugar porter family             57.4    1e-06   
ref|WP_033611623.1|  MFS transporter                                  57.4    1e-06   
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like             57.8    2e-06   
ref|WP_030370258.1|  major facilitator transporter                    57.4    2e-06   
gb|AEJ43404.1|  sugar transporter                                     57.4    2e-06   
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g           57.4    2e-06   
ref|WP_008105265.1|  MFS transporter, sugar porter family             57.4    2e-06   
ref|WP_024120422.1|  major facilitator transporter                    57.4    2e-06   
ref|WP_041695745.1|  sugar transporter                                57.4    2e-06   
ref|WP_006110627.1|  sugar transporter                                57.4    2e-06   
ref|WP_031002531.1|  major facilitator transporter                    57.4    2e-06   
ref|WP_035944149.1|  major facilitator transporter                    57.4    2e-06   
gb|EUC65437.1|  sugar porter (SP) family MFS transporter              57.4    2e-06   
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like             57.4    2e-06   
ref|XP_008188773.1|  PREDICTED: probable inositol transporter 2       57.0    2e-06   
gb|KEP51777.1|  MFS Myo-inositol transporter                          57.4    2e-06   
ref|WP_021509386.1|  major facilitator transporter                    57.0    2e-06   
ref|XP_003603886.1|  Mannitol transporter                             57.4    2e-06   
gb|AHG00573.1|  major facilitator transporter                         57.0    2e-06   
gb|AEK82124.1|  sugar transporter                                     57.0    2e-06   
ref|WP_043786128.1|  MFS transporter                                  57.0    2e-06   
ref|XP_002885281.1|  ATPLT5                                           57.0    2e-06   
ref|WP_040493029.1|  hypothetical protein                             57.0    2e-06   
ref|WP_033290406.1|  MFS transporter                                  57.0    2e-06   
gb|ACJ85869.1|  unknown                                               57.0    2e-06   
gb|KHN25361.1|  Polyol transporter 5                                  57.0    2e-06   
ref|WP_010078102.1|  major facilitator transporter                    57.0    3e-06   
ref|WP_030024002.1|  major facilitator transporter                    57.0    3e-06   
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like             57.0    3e-06   
gb|EJT97810.1|  hypothetical protein DACRYDRAFT_119041                57.0    3e-06   
ref|XP_003078139.1|  sugar transporter family protein (ISS)           56.6    3e-06   
ref|WP_043791672.1|  MFS transporter                                  56.6    3e-06   
gb|KJB12316.1|  hypothetical protein B456_002G011500                  56.6    3e-06   
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g           56.6    3e-06   
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1         56.6    3e-06   
ref|XP_001745016.1|  hypothetical protein                             56.6    3e-06   
ref|WP_018090578.1|  major facilitator transporter                    56.6    3e-06   
ref|XP_002519083.1|  sugar transporter, putative                      56.6    3e-06   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like             56.6    3e-06   
ref|WP_027736613.1|  major facilitator transporter                    56.6    3e-06   
ref|XP_007510995.1|  predicted protein                                56.6    3e-06   
ref|WP_018667676.1|  hypothetical protein                             56.6    3e-06   
ref|WP_007212778.1|  MULTISPECIES: hypothetical protein               56.2    3e-06   
ref|WP_026367882.1|  MULTISPECIES: hypothetical protein               56.2    3e-06   
gb|AAY86779.1|  putative sugar transporter protein                    55.8    3e-06   
ref|XP_006414919.1|  hypothetical protein EUTSA_v10026911mg           52.8    3e-06   
gb|KJB12315.1|  hypothetical protein B456_002G011400                  56.6    4e-06   
ref|WP_043661366.1|  IolT                                             56.2    4e-06   
ref|NP_001147446.1|  sorbitol transporter                             56.6    4e-06   
ref|WP_012086188.1|  major facilitator transporter                    56.2    4e-06   
gb|AAM44082.1|  putative sorbitol transporter                         56.6    4e-06   
ref|WP_040734328.1|  sugar transporter                                56.2    4e-06   
ref|WP_034830161.1|  IolT                                             56.2    4e-06   
ref|WP_044155627.1|  major facilitator transporter                    56.2    4e-06   
gb|EMS24444.1|  MFS myo-inositol transporter                          56.2    4e-06   
gb|AFK48916.1|  unknown                                               53.9    4e-06   
ref|WP_039336916.1|  IolT                                             56.2    4e-06   
ref|WP_030983849.1|  major facilitator transporter                    56.2    4e-06   
ref|XP_002972359.1|  hypothetical protein SELMODRAFT_97702            56.2    4e-06   
ref|WP_026546847.1|  major facilitator transporter                    56.2    4e-06   
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like             55.8    4e-06   
ref|WP_026540735.1|  major facilitator transporter                    56.2    4e-06   
emb|CEG30931.1|  major inositol transport protein IolT                56.2    5e-06   
gb|EKD78085.1|  hypothetical protein ACD_42C00046G0002                55.8    5e-06   
ref|WP_022898272.1|  MFS transporter                                  55.8    5e-06   
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like             55.8    5e-06   
ref|WP_021183684.1|  Major myo-inositol transporter IolT              55.8    5e-06   
ref|XP_002839096.1|  hypothetical protein                             54.7    5e-06   
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg           55.8    5e-06   
gb|EJY79631.1|  Sugar transporter protein                             55.8    5e-06   
ref|WP_008862673.1|  MFS transporter                                  55.8    5e-06   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6         55.8    6e-06   
ref|XP_007200584.1|  hypothetical protein PRUPE_ppa007633mg           55.5    6e-06   
gb|AEX55225.1|  sugar transporter                                     55.8    6e-06   
gb|KIQ06145.1|  major facilitator transporter                         55.5    7e-06   
ref|WP_031259001.1|  major facilitator transporter                    55.5    7e-06   
ref|WP_042539908.1|  major facilitator transporter                    55.5    7e-06   
ref|WP_007893467.1|  MFS transporter, sugar porter family             55.5    7e-06   
ref|WP_013227002.1|  MFS transporter                                  55.5    7e-06   
ref|WP_038224092.1|  arabinose-proton symporter                       55.5    7e-06   
gb|EYT66920.1|  major facilitator transporter                         55.5    7e-06   
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1         55.5    7e-06   
emb|CAJ29291.1|  putative polyol transporter protein 4                55.5    7e-06   
ref|WP_040508829.1|  MFS sugar transporter                            55.5    7e-06   
ref|XP_002313809.1|  putative sorbitol transporter family protein     55.5    7e-06   
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like             55.5    8e-06   
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1         55.5    8e-06   
ref|XP_642246.1|  sugar transporter family protein                    55.5    8e-06   
gb|EHH68038.1|  sugar-proton symporter                                55.5    8e-06   
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1         55.5    8e-06   
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1         55.5    8e-06   
gb|ETI34767.1|  hypothetical protein F443_18778                       55.5    8e-06   
gb|AAO74897.1|  putative Na+/myo-inositol symporter                   55.5    8e-06   
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590        55.5    8e-06   
dbj|GAD82443.1|  putative sugar transporter                           55.5    9e-06   
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like             55.5    9e-06   
ref|WP_008106285.1|  major facilitator transporter                    55.1    9e-06   
ref|XP_003620669.1|  Myo-inositol transporter                         55.5    9e-06   
ref|WP_044379014.1|  major facilitator transporter                    55.1    9e-06   
ref|WP_016574822.1|  sugar-transport integral membrane protein SugI   55.1    9e-06   
gb|KHN39768.1|  Polyol transporter 5                                  55.1    9e-06   
ref|XP_011409830.1|  PREDICTED: proton myo-inositol cotransporter...  55.1    9e-06   
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg           55.1    9e-06   
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840        55.1    9e-06   
dbj|BAM66296.1|  sorbitol transporter                                 55.1    1e-05   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...  55.1    1e-05   
ref|WP_041336785.1|  major facilitator transporter                    55.1    1e-05   
ref|WP_036836494.1|  MULTISPECIES: IolT                               55.1    1e-05   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like    55.1    1e-05   
ref|WP_012945458.1|  major facilitator transporter                    55.1    1e-05   
ref|WP_023049853.1|  MFS transporter, SP family                       55.1    1e-05   
ref|WP_027330048.1|  MFS transporter                                  55.1    1e-05   
ref|WP_027466006.1|  major facilitator transporter                    55.1    1e-05   
gb|KEH30426.1|  polyol/monosaccharide transporter 1                   55.1    1e-05   
ref|WP_017924492.1|  major facilitator transporter                    55.1    1e-05   
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                  55.1    1e-05   
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                  55.1    1e-05   
ref|WP_019554238.1|  hypothetical protein                             55.1    1e-05   
ref|WP_030813270.1|  sugar transporter                                55.1    1e-05   
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g           55.1    1e-05   
ref|WP_012735141.1|  major facilitator transporter                    54.7    1e-05   
ref|WP_036602590.1|  IolT                                             54.7    1e-05   
ref|XP_011274141.1|  Low-affinity glucose transporter HXT4            55.1    1e-05   
ref|WP_002492575.1|  major facilitator transporter                    54.7    1e-05   
gb|ABK29439.1|  sugar transport protein                               54.7    1e-05   
ref|WP_028403091.1|  major facilitator transporter                    54.7    1e-05   
ref|WP_040462400.1|  D-xylose-proton symporter                        54.7    1e-05   
gb|KEH30425.1|  polyol/monosaccharide transporter 1                   54.7    1e-05   
ref|WP_002460768.1|  major facilitator transporter                    54.7    1e-05   
gb|AAY88181.2|  mannitol transporter 1                                54.7    1e-05   
ref|XP_002972026.1|  hypothetical protein SELMODRAFT_441647           54.7    1e-05   
ref|WP_017611217.1|  hypothetical protein                             54.7    1e-05   
emb|CDO97075.1|  unnamed protein product                              54.7    1e-05   
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1  54.7    1e-05   
ref|WP_017577029.1|  hypothetical protein                             54.7    1e-05   
ref|XP_006958096.1|  general substrate transporter                    54.7    1e-05   
ref|XP_002972566.1|  hypothetical protein SELMODRAFT_148545           54.7    1e-05   
ref|WP_037544280.1|  major facilitator transporter                    54.7    1e-05   
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like             54.7    2e-05   
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like             54.7    2e-05   
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g           54.7    2e-05   
ref|WP_014280044.1|  major facilitator transporter                    54.7    2e-05   
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like             54.7    2e-05   
gb|EOD67100.1|  MFS arabinose transport protein                       54.3    2e-05   
ref|WP_042624335.1|  major facilitator transporter                    54.7    2e-05   
ref|WP_031179472.1|  sugar transporter                                54.3    2e-05   
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like             54.7    2e-05   
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                  54.3    2e-05   
ref|NP_001060109.2|  Os07g0582500                                     54.3    2e-05   
ref|WP_039332081.1|  D-xylose-proton symporter                        54.3    2e-05   
ref|WP_044269981.1|  hypothetical protein                             54.3    2e-05   
ref|WP_022883207.1|  major facilitator transporter                    54.3    2e-05   
ref|WP_030086030.1|  major facilitator transporter                    54.3    2e-05   
ref|WP_007432031.1|  major facilitator transporter                    54.3    2e-05   



>ref|XP_011008112.1| PREDICTED: D-xylose-proton symporter-like 2 [Populus euphratica]
Length=502

 Score =   212 bits (539),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ T SS+G+ GKSSGEIG V+EPLL+G     ENYS+ + I PFLFPALGGLLYGYD
Sbjct  4    DPEQPTLSSLGKAGKSSGEIGGVEEPLLNGGIHPSENYSLASAIFPFLFPALGGLLYGYD  63

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IG+TSCATISI+SAT SGISWYDL+SV IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  64   IGSTSCATISIKSATLSGISWYDLNSVDIGLITSGSLYGALIGSVLAFNIADFLGRRREL  123

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +L++ LYL+G L+TA APV+ +MVIGRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  124  ILAAFLYLVGALVTALAPVFAVMVIGRFVFGIGIGLAMHAAPMYIAETAP  173



>gb|ABK95072.1| unknown [Populus trichocarpa]
Length=502

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ T SS+G+ GKSSGEIG V+EPLL+G     ENYS+V+ I PFLFPALGGLLYGYD
Sbjct  4    DPEQPTLSSLGKVGKSSGEIGGVEEPLLNGGIHTSENYSLVSAIFPFLFPALGGLLYGYD  63

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IG+TSCATISI+SAT SGISWY+L+SV IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  64   IGSTSCATISIKSATLSGISWYNLNSVDIGLITSGSLYGALIGSVLAFNIADFLGRRREL  123

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +L++ LYL+G L+TA AP + +MVIGRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  124  ILAAFLYLVGALVTALAPAFAVMVIGRFVFGIGIGLAMHAAPMYIAETAP  173



>ref|XP_002325479.2| hypothetical protein POPTR_0019s08330g [Populus trichocarpa]
 gb|EEE99860.2| hypothetical protein POPTR_0019s08330g [Populus trichocarpa]
Length=446

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ T SS+G+ GKSSGEIG V+EPLL+G     ENYS+ + I PFLFPALGGLLYGYD
Sbjct  4    DPEQPTLSSLGKVGKSSGEIGGVEEPLLNGGIHTSENYSLASAIFPFLFPALGGLLYGYD  63

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IG+TSCATISI+SAT SGISWY+L+SV IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  64   IGSTSCATISIKSATLSGISWYNLNSVDIGLITSGSLYGALIGSVLAFNIADFLGRRREL  123

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +L++ LYL+G L+TA AP + +MVIGRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  124  ILAAFLYLVGALVTALAPAFAVMVIGRFVFGIGIGLAMHAAPMYIAETAP  173



>gb|KDP21779.1| hypothetical protein JCGZ_00566 [Jatropha curcas]
Length=501

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 154/174 (89%), Gaps = 2/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MATD PEQ + SS G+ GKSSGEI  V+EPLL+G+    ENYS+ A ILPFLFPALGGLL
Sbjct  1    MATD-PEQSSLSSFGKVGKSSGEIDGVEEPLLNGENSS-ENYSIAAAILPFLFPALGGLL  58

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGYDIG+TSCATI+IES+T SGISWY+L+SV+IGLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGSTSCATINIESSTFSGISWYNLNSVEIGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RREL+++++LYL+G L TA AP  VIMVIGRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  119  RRELIVAALLYLVGALATALAPDLVIMVIGRFVFGIGIGLAMHAAPMYIAETAP  172



>ref|XP_008376911.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ   SS+G+ GKSSGEIG  QEPLL G Q + ENYS++A ILPFLFPA GGLLYGYD
Sbjct  4    DPEQHAPSSLGKVGKSSGEIGDAQEPLLEGAQ-NSENYSLIAAILPFLFPAFGGLLYGYD  62

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATSCATISIESAT SG+SWY+LSSV+IGLITSGSLYGALIGS LAFNIADFLGRRREL
Sbjct  63   IGATSCATISIESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLLAFNIADFLGRRREL  122

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +L+++LYL+GGL+TA AP   +MVIGR +YG+GIGLAMHAAPMYIAET+P
Sbjct  123  ILAALLYLLGGLVTALAPDLPVMVIGRLIYGIGIGLAMHAAPMYIAETAP  172



>ref|XP_002520022.1| sugar transporter, putative [Ricinus communis]
 gb|EEF42346.1| sugar transporter, putative [Ricinus communis]
Length=502

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 154/174 (89%), Gaps = 1/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA  D EQ +FSS+G+ GKSSGEI   +EPLL+G     E YS++A +LPFLFPALGGLL
Sbjct  1    MAATDLEQPSFSSLGKVGKSSGEIDGAEEPLLNGGSSS-EYYSILAAVLPFLFPALGGLL  59

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGYDIGATSCATI+IESATSSGISWY+L++VQ+GLITSGSLYGALIGS +AFNIADFLGR
Sbjct  60   YGYDIGATSCATITIESATSSGISWYNLNAVQLGLITSGSLYGALIGSVVAFNIADFLGR  119

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RREL+++++LYL+G L+T  AP +V+MVIGRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  120  RRELIVAALLYLVGALVTGLAPDFVVMVIGRFVYGIGIGLAMHAAPMYIAETAP  173



>ref|XP_009361176.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ   SS+G+ GKSSGEIG  QEPLL G   + ENYS++A ILPFLFPA GGLLYGYD
Sbjct  4    DPEQHAPSSLGKVGKSSGEIGDAQEPLLDGAH-NSENYSLIAAILPFLFPAFGGLLYGYD  62

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATSCATISIESAT SG+SWY+LSSV+IGLITSGSLYGALIGS LAFN+ADFLGRRREL
Sbjct  63   IGATSCATISIESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLLAFNVADFLGRRREL  122

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ML+++LYL+GGL+TA AP   +MVIGRF+YG+GIGLAMHAAPMYIAET+P
Sbjct  123  MLAALLYLLGGLVTALAPDLPVMVIGRFIYGIGIGLAMHAAPMYIAETAP  172



>gb|KJB26762.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=395

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA+D  EQ   SS+G+ G+SSGEIGS  EPL++G     E+YS  A ILPFLFPALGGLL
Sbjct  1    MASDH-EQPGLSSLGKVGRSSGEIGSEHEPLVNGIHTS-ESYSASAAILPFLFPALGGLL  58

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGYDIGATSCATISIESAT SGISWYDLSSV++GLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGATSCATISIESATLSGISWYDLSSVEVGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RREL+++SI+YL+G L+TAFAP  V+MVIGRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  119  RRELIMASIMYLVGALVTAFAPNLVVMVIGRFVYGIGIGLAMHAAPMYIAETAP  172



>gb|KJB26763.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=460

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             D EQ   SS+G+ G+SSGEIGS  EPL++G     E+YS  A ILPFLFPALGGLLYGY
Sbjct  3    SDHEQPGLSSLGKVGRSSGEIGSEHEPLVNGIHTS-ESYSASAAILPFLFPALGGLLYGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATISIESAT SGISWYDLSSV++GLITSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSCATISIESATLSGISWYDLSSVEVGLITSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++SI+YL+G L+TAFAP  V+MVIGRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  122  LIMASIMYLVGALVTAFAPNLVVMVIGRFVYGIGIGLAMHAAPMYIAETAP  172



>gb|KJB26764.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=501

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             D EQ   SS+G+ G+SSGEIGS  EPL++G     E+YS  A ILPFLFPALGGLLYGY
Sbjct  3    SDHEQPGLSSLGKVGRSSGEIGSEHEPLVNGIHTS-ESYSASAAILPFLFPALGGLLYGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATISIESAT SGISWYDLSSV++GLITSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSCATISIESATLSGISWYDLSSVEVGLITSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++SI+YL+G L+TAFAP  V+MVIGRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  122  LIMASIMYLVGALVTAFAPNLVVMVIGRFVYGIGIGLAMHAAPMYIAETAP  172



>ref|XP_009351838.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ   SS+ + GKSSGEIG  QEPLL+G   + ENYS++A ILPFLFPALGGLLYGY
Sbjct  3    SDPEQPALSSLAKVGKSSGEIGDTQEPLLNGVH-NSENYSLIAAILPFLFPALGGLLYGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATIS+ESAT SG+SWY+LSSV+IGLITSGSLYGALIGS +AFNIADFLGRRRE
Sbjct  62   DIGATSCATISVESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLMAFNIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+++LYL+G L+TA AP   +MVIGR VYG+GIGLAMHAAPMYIAET+P
Sbjct  122  LILAALLYLLGALVTAVAPNLPVMVIGRLVYGIGIGLAMHAAPMYIAETAP  172



>gb|KDO39946.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=355

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPMYIAETAP  177



>gb|KDO39947.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=381

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPMYIAETAP  177



>gb|KDO39945.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=451

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPMYIAETAP  177



>gb|KDO39944.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=487

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPMYIAETAP  177



>ref|XP_008234574.1| PREDICTED: D-xylose-proton symporter-like 2 [Prunus mume]
Length=500

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ   SS+ Q G SSGE+G  QEPLL G   + ENYSV+A ILPFLFPALGGLLYGY
Sbjct  3    SDPEQPRLSSL-QKGGSSGELGDAQEPLLSGVH-NSENYSVLAAILPFLFPALGGLLYGY  60

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATIS+ES TSSGISWY+LSSV+IGLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  61   DIGATSCATISVESPTSSGISWYNLSSVEIGLITSGSLYGALIGSLLAFNVADFLGRRRE  120

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ILYL+G L+TA AP   +MVIGRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  121  LISAAILYLLGALVTALAPDLPVMVIGRFVFGIGIGLAMHAAPMYIAETAP  171



>ref|XP_006347568.1| PREDICTED: D-xylose-proton symporter-like 2-like [Solanum tuberosum]
Length=503

 Score =   199 bits (506),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = +2

Query  104  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            MAT +DPEQL  SSI +   SS EI  V+EPLL G+  H ENYS+ + +LPFLFPA GGL
Sbjct  1    MATANDPEQLIVSSIDKGENSSSEINIVREPLLKGEH-HAENYSIRSAVLPFLFPAFGGL  59

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            LYGYDIGATS ATISIESA+ SGISWYDLSSVQ GLITSGSLYGALIGS +AF IAD+LG
Sbjct  60   LYGYDIGATSSATISIESASLSGISWYDLSSVQTGLITSGSLYGALIGSAVAFQIADWLG  119

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RRREL++S++ Y +G L+TAFAPVYVI+VIGR +YGVGIGLAMHAAPMYIAET+P
Sbjct  120  RRRELIVSALFYFLGALVTAFAPVYVILVIGRLLYGVGIGLAMHAAPMYIAETAP  174



>ref|XP_007029560.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY10062.1| Major facilitator superfamily protein [Theobroma cacao]
Length=501

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 149/174 (86%), Gaps = 2/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA+D  EQ   SS G+ GKSSGEIG+  EPL++G     ENYS  A I PFLFPALGGLL
Sbjct  1    MASDH-EQPGLSSFGKVGKSSGEIGAEHEPLINGIHSS-ENYSASAAIFPFLFPALGGLL  58

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGYDIG+TSCATISIESA+ SG+SWYDLSSV+IGLITSGSLYGALIGS LAFNIADFLGR
Sbjct  59   YGYDIGSTSCATISIESASLSGMSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADFLGR  118

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RREL+ ++I+YL+G L+TAFAP  V+MVIGR VYG+GIGLAMHAAPMYIAET+P
Sbjct  119  RRELITAAIMYLVGALVTAFAPDLVVMVIGRLVYGIGIGLAMHAAPMYIAETAP  172



>ref|XP_008362818.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPE+   SS+ +  KSSGEIG  QEPLL+G   + ENYS++A ILPFLFPALGGLLYGY
Sbjct  3    SDPEKPALSSLAKVRKSSGEIGDTQEPLLNGVH-NSENYSLIAAILPFLFPALGGLLYGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATIS+ESAT SG+SWY+LSSV+IGLITSGSLYGALIGS +AFNIADFLGRRRE
Sbjct  62   DIGATSCATISVESATLSGVSWYNLSSVEIGLITSGSLYGALIGSLMAFNIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+++LYL+G L+TA AP   +MVIGR VYG+GIGLAMHAAPMYIAET+P
Sbjct  122  LILAALLYLLGALVTAVAPDLPVMVIGRLVYGIGIGLAMHAAPMYIAETAP  172



>ref|NP_001288106.1| D-xylose-proton symporter-like 2-like [Solanum lycopersicum]
 dbj|BAO96239.1| vacuolar glucose transporter 2 [Solanum lycopersicum]
Length=503

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = +2

Query  104  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            MAT  D EQL  SSI +   SS EI  V+EPLL G+  H ENYSV++ +LPFLFPA GGL
Sbjct  1    MATAHDTEQLIVSSIDKGENSSSEINIVREPLLEGEH-HAENYSVLSAVLPFLFPAFGGL  59

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            LYGYDIGATS ATISIESAT SGISWYDLSSVQ GLITSGSLYGALIGS +AF IAD+LG
Sbjct  60   LYGYDIGATSSATISIESATLSGISWYDLSSVQTGLITSGSLYGALIGSAVAFQIADWLG  119

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RRREL++S++ Y +G L+TAFAPVYVI+VIGR +YGVGIGLAMHAAPMYIAET+P
Sbjct  120  RRRELIVSALFYFLGALVTAFAPVYVILVIGRLLYGVGIGLAMHAAPMYIAETAP  174



>ref|XP_010063233.1| PREDICTED: D-xylose-proton symporter-like 2 [Eucalyptus grandis]
 gb|KCW90943.1| hypothetical protein EUGRSUZ_A02968 [Eucalyptus grandis]
Length=503

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIG-SVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            DPE+ T SS+ + GKSSGEIG + QEPL++G     ++YSV A +LPFLFPALGGLLYGY
Sbjct  4    DPERPTRSSLAKVGKSSGEIGDATQEPLINGNGGIPDSYSVAAAVLPFLFPALGGLLYGY  63

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATIS+ESAT SGISWYDLSS+QIGLITSGSLYGALIGS LAF+IADF+GRRRE
Sbjct  64   DIGATSCATISVESATLSGISWYDLSSLQIGLITSGSLYGALIGSVLAFSIADFIGRRRE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+S+LYL+G LITA AP + +MV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  124  LILASVLYLVGALITALAPDFAVMVVGRFVFGIGIGLAMHAAPMYIAETAP  174



>ref|XP_006443190.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 gb|ESR56430.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=451

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWY LSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYGLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPMYIAETAP  177



>ref|XP_006443191.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 ref|XP_006478911.1| PREDICTED: D-xylose-proton symporter-like 2-like [Citrus sinensis]
 gb|ESR56431.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=506

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 5/178 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWY LSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYGLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVFGIGIGLAMHAAPMYIAETAP  177



>ref|XP_004170091.1| PREDICTED: D-xylose-proton symporter-like 2-like, partial [Cucumis 
sativus]
Length=459

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  110  TDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  289
            T D  +L  SS+G+ G+SSGEI +V+EPL+  +  H EN+S  A ILPFLFPALGGLLYG
Sbjct  2    TSDHRELVLSSLGKVGQSSGEIDNVEEPLISVEFKHSENFSARAAILPFLFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            YDIGATSCATIS++SA+SSGISWY+LSSV++GL+TSGSLYGALIGS LAFN+ADFLGRRR
Sbjct  62   YDIGATSCATISLQSASSSGISWYNLSSVEVGLVTSGSLYGALIGSVLAFNVADFLGRRR  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+LS+++YL+G +IT  AP +VI++IGR + G GIGLAMHAAPMYIAETSP
Sbjct  122  ELILSALMYLVGAIITGLAPNFVILIIGRIISGTGIGLAMHAAPMYIAETSP  173



>ref|XP_004137173.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cucumis sativus]
 gb|KGN53693.1| hypothetical protein Csa_4G106860 [Cucumis sativus]
Length=502

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = +2

Query  110  TDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  289
            T D  +L  SS+G+ G+SSGEI +V+EPL+  +  H EN+S  A ILPFLFPALGGLLYG
Sbjct  2    TSDHRELVLSSLGKVGQSSGEIDNVEEPLISVEFKHSENFSARAAILPFLFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            YDIGATSCATIS++SA+SSGISWY+LSSV++GL+TSGSLYGALIGS LAFN+ADFLGRRR
Sbjct  62   YDIGATSCATISLQSASSSGISWYNLSSVEVGLVTSGSLYGALIGSVLAFNVADFLGRRR  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+LS+++YL+G +IT  AP +VI++IGR + G GIGLAMHAAPMYIAETSP
Sbjct  122  ELILSALMYLVGAIITGLAPNFVILIIGRIISGTGIGLAMHAAPMYIAETSP  173



>ref|XP_007219039.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
 gb|EMJ20238.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
Length=500

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             D EQ   SS+ Q G SS E+G  QEPLL+G   + ENYSV+A ILPFLFPALGGLLYGY
Sbjct  3    SDSEQPRLSSL-QKGGSSVELGDAQEPLLNGVH-NSENYSVLAAILPFLFPALGGLLYGY  60

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATIS+ES TSSGISWY+LSSV+IGLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  61   DIGATSCATISVESPTSSGISWYNLSSVEIGLITSGSLYGALIGSLLAFNVADFLGRRRE  120

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ILYL+G L+TA AP   +MVIGRFV+G+GIGLAMHAAPMYIAET+P
Sbjct  121  LISAAILYLLGALVTALAPDLPVMVIGRFVFGIGIGLAMHAAPMYIAETAP  171



>ref|XP_009777282.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009777283.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
Length=498

 Score =   190 bits (483),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 145/175 (83%), Gaps = 7/175 (4%)
 Frame = +2

Query  104  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            MAT  DPEQ   S         GEI +V+EPLL G+  H ENYS+ + ILPFLFPA GGL
Sbjct  1    MATASDPEQPIVSF-----TDKGEINNVREPLLKGEH-HPENYSIRSAILPFLFPAFGGL  54

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            LYGYDIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LG
Sbjct  55   LYGYDIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFKIADWLG  114

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RRREL++S++ Y +G L+TAFAPVYVIMVIGR +YGVGIGLAMHAAPMYIAET+P
Sbjct  115  RRRELIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPMYIAETAP  169



>ref|XP_011075803.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Sesamum 
indicum]
Length=502

 Score =   190 bits (483),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             D EQ  FS   + GKSS E   ++EPLL       E++SV++ ILPFLFPA GGLLYGY
Sbjct  3    SDVEQPAFSYRAKNGKSSAETDGIEEPLLKNDSREYEHFSVLSAILPFLFPAFGGLLYGY  62

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+SATSSGISWY+LS V++GLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  63   DIGATSSATISIKSATSSGISWYNLSPVEVGLITSGSLYGALIGSVLAFNVADFLGRRRE  122

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+LSS++YLIG L+TA AP +VIMVIGRF+YG+GIGLAMHAAPMYIAET+P
Sbjct  123  LILSSLMYLIGALVTALAPNFVIMVIGRFIYGIGIGLAMHAAPMYIAETAP  173



>ref|XP_011075802.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Sesamum 
indicum]
Length=524

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             D EQ  FS   + GKSS E   ++EPLL       E++SV++ ILPFLFPA GGLLYGY
Sbjct  25   SDVEQPAFSYRAKNGKSSAETDGIEEPLLKNDSREYEHFSVLSAILPFLFPAFGGLLYGY  84

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+SATSSGISWY+LS V++GLITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  85   DIGATSSATISIKSATSSGISWYNLSPVEVGLITSGSLYGALIGSVLAFNVADFLGRRRE  144

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+LSS++YLIG L+TA AP +VIMVIGRF+YG+GIGLAMHAAPMYIAET+P
Sbjct  145  LILSSLMYLIGALVTALAPNFVIMVIGRFIYGIGIGLAMHAAPMYIAETAP  195



>ref|XP_009777280.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Nicotiana 
sylvestris]
Length=555

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 145/175 (83%), Gaps = 7/175 (4%)
 Frame = +2

Query  104  MAT-DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            MAT  DPEQ   S         GEI +V+EPLL G+  H ENYS+ + ILPFLFPA GGL
Sbjct  58   MATASDPEQPIVSF-----TDKGEINNVREPLLKGEH-HPENYSIRSAILPFLFPAFGGL  111

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            LYGYDIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LG
Sbjct  112  LYGYDIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFKIADWLG  171

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RRREL++S++ Y +G L+TAFAPVYVIMVIGR +YGVGIGLAMHAAPMYIAET+P
Sbjct  172  RRRELIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPMYIAETAP  226



>ref|XP_009777281.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 142/171 (83%), Gaps = 6/171 (4%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ   S         GEI +V+EPLL G+  H ENYS+ + ILPFLFPA GGLLYGY
Sbjct  15   SDPEQPIVSF-----TDKGEINNVREPLLKGEH-HPENYSIRSAILPFLFPAFGGLLYGY  68

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LGRRRE
Sbjct  69   DIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFKIADWLGRRRE  128

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++S++ Y +G L+TAFAPVYVIMVIGR +YGVGIGLAMHAAPMYIAET+P
Sbjct  129  LIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPMYIAETAP  179



>ref|XP_008455657.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Cucumis 
melo]
Length=502

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            D      SS+G+ G+SSGEI +V+EPL+  +  + EN+S  A ILPFLFPALGGLLYGYD
Sbjct  4    DHRHPVLSSLGKVGQSSGEIDNVEEPLVSVEFKNSENFSARAAILPFLFPALGGLLYGYD  63

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATSCATIS++SA+SSGISWY+LSSV++GL+TSGSLYGALIGS LAFN+ADFLGRRREL
Sbjct  64   IGATSCATISLQSASSSGISWYNLSSVEVGLVTSGSLYGALIGSVLAFNVADFLGRRREL  123

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +LS+++YL+G +IT  AP + I++IGRF+ G GIGLAMHAAPMYIAETSP
Sbjct  124  ILSALMYLVGAIITGLAPNFAILIIGRFISGTGIGLAMHAAPMYIAETSP  173



>ref|XP_004505609.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cicer arietinum]
Length=502

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 145/174 (83%), Gaps = 1/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA+D  +Q   SS  + GKSS E  S +EPLL+G +   ENYS+ A ILPFLFPA GGLL
Sbjct  1    MASDPEQQPPLSSFSKEGKSSREDRSAREPLLNGVRGS-ENYSISAAILPFLFPAFGGLL  59

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            +GYDIGATS ATISI+S + SGI+WYDL SV+IGL+TSGSLYGALIGS LAFNIADFLGR
Sbjct  60   FGYDIGATSSATISIQSPSQSGITWYDLGSVEIGLLTSGSLYGALIGSLLAFNIADFLGR  119

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RREL+++S+LYL+G LITA AP Y I+V+GR V+G+GIGLAMHAAPMYIAET+P
Sbjct  120  RRELIVASLLYLVGALITALAPNYPILVVGRLVFGIGIGLAMHAAPMYIAETAP  173



>ref|XP_003607412.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 ref|XP_003607415.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 gb|AES89609.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=501

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllygy  292
            DPEQ   SS  Q GKSS E+ S +EPLL+G   H+ ++YS+ A ILPFLFPA GGLL+GY
Sbjct  4    DPEQPPLSSFSQEGKSSTEVRSEREPLLNGI--HVPQDYSLSAAILPFLFPAFGGLLFGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+S++ SGI+WYDL +V+IGL+TSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSSATISIQSSSLSGITWYDLDAVEIGLLTSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++++YL+G LITAFAP + ++VIGR V+G+GIGLAMHAAPMYIAET+P
Sbjct  122  LLVAALMYLVGALITAFAPNFPLLVIGRLVFGIGIGLAMHAAPMYIAETAP  172



>gb|AFK39030.1| unknown [Medicago truncatula]
Length=501

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllygy  292
            DPEQ   SS  Q GKSS E+ S +EPLL+G   H+ ++YS+ A ILPFLFPA GGLL+GY
Sbjct  4    DPEQPPLSSFSQEGKSSTEVRSEREPLLNGI--HVPQDYSLSAAILPFLFPAFGGLLFGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+S++ SGI+WYDL +V+IGL+TSGSLYGALIGS LAFNIADFLGRRRE
Sbjct  62   DIGATSSATISIQSSSLSGITWYDLDAVEIGLLTSGSLYGALIGSVLAFNIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++++YL+G LITAFAP + +++IGR V+G+GIGLAMHAAPMYIAET+P
Sbjct  122  LLVAALMYLVGALITAFAPNFPLLLIGRLVFGIGIGLAMHAAPMYIAETAP  172



>gb|KHN05527.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=501

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ   SS  +  +S GEIGS  EPLL+G     E+YSV A ILPFLFPALGGLL+GY
Sbjct  3    SDPEQPAHSSFAKEARSGGEIGSAIEPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+S T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+E
Sbjct  62   DIGATSSATISIQSPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSLLAFNVADFLGRRKE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++++YL+G L+TA AP + ++V+GR V+G+GIGLAMHAAPMYIAET+P
Sbjct  122  LIGAAVVYLVGALVTALAPNFPVLVLGRLVFGIGIGLAMHAAPMYIAETAP  172



>ref|XP_003537722.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X1 [Glycine 
max]
Length=501

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ   SS  +  +S GEIGS  EPLL+G     E+YSV A ILPFLFPALGGLL+GY
Sbjct  3    SDPEQPAHSSFAKEARSGGEIGSAIEPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+S T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+E
Sbjct  62   DIGATSSATISIQSPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSLLAFNVADFLGRRKE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++++YL+G L+TA AP + ++V+GR V+G+GIGLAMHAAPMYIAET+P
Sbjct  122  LIGAAVVYLVGALVTALAPNFPVLVLGRLVFGIGIGLAMHAAPMYIAETAP  172



>ref|XP_007131530.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
 gb|ESW03524.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
Length=498

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 143/171 (84%), Gaps = 4/171 (2%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ T +   + G SSGEIGS +EPLL G   H E+YS+ A ILPFLFPA GGLL+GY
Sbjct  3    SDPEQPTSA---KEGSSSGEIGSAREPLLIGVH-HSESYSLSAAILPFLFPAFGGLLFGY  58

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISI+S T SG+SWY LSS++IGL+TSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  59   DIGATSSATISIQSPTLSGVSWYQLSSIEIGLLTSGSLYGALIGSLLAFNVADFLGRRRE  118

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L+TAFAP + ++V+GR ++G GIGLAMHAAPMYIAET+P
Sbjct  119  LIVAALLYFVGALVTAFAPNFSVLVLGRLIFGTGIGLAMHAAPMYIAETAP  169



>ref|XP_010495236.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=259

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            DPEQ   SS+ +  GKSSGEI S +EPL+  ++ H+ ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSSGEISSEREPLI--KENHVPENYSVVAAILPFFFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATIS++S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+LS++LYLIG L+TA AP+Y +++IGR  YGV +GLAMHAAPMYIAET+P
Sbjct  122  ELILSALLYLIGALVTALAPIYSVLIIGRVTYGVSVGLAMHAAPMYIAETAP  173



>ref|XP_002277076.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Vitis 
vinifera]
 emb|CBI26530.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            D EQ + +S+G+ GKSSGEI  +QEPL+ G     ENYSV A ILPFLFPALGGLLYGYD
Sbjct  3    DLEQPSLTSLGKVGKSSGEIDGMQEPLIDGVGSS-ENYSVAAAILPFLFPALGGLLYGYD  61

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATSCA ISIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRREL
Sbjct  62   IGATSCALISIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRREL  121

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +L+++LYL+G L+TA AP +++MVIGRFV+G+GIGL+MHAAPMYIAET+P
Sbjct  122  ILAALLYLVGALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPMYIAETAP  171



>gb|EYU43459.1| hypothetical protein MIMGU_mgv1a004913mg [Erythranthe guttata]
Length=504

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLL-HGQQPHIENYSVVACIlpflfpalggllygy  292
            D E  T S   +  K SGEI +VQ+PLL + +    E +SVV+ ILPFLFPA GGLLYGY
Sbjct  4    DVESPTISFPAKNVKYSGEIDAVQQPLLENNKSTECEEFSVVSAILPFLFPAFGGLLYGY  63

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+ I+SAT SG+SWY+LSSVQ+GLITSGSLYGALIGS LA+ +ADFLGRRRE
Sbjct  64   DIGATSSATLLIQSATLSGVSWYNLSSVQVGLITSGSLYGALIGSILAYTVADFLGRRRE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L LSS++Y +G  +TAFAP +V++VIGR VYG+GIGLAMHAAPMYIAET+P
Sbjct  124  LGLSSVMYFVGATVTAFAPTFVVLVIGRVVYGIGIGLAMHAAPMYIAETAP  174



>ref|XP_006400240.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
 gb|ESQ41693.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
Length=502

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSI-GQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            DPEQ   SS+ G+ GKSSGEI + +EPL+  +  HI ENY+VV+ ILPFLFPALGGLLYG
Sbjct  4    DPEQRPTSSVFGEVGKSSGEIRTEREPLI--KDNHIPENYTVVSAILPFLFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATISI+S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF+IAD +GRR+
Sbjct  62   YEIGATSCATISIQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFSIADVIGRRK  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+L++ L+L+G L+TA AP+Y +++IGR  YGVG+GLAMHAAPMYIAET+P
Sbjct  122  ELILAAFLFLVGALVTALAPIYSVLIIGRVTYGVGVGLAMHAAPMYIAETAP  173



>ref|XP_004307871.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 141/170 (83%), Gaps = 5/170 (3%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ   SS+ +   S    G VQ PLL+G Q   +NYSV+A +LPFLFPALGGLLYGYD
Sbjct  4    DPEQPPRSSLHEVQNS----GDVQMPLLNGGQ-FSDNYSVLAAVLPFLFPALGGLLYGYD  58

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATSCATIS+ESAT SG+SWYDLSSV+IGLITSGSLYGALIGS LAFNIAD +GRR EL
Sbjct  59   IGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADIIGRRWEL  118

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + S+I+YLIG ++TA AP   IMVIGR V+G+GIGLAMHAAPMYIAET+P
Sbjct  119  ISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIGLAMHAAPMYIAETAP  168



>ref|XP_010671130.1| PREDICTED: D-xylose-proton symporter-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 144/175 (82%), Gaps = 6/175 (3%)
 Frame = +2

Query  107  ATDDPEQLTFSSIGQPGKSSGE--IGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            +T D +    SS G   K+SGE  +  V+ PLL+G  P  E+YS+++CI+PFLFPALGGL
Sbjct  4    STTDHQHHVLSSFG---KASGEFDLDEVERPLLNGAHPT-EDYSLLSCIVPFLFPALGGL  59

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            L+GYDIGATS AT+SI+S T SG +WYDLSSV++GLI+SGSLYGALIGS LAFN+ADFLG
Sbjct  60   LFGYDIGATSSATLSIQSPTLSGTTWYDLSSVEVGLISSGSLYGALIGSVLAFNVADFLG  119

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RR+EL+ ++I YL G LITA  P +VIM+IGRF++G+GIGLAMHAAPMYIAET+P
Sbjct  120  RRKELIAAAIFYLAGALITAIGPNFVIMMIGRFIFGIGIGLAMHAAPMYIAETAP  174



>ref|XP_010087486.1| D-xylose-proton symporter-like 2 [Morus notabilis]
 gb|EXB29167.1| D-xylose-proton symporter-like 2 [Morus notabilis]
Length=518

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 12/179 (7%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPL--------LHGQQPHIENYSVVACIlpflfpa  268
             DPEQ T SS+    KSSGEIGS+Q           ++G   + + YSV+A ILPFLFPA
Sbjct  15   SDPEQPTLSSLV---KSSGEIGSIQLLQQLQEPLLNVNGAH-NSDTYSVIAAILPFLFPA  70

Query  269  lggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIA  448
            LGGLLYGYDIGATSCATIS++SATSSG+SWY+LSSV IGLITSGSLYGALIGS LAFN++
Sbjct  71   LGGLLYGYDIGATSCATISVQSATSSGVSWYNLSSVDIGLITSGSLYGALIGSVLAFNVS  130

Query  449  DFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            DFLGRRREL+ +++ YL G +IT  A    IMVIGRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  131  DFLGRRRELISAALFYLFGAIITTVASNLAIMVIGRFVYGIGIGLAMHAAPMYIAETAP  189



>gb|KFK37751.1| hypothetical protein AALP_AA3G025300 [Arabis alpina]
Length=503

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 140/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            D E  + SS+ Q G SS GEI SV++PL+       ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DSENQSISSLSQVGDSSSGEISSVKQPLIKQNHHSPENYSVLAAIPPFLFPALGALLFGY  63

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCATIS++S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  64   EIGATSCATISLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LYL+G ++TA APV+ ++++GR  YG+GIGL MHAAPMYIAET+P
Sbjct  124  LILAAFLYLVGAIVTAIAPVFSVLIVGRVTYGIGIGLTMHAAPMYIAETAP  174



>ref|XP_011470132.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=495

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 140/170 (82%), Gaps = 7/170 (4%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DPEQ   SS+ +        G VQ PLL+G Q   +NYSV+A +LPFLFPALGGLLYGYD
Sbjct  4    DPEQPPRSSLHENS------GDVQMPLLNGGQ-FSDNYSVLAAVLPFLFPALGGLLYGYD  56

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATSCATIS+ESAT SG+SWYDLSSV+IGLITSGSLYGALIGS LAFNIAD +GRR EL
Sbjct  57   IGATSCATISVESATLSGVSWYDLSSVEIGLITSGSLYGALIGSVLAFNIADIIGRRWEL  116

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + S+I+YLIG ++TA AP   IMVIGR V+G+GIGLAMHAAPMYIAET+P
Sbjct  117  ISSAIVYLIGAIVTALAPDLPIMVIGRVVFGIGIGLAMHAAPMYIAETAP  166



>ref|XP_010420407.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420408.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420410.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420411.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            DPEQ   SS+ +  GKSSGEI S +EPL+  ++ H+ ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSSGEISSEREPLI--KENHVPENYSVVAAILPFFFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATIS++S + SG+SWY+LSSV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGVSWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+L+++L+LIG L+TA AP+Y +++IGR  YGV +GLAMHAAPMYIAET+P
Sbjct  122  ELILAALLFLIGALVTALAPIYSVLIIGRVTYGVSVGLAMHAAPMYIAETAP  173



>ref|XP_010920045.1| PREDICTED: D-xylose-proton symporter-like 2 [Elaeis guineensis]
Length=501

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 140/173 (81%), Gaps = 4/173 (2%)
 Frame = +2

Query  107  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  286
            A  DPE    S + +      EI + +EPL++G   H E+YS  A ILPFLFPALG LLY
Sbjct  4    AISDPE---LSRVHRKEVKGNEIDNPREPLINGVGYH-ESYSANAAILPFLFPALGALLY  59

Query  287  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  466
            GYDIGATS ATIS+ES+T SG +WYDLSS++IGL+ SGSLYGALIGS LAFNIADFLGRR
Sbjct  60   GYDIGATSGATISLESSTLSGTTWYDLSSLEIGLVVSGSLYGALIGSVLAFNIADFLGRR  119

Query  467  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            REL+LSS+LYL+G L+TA AP Y +MV+GRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  120  RELILSSVLYLVGALVTALAPTYPVMVVGRFVYGIGIGLAMHAAPMYIAETAP  172



>ref|XP_010453878.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453879.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453880.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453881.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 144/172 (84%), Gaps = 4/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            DPEQ   SS+ +  GKSSGEI S +EPL+  ++ H+ ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSSGEISSEREPLI--KENHVPENYSVVAAILPFFFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATIS++S + SGISWY+ SSV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGISWYNFSSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+L++IL+LIG L+TA AP+Y +++IGR  YGV +GLAMHAAPMYIAET+P
Sbjct  122  ELILAAILFLIGALVTALAPIYSVLIIGRVTYGVSVGLAMHAAPMYIAETAP  173



>ref|XP_010506301.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=502

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            DPE+ + SS+GQ G SS G I + +EPL+  +    ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DPERQSISSVGQIGDSSSGGISAEKEPLIK-ENHSPENYSVLAAIPPFLFPALGALLFGY  62

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCATISIES T SGISWYDLS V +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  63   EIGATSCATISIESPTLSGISWYDLSPVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  122

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LYL+G ++TA APV+ +++IGR +YG+GIGL MHAAPMYIAET+P
Sbjct  123  LILAAFLYLVGAIVTAVAPVFSVLIIGRVMYGIGIGLTMHAAPMYIAETAP  173



>ref|XP_009126155.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Brassica 
rapa]
Length=502

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA D  +Q T S++ + GKSSGEI S +EPL+       ENYSVV+ I PFLFPALGGLL
Sbjct  1    MAFDPEQQPTSSALVEVGKSSGEIRSEREPLIKDNHTP-ENYSVVSAIFPFLFPALGGLL  59

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF IAD +GR
Sbjct  60   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFTIADVIGR  119

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R+EL+L+++ +L+G L T  AP+Y +++IGR  YGVG+GLAMHAAPMYIAET+P
Sbjct  120  RKELVLAALFFLVGALATTLAPIYSVLIIGRVTYGVGVGLAMHAAPMYIAETAP  173



>ref|XP_009126154.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 142/174 (82%), Gaps = 1/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA D  +Q T S++ + GKSSGEI S +EPL+       ENYSVV+ I PFLFPALGGLL
Sbjct  4    MAFDPEQQPTSSALVEVGKSSGEIRSEREPLIKDNHTP-ENYSVVSAIFPFLFPALGGLL  62

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF IAD +GR
Sbjct  63   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFTIADVIGR  122

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R+EL+L+++ +L+G L T  AP+Y +++IGR  YGVG+GLAMHAAPMYIAET+P
Sbjct  123  RKELVLAALFFLVGALATTLAPIYSVLIIGRVTYGVGVGLAMHAAPMYIAETAP  176



>ref|NP_001190323.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92372.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=470

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 146/176 (83%), Gaps = 4/176 (2%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalgg  277
            MA D  +Q   SS+ +  GKSSGEI   +EPL+  ++ H+ ENYSVVA ILPFLFPALGG
Sbjct  1    MALDPEQQQPISSVSREFGKSSGEISPEREPLI--KENHVPENYSVVAAILPFLFPALGG  58

Query  278  llygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFL  457
            LLYGY+IGATSCATIS++S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF IAD +
Sbjct  59   LLYGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVI  118

Query  458  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GRR+EL+L+++LYL+G L+TA AP Y +++IGR +YGV +GLAMHAAPMYIAET+P
Sbjct  119  GRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAP  174



>ref|NP_850835.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 ref|NP_850836.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 sp|Q6AWX0.1|XYLL2_ARATH RecName: Full=D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AAT85724.1| At5g17010 [Arabidopsis thaliana]
 dbj|BAF00329.1| sugar transporter like protein [Arabidopsis thaliana]
 gb|AED92369.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92370.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=503

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 146/176 (83%), Gaps = 4/176 (2%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalgg  277
            MA D  +Q   SS+ +  GKSSGEI   +EPL+  ++ H+ ENYSVVA ILPFLFPALGG
Sbjct  1    MALDPEQQQPISSVSREFGKSSGEISPEREPLI--KENHVPENYSVVAAILPFLFPALGG  58

Query  278  llygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFL  457
            LLYGY+IGATSCATIS++S + SGISWY+LSSV +GL+TSGSLYGAL GS +AF IAD +
Sbjct  59   LLYGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTIADVI  118

Query  458  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GRR+EL+L+++LYL+G L+TA AP Y +++IGR +YGV +GLAMHAAPMYIAET+P
Sbjct  119  GRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAP  174



>gb|KHN46451.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=497

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DP Q     + +  +S GEI S +EPLL+G     E+YSV A ILPFLFPALGGLL+GYD
Sbjct  4    DPVQ----PVAKKARSGGEIVSAREPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGYD  58

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATS ATISIES T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+EL
Sbjct  59   IGATSSATISIESPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSVLAFNVADFLGRRKEL  118

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + S+++YL+G L+TA AP + ++V+GR V+G GIGLAMHAAPMYIAET+P
Sbjct  119  IGSAVVYLVGALVTALAPNFPVLVLGRLVFGTGIGLAMHAAPMYIAETAP  168



>ref|XP_003540611.1| PREDICTED: D-xylose-proton symporter-like 2-like [Glycine max]
Length=497

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 5/170 (3%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
            DP Q     + +  +S GEI S +EPLL+G     E+YSV A ILPFLFPALGGLL+GYD
Sbjct  4    DPVQ----PVAKKARSGGEIVSAREPLLNGVHDS-ESYSVSAAILPFLFPALGGLLFGYD  58

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATS ATISIES T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+EL
Sbjct  59   IGATSSATISIESPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSVLAFNVADFLGRRKEL  118

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + S+++YL+G L+TA AP + ++V+GR V+G GIGLAMHAAPMYIAET+P
Sbjct  119  IGSAVVYLVGALVTALAPNFPVLVLGRLVFGTGIGLAMHAAPMYIAETAP  168



>emb|CDY28736.1| BnaCnng06220D [Brassica napus]
Length=503

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            D E+ +  S+GQ G SS GEI S ++PL+       ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DAEKQSIVSLGQIGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGALLFGY  63

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCATISI+S   SGISWY+LSSV +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  64   EIGATSCATISIKSPKLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+++LYL+G ++TA APV+ +++IGR +YG+G+GL MHAAPMYIAET+P
Sbjct  124  LILAALLYLVGAIVTAVAPVFYVLIIGRLMYGIGVGLTMHAAPMYIAETAP  174



>emb|CDY38076.1| BnaC02g06970D [Brassica napus]
Length=502

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 143/174 (82%), Gaps = 1/174 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            MA D  +Q T S+  + GK+SGEI S +EPL+       ENYSVV+ I PFLFPALGGLL
Sbjct  1    MAFDPEQQPTSSAFVEVGKTSGEIRSEREPLIKDNHTP-ENYSVVSAIFPFLFPALGGLL  59

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF+IAD +GR
Sbjct  60   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFSIADVIGR  119

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R+EL+L+++ +L+GGL T  AP+Y +++IGR  YGVG+GLAMHAAPMYIAET+P
Sbjct  120  RKELVLAALFFLVGGLATTLAPIYSVLIIGRVTYGVGVGLAMHAAPMYIAETAP  173



>ref|XP_010662115.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Vitis 
vinifera]
Length=493

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = +2

Query  143  IGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATI  322
            I + GKSSGEI  +QEPL+ G     ENYSV A ILPFLFPALGGLLYGYDIGATSCA I
Sbjct  5    ISEVGKSSGEIDGMQEPLIDGVGSS-ENYSVAAAILPFLFPALGGLLYGYDIGATSCALI  63

Query  323  SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyli  502
            SIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRREL+L+++LYL+
Sbjct  64   SIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRRELILAALLYLV  123

Query  503  ggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            G L+TA AP +++MVIGRFV+G+GIGL+MHAAPMYIAET+P
Sbjct  124  GALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPMYIAETAP  164



>ref|XP_002873804.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50063.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            DPEQ   SS+ +  GKS GEI + +EPL+  ++ H  ENYSVVA ILPF FPALGGLLYG
Sbjct  4    DPEQQPISSVSREVGKSDGEISAEREPLI--KENHTPENYSVVAAILPFFFPALGGLLYG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATIS++S + SGISWY+L+SV +GL+TSGSLYGAL GS +AF IAD +GRR+
Sbjct  62   YEIGATSCATISLQSPSLSGISWYNLTSVDVGLVTSGSLYGALFGSIVAFTIADVIGRRK  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+L+++LYL+G L+TA AP Y +++IGR  YGV +GLAMHAAPMYIAET+P
Sbjct  122  ELILAALLYLVGALVTALAPTYSVLIIGRVTYGVSVGLAMHAAPMYIAETAP  173



>emb|CDX85478.1| BnaA02g03350D [Brassica napus]
Length=505

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  116  DPEQL----TFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            DPEQ      F  +   GK+SGEI S +EPL+       ENYSVVA I PFLFPALGGLL
Sbjct  4    DPEQQPTSSAFVELTPTGKTSGEIRSEREPLIKDNHTP-ENYSVVAAIFPFLFPALGGLL  62

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGY+IGATSCATIS++S + SGISWY+LSS+ +GL+TSGSLYGAL+GS +AF IAD +GR
Sbjct  63   YGYEIGATSCATISLQSPSLSGISWYNLSSLDVGLVTSGSLYGALVGSAVAFTIADVIGR  122

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R+EL+L+++ +L+G L T  AP+Y +++IGR  YGVG+GLAMHAAPMYIAET+P
Sbjct  123  RKELVLAALFFLVGALATTLAPIYSVLIIGRVTYGVGVGLAMHAAPMYIAETAP  176



>ref|XP_006287575.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
 gb|EOA20473.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
Length=502

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQP-GKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            DPEQ   +S+ +  GKSSGEI + +EPL+  +    ENYS VA +LPF FPALGGLLYGY
Sbjct  4    DPEQQPITSVSREVGKSSGEISAEREPLIK-ENHDPENYSAVAAVLPFFFPALGGLLYGY  62

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCATIS++S + SGISWY+LS V +GL+TSGSLYGAL+GS +AF IAD +GRR+E
Sbjct  63   EIGATSCATISLQSPSLSGISWYNLSPVDVGLVTSGSLYGALLGSIVAFTIADVIGRRKE  122

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+++LYL+G L+TA +P+Y +++IGR +YGV +GLAMHAAPMYIAET+P
Sbjct  123  LILAALLYLVGALVTALSPIYSVLIIGRIIYGVSVGLAMHAAPMYIAETAP  173



>ref|XP_009613870.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Nicotiana tomentosiformis]
Length=462

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATISIESAT SGISWYDLSSVQ+GL+TSGSLYGALIGS +AF IAD+LGRRRE
Sbjct  23   DIGATSSATISIESATFSGISWYDLSSVQLGLVTSGSLYGALIGSAVAFQIADWLGRRRE  82

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++S++ Y +G L+TAFAPVYVIMVIGR +YGVGIGLAMHAAPMYIAET+P
Sbjct  83   LIVSALFYFVGALVTAFAPVYVIMVIGRLLYGVGIGLAMHAAPMYIAETAP  133



>ref|XP_002884358.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60617.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            DPE  + SS+GQ G SS GEI + +EPL+  +    ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DPENQSISSVGQVGDSSSGEINAQKEPLIK-ENHSPENYSVLAAIPPFLFPALGALLFGY  62

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCA +SI+S T SGI+WYDLSSV +G++TSGSLYGALIGS +AF++AD +GRR+E
Sbjct  63   EIGATSCAIMSIKSPTLSGITWYDLSSVDVGILTSGSLYGALIGSIVAFSVADTIGRRKE  122

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LYL+G ++T  AP + I++IGR  YG+GIGL MHAAPMYIAET+P
Sbjct  123  LILAAFLYLVGAIVTVVAPAFSILIIGRVTYGMGIGLTMHAAPMYIAETAP  173



>ref|XP_006297488.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
 gb|EOA30386.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
Length=502

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            DPE+ + S  GQ G SS G I + +EPL+  +    ENYSV+A I PFLFPALG LL+GY
Sbjct  4    DPERQSISFAGQIGDSSSGGISAEKEPLIK-ENHSPENYSVLAAIPPFLFPALGALLFGY  62

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCATISI+S T SGISWYDLSSV +G++TSGSLYGALIGS +AF++AD +GRR+E
Sbjct  63   EIGATSCATISIKSPTLSGISWYDLSSVDVGIMTSGSLYGALIGSMVAFSVADTIGRRKE  122

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ +YL+G ++T+ APV+ +++IGR +YG+GIGL MHAAPMYIAET+P
Sbjct  123  LILAAFVYLVGAIVTSVAPVFSVLIIGRVLYGIGIGLTMHAAPMYIAETAP  173



>ref|XP_009130331.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=504

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            M  D  +Q   S  GQ G SS GEI S ++PL+       ENYSV+A I PFLFPALG L
Sbjct  1    MGFDAEKQSIVSVEGQVGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGAL  60

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            L+GY+IGATSCATISI+S   SGISWY+LSSV +G+ITSGSLYGALIGS +AF+ AD +G
Sbjct  61   LFGYEIGATSCATISIKSPKLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSAADIIG  120

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RR+EL+L++ LYL+G ++TA APV+ +++IGR +YG+G+GL MHAAPMYIAET+P
Sbjct  121  RRKELILAAFLYLVGAIVTAVAPVFSVLIIGRLMYGIGVGLTMHAAPMYIAETAP  175



>gb|KFK25925.1| hypothetical protein AALP_AA8G181200 [Arabis alpina]
Length=504

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 146/174 (84%), Gaps = 6/174 (3%)
 Frame = +2

Query  116  DPEQLTFSS--IGQPGKSS-GEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggll  283
            DPEQ + SS    + GKSS GEI + +EPL+  ++ HI ENYSVV+ ILPFLFPALGGLL
Sbjct  4    DPEQQSTSSSDFVEVGKSSSGEISAEREPLI--KENHILENYSVVSAILPFLFPALGGLL  61

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            YGY+IGATSCATIS++S + SG+SWY+LSS+ +GL+TSGSLYGAL GS +AF+IAD +GR
Sbjct  62   YGYEIGATSCATISLQSPSLSGVSWYNLSSLDVGLVTSGSLYGALFGSIVAFSIADVIGR  121

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R+EL+L++ LYL+G ++TA AP+Y  ++IGR  YGVG+GLAMHAAPMYIAET+P
Sbjct  122  RKELILAAFLYLVGAVLTALAPIYFALIIGRVTYGVGVGLAMHAAPMYIAETAP  175



>ref|XP_010933397.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Elaeis 
guineensis]
Length=468

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 4/173 (2%)
 Frame = +2

Query  107  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  286
            AT DPE      + +   +  EI S  EPL++G +   E+YSV A ILPFLFPALGG LY
Sbjct  4    ATYDPE---LPMVHRKDVTEREIDSAGEPLINGDR-SCESYSVRAAILPFLFPALGGALY  59

Query  287  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  466
            GYDIGATS ATIS+ES+T SG +WY+LSS++IGL+ SGSLYGALIGS LAF IADFLGRR
Sbjct  60   GYDIGATSGATISVESSTLSGTTWYNLSSLEIGLVVSGSLYGALIGSVLAFAIADFLGRR  119

Query  467  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            REL+LSS+LY +G L+TA AP + +M++GRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  120  RELILSSVLYFVGALLTALAPDFPVMMVGRFVYGIGIGLAMHAAPMYIAETAP  172



>gb|EPS57619.1| hypothetical protein M569_17198, partial [Genlisea aurea]
Length=304

 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATISI+S+  SGISWYDLSSV++G+ITSGSLYGALIGS LAFN+ADFLGRRRE
Sbjct  14   DIGATSCATISIQSSVVSGISWYDLSSVEVGVITSGSLYGALIGSILAFNVADFLGRRRE  73

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+S +Y IG L+TA AP +V++V GRF+YG+GIGLAMHAAPMYIAETSP
Sbjct  74   LILASSMYFIGILVTASAPNFVLLVSGRFIYGIGIGLAMHAAPMYIAETSP  124



>ref|XP_010933396.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 139/173 (80%), Gaps = 4/173 (2%)
 Frame = +2

Query  107  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  286
            AT DPE      + +   +  EI S  EPL++G +   E+YSV A ILPFLFPALGG LY
Sbjct  4    ATYDPE---LPMVHRKDVTEREIDSAGEPLINGDR-SCESYSVRAAILPFLFPALGGALY  59

Query  287  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  466
            GYDIGATS ATIS+ES+T SG +WY+LSS++IGL+ SGSLYGALIGS LAF IADFLGRR
Sbjct  60   GYDIGATSGATISVESSTLSGTTWYNLSSLEIGLVVSGSLYGALIGSVLAFAIADFLGRR  119

Query  467  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            REL+LSS+LY +G L+TA AP + +M++GRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  120  RELILSSVLYFVGALLTALAPDFPVMMVGRFVYGIGIGLAMHAAPMYIAETAP  172



>ref|XP_010558647.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
 ref|XP_010558648.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
Length=501

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
             DPEQ +  S+ Q GKSSGEI S +EPL+  +    ENYSVVA +LPFLFPALGGLLYGY
Sbjct  3    SDPEQPSLPSLVQVGKSSGEISSEREPLIK-ESYSSENYSVVAAVLPFLFPALGGLLYGY  61

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCATISI+S T SGISWY+LSSV IGLITSGSLYGALIGS +AF +ADFLGRR+E
Sbjct  62   DIGATSCATISIKSPTLSGISWYNLSSVDIGLITSGSLYGALIGSIVAFTVADFLGRRKE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ ++L+G L+TA APV+ I+VIGR +YG+GIGLAMHAAP+YIAET+P
Sbjct  122  LILAACVFLVGALVTALAPVFFILVIGRIIYGIGIGLAMHAAPIYIAETAP  172



>emb|CDY43152.1| BnaA05g32340D [Brassica napus]
Length=504

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSS-GEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            M  D  +Q   S  GQ G SS GEI S ++PL+       ENYSV+A I PFLFPALG L
Sbjct  1    MGFDAEKQSIVSVEGQIGDSSSGEISSEKQPLIKENHHSPENYSVLAAIPPFLFPALGAL  60

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            L+GY+IGATSCATISI+S   SGISWY+LSSV +G+ITSGSLYGALIGS +AF++AD +G
Sbjct  61   LFGYEIGATSCATISIKSPKLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSVADIIG  120

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             R+EL+L++ LYL+G ++TA APV+ +++IGR +YG+G+GL MHAAPMYIAET+P
Sbjct  121  LRKELILAAFLYLVGAIVTAVAPVFYVLIIGRLMYGIGVGLTMHAAPMYIAETAP  175



>emb|CDP04938.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 142/181 (78%), Gaps = 10/181 (6%)
 Frame = +2

Query  113  DDPEQ--LTFSSIGQPGKSSGEIGSVQEP--LLH------GQQPHIENYSVVACIlpflf  262
            D P Q   T S + + G    + G+ +E   LLH       Q+   +NYSV+A ILPFLF
Sbjct  5    DRPHQPPTTASLLTKGGGGEIDDGAPEEEHLLLHENGEQQQQRLQSDNYSVLAAILPFLF  64

Query  263  palggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFN  442
            PALGGLLYGYDIGATS ATISI+S + SGISWYDLSSV++GLITSGSLYGAL GS LAFN
Sbjct  65   PALGGLLYGYDIGATSSATISIQSPSFSGISWYDLSSVEVGLITSGSLYGALAGSVLAFN  124

Query  443  IADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETS  622
            +ADFLGRRREL+ SS+LYL+G L+TA AP +V++VIGR VYG+GIGLAMHAAPMYIAET+
Sbjct  125  VADFLGRRRELIFSSLLYLLGALVTALAPNFVVLVIGRLVYGIGIGLAMHAAPMYIAETA  184

Query  623  P  625
            P
Sbjct  185  P  185



>ref|NP_186959.2| vacuolar glucose transporter 1 [Arabidopsis thaliana]
 sp|Q8L6Z8.1|XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1 [Arabidopsis thaliana]
 gb|AAM98195.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56818.1| At3g03090 [Arabidopsis thaliana]
 gb|AEE73900.1| vacuolar glucose transporter 1 [Arabidopsis thaliana]
Length=503

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQP--GKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  289
            DPE  + SS+GQ     SSG I + +EPLL  +    ENYSV+A I PFLFPALG LL+G
Sbjct  4    DPENQSISSVGQVVGDSSSGGITAEKEPLLK-ENHSPENYSVLAAIPPFLFPALGALLFG  62

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCA +S++S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GRR+
Sbjct  63   YEIGATSCAIMSLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRK  122

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+L++ LYL+G ++T  APV+ I++IGR  YG+GIGL MHAAPMYIAET+P
Sbjct  123  ELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAP  174



>gb|KDO39943.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=453

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 5/158 (3%)
 Frame = +2

Query  104  MATDDPEQLT--FSSIGQPGKSSGEIGSV-QEPLL-HGQQPHIENYSVVACIlpflfpal  271
            MATD PEQ     SS G+ GKSSGEIGS  +EPL+ +G +P  ENYSV A ILPFLFPAL
Sbjct  1    MATD-PEQARARLSSFGKVGKSSGEIGSADEEPLIANGIRPSPENYSVSAAILPFLFPAL  59

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLLYGYDIG+TSCATISIES T SGISWYDLSSV+IGLITSGSLYGALIGS LAFNIAD
Sbjct  60   GGLLYGYDIGSTSCATISIESPTLSGISWYDLSSVEIGLITSGSLYGALIGSILAFNIAD  119

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVY  565
             LGRRREL+L+++LYL+G L+TA AP ++IMV+GRFV+
Sbjct  120  ILGRRRELILAALLYLVGALVTALAPDFIIMVVGRFVF  157



>ref|XP_004309072.1| PREDICTED: D-xylose-proton symporter-like 2 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  164  SGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATS  343
            SG+IG  ++PLL G      NYS++  I PFLFPAL GL+YGYDIGAT+CATIS+ SAT 
Sbjct  16   SGDIGGAKDPLLTGVHKISHNYSLLRAIFPFLFPALEGLVYGYDIGATACATISLGSATL  75

Query  344  SGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAF  523
            SG+SWYDLSS+QIGLI SGSL GALIGS LAFN  D LGRR EL+ S++LY IG LITA 
Sbjct  76   SGVSWYDLSSLQIGLIASGSLSGALIGSVLAFNAGDVLGRRFELIASAVLYCIGALITAL  135

Query  524  APVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            AP + +MVIGRFV+GVGIGLAMHAAPMY+AET+P
Sbjct  136  APEFPVMVIGRFVFGVGIGLAMHAAPMYMAETAP  169



>ref|XP_010463755.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=498

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggll  283
            M  D   Q  F  IG    SSG I + +EPL+  +    ENYSV+A I PFLFPALG LL
Sbjct  1    MGFDSERQ--FEQIGD--SSSGGISAEKEPLIK-ENHSPENYSVLAAIPPFLFPALGALL  55

Query  284  ygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            +GY+IGATSCATISI+S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GR
Sbjct  56   FGYEIGATSCATISIKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSAVAFSVADIIGR  115

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R+EL+L++ LYL+G ++TA APV+ +++IGR  YG+GIGL MHAAPMYIAET+P
Sbjct  116  RKELILAAFLYLVGAIVTAVAPVFSVLIIGRVTYGIGIGLTMHAAPMYIAETAP  169



>ref|XP_009134719.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=502

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 137/172 (80%), Gaps = 4/172 (2%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSG-EIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            D E+ +   + Q G  S   + SVQEPL+  +Q H  ENYSV+A I PFLFPALG  L+G
Sbjct  4    DAEKQSIVHVEQVGDLSLIGLSSVQEPLI--KQKHTPENYSVLAAIPPFLFPALGTFLFG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATISI+S T SGISWY+LSSV +G+ITSGSLYGALIGS +AF+IAD +GRR+
Sbjct  62   YEIGATSCATISIKSPTLSGISWYNLSSVDVGIITSGSLYGALIGSIVAFSIADIIGRRK  121

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             L+ ++ LYLIG ++TA APV+ +++IGR VYG+G+GL MHAAPMYIAET+P
Sbjct  122  GLITAAFLYLIGAIVTAVAPVFPVLIIGRVVYGIGVGLTMHAAPMYIAETAP  173



>ref|XP_008809219.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Phoenix dactylifera]
Length=502

 Score =   158 bits (400),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 137/174 (79%), Gaps = 5/174 (3%)
 Frame = +2

Query  107  ATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalgglly  286
            AT DPE      + +   +  EI S  EPL++  +   E+YSV A ILPFLFPALGG LY
Sbjct  4    ATSDPE---LPRVHRKDVTGREIDSATEPLINSDR-SCESYSVRAAILPFLFPALGGALY  59

Query  287  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADF-LGR  463
            GYDIGATS ATIS+ES+T SG +WYDLSS++IGL+ SGSLYGALIGS LAF +ADF + R
Sbjct  60   GYDIGATSGATISVESSTLSGTTWYDLSSLEIGLVVSGSLYGALIGSVLAFTVADFXVWR  119

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RREL+LSS+LY +G L+TA AP + +MV+GRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  120  RRELILSSVLYFVGALLTALAPDFPVMVVGRFVYGIGIGLAMHAAPMYIAETAP  173



>emb|CDX92030.1| BnaC03g33320D [Brassica napus]
Length=502

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 126/148 (85%), Gaps = 3/148 (2%)
 Frame = +2

Query  185  QEPLLHGQQPHI-ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWY  361
            QEPL+  QQ H  ENYSV+A I PFLFPALG  L+GY+IGATSCATISI+S T SGISWY
Sbjct  28   QEPLI--QQKHSPENYSVLAAIPPFLFPALGAFLFGYEIGATSCATISIKSPTLSGISWY  85

Query  362  DLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVI  541
            +LSSV +G+ITSGSLYGALIGS +AF+IAD +GRR+ L+ ++ LYL+G ++TA APV+ +
Sbjct  86   NLSSVDVGIITSGSLYGALIGSIVAFSIADIIGRRKGLITAAFLYLVGAIVTALAPVFHV  145

Query  542  MVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++IGR VYG+G+GL MHAAPMYIAET+P
Sbjct  146  LIIGRVVYGIGVGLTMHAAPMYIAETAP  173



>emb|CDY49922.1| BnaCnng18320D [Brassica napus]
Length=503

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQ-PGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            D E+ +  S+GQ    SSG I SV+EPL+       E+YSV+A I  FLFPALG LL+GY
Sbjct  4    DSEKQSIVSLGQVGDSSSGGISSVKEPLIKENHHSPEDYSVLAAIPSFLFPALGALLFGY  63

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCA ISI+S T SGISWY+LS V +G+ITSGSLYGALIGS +AF+IAD +GRR+E
Sbjct  64   EIGATSCAIISIKSPTLSGISWYNLSPVDVGIITSGSLYGALIGSIVAFSIADTIGRRKE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LYL+G ++T+ APV+ +++IGR +YGVGIGL MHAAPMYIAETSP
Sbjct  124  LILAAFLYLVGAIVTSLAPVFSVLIIGRLMYGVGIGLTMHAAPMYIAETSP  174



>ref|XP_008791055.1| PREDICTED: D-xylose-proton symporter-like 2 [Phoenix dactylifera]
Length=475

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS+ES+  SG +WY+LSS++IGL+ SGSLYGALIGS LAFNIADFLGRRRE
Sbjct  36   DIGATSSATISLESSALSGTTWYNLSSLEIGLVVSGSLYGALIGSILAFNIADFLGRRRE  95

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+LSS+LYL+G LITA AP Y +MV+GRFVYG+GIGLAMHAAPMYIAET+P
Sbjct  96   LILSSVLYLVGALITALAPSYPVMVVGRFVYGIGIGLAMHAAPMYIAETAP  146



>ref|XP_009119042.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
 emb|CDY23466.1| BnaC04g49940D [Brassica napus]
Length=503

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 138/171 (81%), Gaps = 1/171 (1%)
 Frame = +2

Query  116  DPEQLTFSSIGQ-PGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygy  292
            D E+ + +S+GQ    SSG I SV+EPL+       E+YSV+A I PFLFPALG LL+GY
Sbjct  4    DSEKQSIASLGQVGDSSSGGISSVKEPLIKENHHSPEDYSVLAAIPPFLFPALGALLFGY  63

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCA ISI+S T SGISWY LS V +G+ITSGSLYGALIGS +AF+IAD +GRR+E
Sbjct  64   EIGATSCAIISIKSPTLSGISWYTLSPVDVGIITSGSLYGALIGSIVAFSIADTIGRRKE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LYL+G ++T+ APV+ +++IGR +YGVGIGL MHAAPMYIAETSP
Sbjct  124  LILAAFLYLVGAIVTSLAPVFSVLIIGRLMYGVGIGLTMHAAPMYIAETSP  174



>ref|XP_003574402.1| PREDICTED: D-xylose-proton symporter-like 2 [Brachypodium distachyon]
Length=503

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  400
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S+TSSG +WYDLSSVQ GL+ SG
Sbjct  41   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSSTSSGTTWYDLSSVQTGLVVSG  100

Query  401  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIG  580
            SLYGALIGS +AF IADFLGRRREL+++SI YL+G L+TA AP ++IMV+GRF+YG+GIG
Sbjct  101  SLYGALIGSAMAFTIADFLGRRRELVVASISYLVGALLTAVAPNFLIMVVGRFLYGIGIG  160

Query  581  LAMHAAPMYIAETSP  625
            LAMHAAPMYIAET+P
Sbjct  161  LAMHAAPMYIAETAP  175



>ref|XP_006408343.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
 gb|ESQ49796.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
Length=502

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +2

Query  182  VQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWY  361
            V+EPL+  +    EN+SV+A I PFLFPALG LL+GY+IGATSCATISI S T SGISWY
Sbjct  27   VKEPLIK-ENHSPENFSVLAAIPPFLFPALGALLFGYEIGATSCATISIRSPTLSGISWY  85

Query  362  DLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVI  541
            +LS V +G+ITSGSLYGALIGS +AF++AD +GRR+EL+L++ +YL+G ++TA APV+ +
Sbjct  86   NLSPVDVGIITSGSLYGALIGSIVAFSVADIIGRRKELILAAFVYLVGAIVTAIAPVFSV  145

Query  542  MVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++IGR +YG+GIGL MHAAPMYIAET+P
Sbjct  146  LIIGRLMYGIGIGLTMHAAPMYIAETAP  173



>ref|XP_009382608.1| PREDICTED: D-xylose-proton symporter-like 2 [Musa acuminata subsp. 
malaccensis]
Length=498

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 129/155 (83%), Gaps = 1/155 (1%)
 Frame = +2

Query  161  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  340
            +S EI + ++PL++G     E+YS  A ILPF FPALGGLLYGYDIGATS A IS++S++
Sbjct  16   TSSEIENPRQPLINGVTSS-ESYSATAAILPFFFPALGGLLYGYDIGATSGAKISLQSSS  74

Query  341  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  520
             SG +WY+LSS++IGL+ SGSLYGALIGS LAF IADFLGRRREL+LS++LY +G L+TA
Sbjct  75   LSGTTWYNLSSLEIGLVVSGSLYGALIGSALAFTIADFLGRRRELLLSAVLYFVGALLTA  134

Query  521  FAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             AP + +MVIGRFVYG GIGLAMHAAPMYIAET P
Sbjct  135  LAPNFPVMVIGRFVYGTGIGLAMHAAPMYIAETCP  169



>ref|XP_008644912.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Zea mays]
Length=518

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  101  KMATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggl  280
            K    + E++  SS G    +  +    + PLL       E YSV A + PFLFPALGGL
Sbjct  16   KQGQSEHEEIHVSSGGVLAYTDDDDCESRRPLLLRTPASAECYSVSAAVFPFLFPALGGL  75

Query  281  lygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            LYGYDIGATS ATIS++S+T SG +WY+LSSVQ GL+ SGSLYGALIGS LA+ IADFLG
Sbjct  76   LYGYDIGATSGATISLKSSTFSGTTWYNLSSVQTGLVVSGSLYGALIGSVLAYTIADFLG  135

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RR+EL+L+SI Y IG  +TA AP + IMV+GRF+YG+GIGLAMHAAPMYIAET+P
Sbjct  136  RRKELILASISYFIGAFLTAVAPNFTIMVVGRFLYGIGIGLAMHAAPMYIAETAP  190



>dbj|BAJ88105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  400
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S+TSSG +WYDLSSVQ GL+ SG
Sbjct  33   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSSTSSGTTWYDLSSVQTGLVVSG  92

Query  401  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIG  580
            SLYGALIGS  AF +ADFLGRRREL++SSI+YL+G L+TA AP ++IMV+GRF+YG+GIG
Sbjct  93   SLYGALIGSATAFTVADFLGRRRELVVSSIMYLVGALLTAVAPNFLIMVVGRFLYGIGIG  152

Query  581  LAMHAAPMYIAETSP  625
            LAMHAAPMYIAET+P
Sbjct  153  LAMHAAPMYIAETAP  167



>gb|EMS55132.1| D-xylose-proton symporter-like 2 [Triticum urartu]
Length=495

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  400
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S TSSG +WYDLSSVQ GL+ SG
Sbjct  33   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSPTSSGTAWYDLSSVQTGLVVSG  92

Query  401  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIG  580
            SLYGALIGS  AF IADFLGRRREL++SSI+YLIG L+TA AP ++IMV+GRF+YG+GIG
Sbjct  93   SLYGALIGSATAFTIADFLGRRRELVVSSIMYLIGALLTAVAPNFLIMVVGRFLYGIGIG  152

Query  581  LAMHAAPMYIAETSP  625
            LAMHAAPMYIAET+P
Sbjct  153  LAMHAAPMYIAETAP  167



>ref|XP_006662109.1| PREDICTED: D-xylose-proton symporter-like 2-like [Oryza brachyantha]
Length=500

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 134/173 (77%), Gaps = 5/173 (3%)
 Frame = +2

Query  113  DDPEQLTFSSIGQPGKSSGEIGSVQ--EPLLHGQQPHIENYSVVACIlpflfpalgglly  286
            D+P   + S+     ++ G     +  EPLL    PH E Y + A ILPFLFPALGGLLY
Sbjct  3    DEPLSNSNSTTNNKRRAEGIRPDCESTEPLLLA--PH-EPYRLSAAILPFLFPALGGLLY  59

Query  287  gyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  466
            GYDIGATS ATIS++S+T SG +WY+LSS+Q GL+ SGSLYGALIGS LAFNIADFLGRR
Sbjct  60   GYDIGATSGATISLKSSTFSGTTWYNLSSLQTGLVVSGSLYGALIGSILAFNIADFLGRR  119

Query  467  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            REL+ SS+ YLIG L+TA AP + IMV+GRF YG+GIGLAMHAAPMYIAET+P
Sbjct  120  RELIFSSVSYLIGALLTAAAPNFPIMVVGRFFYGIGIGLAMHAAPMYIAETAP  172



>ref|XP_008644913.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Zea mays]
 gb|AFW69044.1| hypothetical protein ZEAMMB73_344214 [Zea mays]
Length=517

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = +2

Query  122  EQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIG  301
            E++  SS G    +  +    + PLL       E YSV A + PFLFPALGGLLYGYDIG
Sbjct  22   EEIHVSSGGVLAYTDDDDCESRRPLLLRTPASAECYSVSAAVFPFLFPALGGLLYGYDIG  81

Query  302  ATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElml  481
            ATS ATIS++S+T SG +WY+LSSVQ GL+ SGSLYGALIGS LA+ IADFLGRR+EL+L
Sbjct  82   ATSGATISLKSSTFSGTTWYNLSSVQTGLVVSGSLYGALIGSVLAYTIADFLGRRKELIL  141

Query  482  ssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +SI Y IG  +TA AP + IMV+GRF+YG+GIGLAMHAAPMYIAET+P
Sbjct  142  ASISYFIGAFLTAVAPNFTIMVVGRFLYGIGIGLAMHAAPMYIAETAP  189



>ref|XP_002464862.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
 gb|EER91860.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
Length=511

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 130/168 (77%), Gaps = 0/168 (0%)
 Frame = +2

Query  122  EQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIG  301
            E++  SS G    +  +    + PLL       E YS+ A + PF FPALGGLLYGYDIG
Sbjct  16   EEIHVSSGGVQAYTDDDDCENRRPLLLRAPASAECYSISAAVFPFFFPALGGLLYGYDIG  75

Query  302  ATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElml  481
            ATS ATIS++S+T SG +WY+LSSVQ GL+ SGSLYGALIGS LA+ IADFLGRR+EL+L
Sbjct  76   ATSGATISLKSSTFSGTTWYNLSSVQTGLVVSGSLYGALIGSVLAYTIADFLGRRKELIL  135

Query  482  ssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +SI YLIG L+TA AP + IMV+GRF+YG+GIGLAMHAAPMYIAET+P
Sbjct  136  ASISYLIGALLTAVAPNFAIMVVGRFLYGIGIGLAMHAAPMYIAETAP  183



>ref|NP_001065505.1| Os10g0579200 [Oryza sativa Japonica Group]
 gb|AAG46179.1|AC018727_31 putative sugar transporter protein [Oryza sativa Japonica Group]
 gb|AAP55176.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27342.1| Os10g0579200 [Oryza sativa Japonica Group]
 dbj|BAG95336.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67505.1| hypothetical protein OsI_34793 [Oryza sativa Indica Group]
 gb|EEE51468.1| hypothetical protein OsJ_32598 [Oryza sativa Japonica Group]
Length=502

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 3/145 (2%)
 Frame = +2

Query  191  PLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLS  370
            PLL    PH E+Y + A ILPFLFPALGGLLYGYDIGATS ATIS++S+T SG +WY+LS
Sbjct  33   PLLLA--PH-ESYRLSAAILPFLFPALGGLLYGYDIGATSGATISLKSSTFSGTTWYNLS  89

Query  371  SVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVI  550
            S+Q GL+ SGSLYGALIGS LAFNIADFLGRRREL+LSS+ YLIG L+TA AP + IMV+
Sbjct  90   SLQTGLVVSGSLYGALIGSILAFNIADFLGRRRELILSSVSYLIGALLTAAAPNFPIMVV  149

Query  551  GRFVYGVGIGLAMHAAPMYIAETSP  625
            GRF YG+GIGLAMHAAPMYIAET+P
Sbjct  150  GRFFYGIGIGLAMHAAPMYIAETAP  174



>gb|EMT10196.1| D-xylose-proton symporter-like protein 2 [Aegilops tauschii]
Length=524

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  221  ENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSG  400
            E YSV A ILPF FPALGGLLYGYDIGATS ATIS++S TSSG +WYDLSSVQ GL+ SG
Sbjct  33   EAYSVSAAILPFFFPALGGLLYGYDIGATSGATISLKSPTSSGTAWYDLSSVQTGLVVSG  92

Query  401  SLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIG  580
            SLYGALIGS  AF IADFLGRRREL++SSI+YLIG L+TA  P ++IMV+GRF+YG+GIG
Sbjct  93   SLYGALIGSATAFTIADFLGRRRELVVSSIMYLIGALLTAVTPNFLIMVVGRFLYGIGIG  152

Query  581  LAMHAAPMYIAETSP  625
            LAMHAAPMYIAET+P
Sbjct  153  LAMHAAPMYIAETAP  167



>emb|CDX92028.1| BnaC03g33300D [Brassica napus]
Length=480

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  182  VQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWY  361
            VQEPL+  Q+   ENY V+A I  FLFPALG  L+GY+IGATSCAT+SI+S T SGISWY
Sbjct  35   VQEPLIK-QKHSPENYCVLAAIPQFLFPALGAFLFGYEIGATSCATLSIKSPTLSGISWY  93

Query  362  DLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVI  541
            +LSSV +G+ITS S YGALIGS +AFN+AD +G R+EL+ +++LYL+G ++TA APV+ +
Sbjct  94   NLSSVDVGIITSCSHYGALIGSIVAFNVADIIGIRKELITAALLYLVGAIVTATAPVFPV  153

Query  542  MVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++IGR VYG+G+GL MHAAPMYIAET+P
Sbjct  154  LIIGRVVYGIGLGLTMHAAPMYIAETAP  181



>ref|XP_004983521.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2-like [Setaria italica]
Length=515

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = +2

Query  185  QEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYD  364
            + PLL G     E YSV A +LPFLFPALGGLLYGYDIGATS ATIS++S+  SG +WY+
Sbjct  43   RRPLLLGTPAAAECYSVPAAVLPFLFPALGGLLYGYDIGATSGATISLKSSKFSGTTWYN  102

Query  365  LSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIM  544
            LSSVQ GL+ SGSLYGALIGS LA+ IADFLGRR+EL+LSSI YLIG L+TA AP + IM
Sbjct  103  LSSVQTGLVVSGSLYGALIGSILAYTIADFLGRRKELILSSISYLIGALLTAAAPNFAIM  162

Query  545  VIGRFVYGVGIGLAMHAAPMYIAETSP  625
            V+GR +YG+GIGLAMHAAPMYIAET+P
Sbjct  163  VVGRLLYGIGIGLAMHAAPMYIAETAP  189



>ref|XP_010489652.1| PREDICTED: D-xylose-proton symporter-like 1, partial [Camelina 
sativa]
Length=469

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            +IGATSCATISI+S T SGISWYDLSSV +G+ITSGSLYGALIGS +AF++AD +GRR+E
Sbjct  30   EIGATSCATISIKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSVADIIGRRKE  89

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LYL+G ++TA APV+ +++IGR +YG+GIGL MHAAPMYIAET+P
Sbjct  90   LILAAFLYLVGAIVTAVAPVFPVLIIGRVMYGIGIGLTMHAAPMYIAETAP  140



>ref|XP_006854111.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
 gb|ERN15578.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
Length=505

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 134/172 (78%), Gaps = 10/172 (6%)
 Frame = +2

Query  137  SSIGQP--GKSSG-------EIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllyg  289
            S + QP  GKS+G       E  S +EPL+      +E YSV A ILPFLFPALGGLLYG
Sbjct  6    SDLEQPRDGKSNGVTVSSPSEDDSAREPLVP-VTASVEAYSVAATILPFLFPALGGLLYG  64

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            YDIGATS A+IS+ES   SG SWYDL+S ++GL+ SGSLYGALIGS LAF + +FLGRRR
Sbjct  65   YDIGATSGASISLESPELSGTSWYDLNSFEVGLVVSGSLYGALIGSILAFGVENFLGRRR  124

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL++SS+LYL+G L+TA AP + ++V+GR VYG+GIG+AMHAAPMYI+ET+P
Sbjct  125  ELLVSSMLYLVGALVTALAPDFPVLVVGRLVYGLGIGMAMHAAPMYISETAP  176



>gb|ADP37177.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=453

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCA ISIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRRE
Sbjct  14   DIGATSCALISIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRRE  73

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+++LYL+G L+TA AP +++MVIGRFV+G+GIGL+MHAAPMYIAET+P
Sbjct  74   LILAALLYLVGALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPMYIAETAP  124



>emb|CAN72732.1| hypothetical protein VITISV_037854 [Vitis vinifera]
Length=458

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATSCA ISIES++ SGISWYDLSSVQIGL TSGSLYGALIGS LAFNIADF GRRRE
Sbjct  30   DIGATSCALISIESSSLSGISWYDLSSVQIGLTTSGSLYGALIGSVLAFNIADFFGRRRE  89

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L+++LYL+G L+TA AP +++MVIGRFV+G+GIGL+MHAAPMYIAET+P
Sbjct  90   LILAALLYLVGALVTAVAPSFIVMVIGRFVFGIGIGLSMHAAPMYIAETAP  140



>ref|XP_001773171.1| predicted protein [Physcomitrella patens]
 gb|EDQ62024.1| predicted protein, partial [Physcomitrella patens]
Length=464

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A +SI S   SG  WY+LSS+QIGL+ SGSLYGAL+GS +AFNIADFLGRR+E
Sbjct  23   DIGATSGAAVSIVSPELSGTDWYNLSSIQIGLVVSGSLYGALLGSVVAFNIADFLGRRKE  82

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            LM++S+LY+ G LIT FAP + I+VIGR ++G+GIGL MHAAPMYIAETSP
Sbjct  83   LMVASLLYIFGSLITGFAPSFAILVIGRIIFGLGIGLTMHAAPMYIAETSP  133



>ref|XP_003563522.2| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brachypodium 
distachyon]
Length=568

 Score =   137 bits (346),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS+ SA  SG +W++LSSVQ+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  125  DIGATSGATISVHSADLSGTTWFNLSSVQLGLVASGSLYGALGGSILAYRIADFLGRRIE  184

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LY+ G L+T FAP +V+++IGR +YGVGIGLAMH AP+YIAET P
Sbjct  185  LVTAAALYISGALVTGFAPNFVVLIIGRLLYGVGIGLAMHGAPLYIAETCP  235



>ref|XP_010261641.1| PREDICTED: D-xylose-proton symporter-like 2, partial [Nelumbo 
nucifera]
Length=429

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/99 (76%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = +2

Query  329  ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyligg  508
            +S+T SGI+WY+LSSV+IGLI SGSLYGALIGS LAF +ADFLGRRRELMLS++LYL+G 
Sbjct  2    QSSTLSGITWYNLSSVEIGLIVSGSLYGALIGSVLAFTVADFLGRRRELMLSALLYLVGA  61

Query  509  liTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+TA AP + +MVIGRF++G+GIGLAMHAAPMYIAET+P
Sbjct  62   LVTALAPDFPVMVIGRFIFGIGIGLAMHAAPMYIAETAP  100



>gb|ABK24923.1| unknown [Picea sitchensis]
Length=521

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 123/153 (80%), Gaps = 3/153 (2%)
 Frame = +2

Query  170  EIGSVQEPLLHGQQ-PHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSS  346
             I   +EPL+  ++ P +  +S  A ILPFLFPALGG+L+GYDIGATS A++S++SA  S
Sbjct  38   NIEGTREPLISSKESPEVFTWS--ALILPFLFPALGGVLFGYDIGATSGASVSLQSAELS  95

Query  347  GISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFA  526
            G +WY+LSS+Q GL+ SGSLYGAL GS +AFN++DFLGRRREL++++ LYL G LITA A
Sbjct  96   GTTWYNLSSIQTGLVVSGSLYGALCGSLIAFNVSDFLGRRRELIVAAALYLSGALITALA  155

Query  527  PVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            P   ++++GR ++G GIGLAMHAAP+YI+ETSP
Sbjct  156  PGLPVLIVGRLLFGFGIGLAMHAAPLYISETSP  188



>ref|XP_004981232.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=563

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SG +W++LSSVQ+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  120  DIGATSGATISVQSADLSGTTWFNLSSVQLGLVASGSLYGALGGSILAYRIADFLGRRIE  179

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  180  LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGLAMHGAPLYIAETSP  230



>gb|EMT28553.1| D-xylose-proton symporter-like protein 3 [Aegilops tauschii]
Length=374

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS+ SA  SG +W++LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  53   DIGATSGATISVHSAELSGTTWFNLSSLQLGLVASGSLYGALGGSILAYRIADFLGRRIE  112

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            LM ++ LY+ G L T  AP +V+++IGR +YGVGIGLAMH AP+YIAET P
Sbjct  113  LMTAAALYISGALTTGLAPNFVVLIIGRLLYGVGIGLAMHGAPLYIAETCP  163



>ref|XP_006651969.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Oryza brachyantha]
Length=473

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A+IS++SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  30   DIGATSGASISLQSAELSGTTWFSLSSIQLGLVASGSLYGALGGSILAYRIADFLGRRIE  89

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LY+ G L+T FAP +V+++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  90   LVTAAALYISGALVTGFAPDFVVLIIGRLLYGLGIGLAMHGAPLYIAETSP  140



>ref|XP_004953925.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=162

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SG +W++ SSVQ+GL+ SGSLYGAL GS L   IADFLGRR E
Sbjct  29   DIGATSGATISVQSADLSGTTWFNRSSVQLGLVASGSLYGALGGSILTHRIADFLGRRIE  88

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  89   LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGLAMHGAPLYIAETSP  139



>ref|XP_008222102.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Prunus mume]
Length=562

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 143/206 (69%), Gaps = 16/206 (8%)
 Frame = +2

Query  11   HFSTSPMPISFPGNCSRYN*GFLPIFLELAKMATDDPEQLTFS-SIGQPGKSSGEIGSVQ  187
            HF T P+  ++  +C R N G                 +L FS  +G P  SSG+    +
Sbjct  39   HF-TPPLRSTY-NDCFRANYG---------TFTNHSAPRLRFSVKVGSPDYSSGD----E  83

Query  188  EPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDL  367
               L  +    E++S V+ I+PFLFPALGGLL+GYDIGATS ATIS++S   SG +W++L
Sbjct  84   AQSLISEATQQEDFSWVSVIIPFLFPALGGLLFGYDIGATSGATISLQSPELSGTAWFNL  143

Query  368  SSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMV  547
            S+VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++S++LYL+GGLITA+AP   +++
Sbjct  144  SAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELIISAVLYLLGGLITAYAPSLSVLL  203

Query  548  IGRFVYGVGIGLAMHAAPMYIAETSP  625
            +GR +YG+GIG+AMH AP+YIAET P
Sbjct  204  VGRLLYGLGIGMAMHGAPLYIAETCP  229



>ref|NP_197203.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 emb|CAC01714.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AED92371.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=440

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 11/180 (6%)
 Frame = +2

Query  104  MATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggl  280
            MA D  +Q   SS+ +  +SSGEI   +EPL+  ++ H+ ENYSVVA ILPFLFPALGGL
Sbjct  1    MALDPEQQQPISSVSR--ESSGEISPEREPLI--KENHVPENYSVVAAILPFLFPALGGL  56

Query  281  lygyDIGATSCATISIESATSSGISWYDL-----SSVQIGLITSGSLYGALIGSFLAFNI  445
            LYGY+IGATSCATIS++   +  +S+Y +     + ++   +TSGSLYGAL GS +AF I
Sbjct  57   LYGYEIGATSCATISLQEPMTL-LSYYAVPFSAVAFIKWNFMTSGSLYGALFGSIVAFTI  115

Query  446  ADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            AD +GRR+EL+L+++LYL+G L+TA AP Y +++IGR +YGV +GLAMHAAPMYIAET+P
Sbjct  116  ADVIGRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAP  175



>ref|XP_007016339.1| Major facilitator superfamily protein isoform 4, partial [Theobroma 
cacao]
 gb|EOY33958.1| Major facilitator superfamily protein isoform 4, partial [Theobroma 
cacao]
Length=416

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG +TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>dbj|BAJ95036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  224  NYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGS  403
            +YS+ A ILPF+FPALGGLL+GYDIGATS ATIS+ SA  SG +W++LSSVQ+GL+ SGS
Sbjct  55   DYSLAAVILPFVFPALGGLLFGYDIGATSGATISVHSAELSGTTWFNLSSVQLGLVASGS  114

Query  404  LYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGL  583
            LYGAL GS LA+ +ADFLGRR EL+ ++ LY+ G L+T  AP +V+++IGR +YGVGIGL
Sbjct  115  LYGALGGSILAYRVADFLGRRIELITAAALYISGALVTGLAPNFVVLIIGRLLYGVGIGL  174

Query  584  AMHAAPMYIAETSP  625
            AMH AP+YIAET P
Sbjct  175  AMHGAPLYIAETCP  188



>ref|XP_006590767.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X2 [Glycine 
max]
Length=435

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 91/101 (90%), Gaps = 0/101 (0%)
 Frame = +2

Query  323  SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyli  502
            +++S T SG+SWY LSSV+IGL+TSGSLYGALIGS LAFN+ADFLGRR+EL+ ++++YL+
Sbjct  6    TLQSPTLSGVSWYKLSSVEIGLLTSGSLYGALIGSLLAFNVADFLGRRKELIGAAVVYLV  65

Query  503  ggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            G L+TA AP + ++V+GR V+G+GIGLAMHAAPMYIAET+P
Sbjct  66   GALVTALAPNFPVLVLGRLVFGIGIGLAMHAAPMYIAETAP  106



>ref|XP_007207311.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
 gb|EMJ08510.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
Length=562

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 130/168 (77%), Gaps = 5/168 (3%)
 Frame = +2

Query  125  QLTFS-SIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIG  301
            +L FS  +G P  SSG+    +   L  +    E +S V+ I+PFLFPALGGLL+GYDIG
Sbjct  66   RLRFSVKVGSPDHSSGD----EAQSLISEATQQEEFSWVSVIIPFLFPALGGLLFGYDIG  121

Query  302  ATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElml  481
            ATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++
Sbjct  122  ATSGATISLQSPELSGTAWFNLSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELII  181

Query  482  ssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            S++LYL+GGLITA+AP   ++++GR +YG+GIG+AMH AP+YIAET P
Sbjct  182  SAVLYLLGGLITAYAPSLSVLLVGRLLYGLGIGMAMHGAPLYIAETCP  229



>ref|XP_007016338.1| Major facilitator superfamily protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY33957.1| Major facilitator superfamily protein isoform 3, partial [Theobroma 
cacao]
Length=463

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG +TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>ref|XP_010256836.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Nelumbo 
nucifera]
Length=568

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L F IADFLGRRRE
Sbjct  125  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVFPIADFLGRRRE  184

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LY++GGLIT FAP   ++++GR +YG+GIGLAMH AP+YIAETSP
Sbjct  185  LILAASLYILGGLITGFAPDLGVLIVGRVLYGLGIGLAMHGAPLYIAETSP  235



>ref|XP_007016337.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY33956.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=493

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG +TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>ref|XP_007016336.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY33955.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=561

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  118  DIGATSGATISLQSPELSGITWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG +TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LIIAALLYVLGGSLTAYAPDLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>ref|XP_008222111.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Prunus mume]
Length=521

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 127/161 (79%), Gaps = 4/161 (2%)
 Frame = +2

Query  143  IGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATI  322
            +G P  SSG+    +   L  +    E++S V+ I+PFLFPALGGLL+GYDIGATS ATI
Sbjct  32   VGSPDYSSGD----EAQSLISEATQQEDFSWVSVIIPFLFPALGGLLFGYDIGATSGATI  87

Query  323  SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyli  502
            S++S   SG +W++LS+VQ+GL+ SGSLYGAL GS L + IADFLGRRREL++S++LYL+
Sbjct  88   SLQSPELSGTAWFNLSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELIISAVLYLL  147

Query  503  ggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GGLITA+AP   ++++GR +YG+GIG+AMH AP+YIAET P
Sbjct  148  GGLITAYAPSLSVLLVGRLLYGLGIGMAMHGAPLYIAETCP  188



>ref|XP_008681531.1| PREDICTED: uncharacterized protein LOC100274077 isoform X2 [Zea 
mays]
Length=559

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG  W+ LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  116  DIGATSGATISVQSPDLSGTDWFSLSSLQLGLVASGSLYGALGGSLLAYRIADFLGRRIE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  176  LVTAAALYILGALVTGFAPNFVALIIGRVLYGIGIGLAMHGAPLYIAETSP  226



>ref|XP_011035266.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Populus euphratica]
Length=557

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++SA  SGISW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  114  DIGATSGATLSLQSAELSGISWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  173

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LY+ GGL+T +AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  174  LIAAALLYVFGGLVTGYAPGLNVLLFGRLLYGLGIGLAMHGAPLYIAETCP  224



>ref|XP_011035268.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Populus euphratica]
Length=555

 Score =   133 bits (335),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++SA  SGISW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  112  DIGATSGATLSLQSAELSGISWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  171

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LY+ GGL+T +AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  172  LIAAALLYVFGGLVTGYAPGLNVLLFGRLLYGLGIGLAMHGAPLYIAETCP  222



>ref|XP_001760396.1| predicted protein [Physcomitrella patens]
 gb|EDQ74787.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A +SI S   SG  WY+LSS+Q GL+ SGSLYGAL GS LAF IADFLGRR+E
Sbjct  140  DIGATSGAAVSIVSPEHSGTDWYNLSSLQTGLVVSGSLYGALAGSVLAFGIADFLGRRKE  199

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LY +G L+T FAP    +V+GR ++G+GIGL+MHAAPMYIAETSP
Sbjct  200  LLLAAFLYSVGALVTGFAPNLAAVVVGRLIFGLGIGLSMHAAPMYIAETSP  250



>ref|XP_006846330.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
 gb|ERN08005.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
Length=570

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +2

Query  161  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  340
            +SGE G + +PL+ G     E ++  + I PFLFPALGG L+GYDIGATS A+IS++SA 
Sbjct  86   ASGE-GELAKPLI-GSSTRNEAFTWSSVIFPFLFPALGGFLFGYDIGATSGASISLQSAE  143

Query  341  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  520
             SG +WY+LS++Q GL+ SGSLYGAL GS + + IADFLGRRREL++++ LY++GGLIT 
Sbjct  144  LSGTTWYNLSAIQTGLVVSGSLYGALFGSLIVYPIADFLGRRRELIVAASLYVLGGLITG  203

Query  521  FAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             AP   +++IGR +YG+GIG+AMH AP+YIAETSP
Sbjct  204  LAPDLAVLIIGRLIYGLGIGMAMHGAPLYIAETSP  238



>ref|XP_007132040.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
 gb|ESW04034.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
Length=558

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SGI+W++LS++Q+GL+ SGSLYGAL+GS LA+ IADFLGR+R+
Sbjct  115  DIGATSGATISLQSADLSGITWFNLSAIQLGLVVSGSLYGALLGSLLAYGIADFLGRKRQ  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LY+ GG++TA AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  175  LIAAALLYIFGGVVTANAPELGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  225



>gb|AFK37407.1| unknown [Lotus japonicus]
Length=563

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LSS+Q+GL+ SGSLYGAL+GS LAF +ADFLGR+R+
Sbjct  120  DIGATSGATISLQSPELSGITWFNLSSIQLGLVVSGSLYGALLGSILAFAVADFLGRKRQ  179

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG ITA AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  180  LIVAALLYILGGAITAAAPELNVLLAGRLLYGLGIGLAMHGAPLYIAETCP  230



>gb|KHN32151.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=560

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGISW++LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  117  DIGATSGATISLQSPELSGISWFNLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  176

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  177  LITAALLYLFGGVITAYAPELGVLLAGRLIYGLGIGLAMHGAPLYIAETCP  227



>ref|XP_003539594.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006592182.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=560

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGISW++LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  117  DIGATSGATISLQSPELSGISWFNLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  176

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  177  LITAALLYLFGGVITAYAPELGVLLAGRLIYGLGIGLAMHGAPLYIAETCP  227



>gb|ACU20080.1| unknown [Glycine max]
Length=250

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGISW+ LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  109  DIGATSGATISLQSPELSGISWFKLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  168

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL GG+ITA+AP   +++  R +YG+GIGLAMH AP+YIAET P
Sbjct  169  LITAALLYLFGGVITAYAPELGVLLAERLLYGLGIGLAMHGAPLYIAETCP  219



>ref|XP_010685696.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=565

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ GL+ SGSLYGAL GS + F IADFLGRRRE
Sbjct  123  DIGATSGATISLQSPELSGTTWFNLSAVQQGLVVSGSLYGALFGSIMVFPIADFLGRRRE  182

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ LY IGGL TAFAP   +++ GR +YG+GIG AMHAAP+YIAET P
Sbjct  183  LLIAATLYAIGGLTTAFAPGLEVLLFGRLIYGLGIGWAMHAAPLYIAETCP  233



>ref|XP_010907806.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
 ref|XP_010907807.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
Length=564

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A+IS++SA  SG +W++LS+VQ+GL+ SGSLYGAL GS +A+ IAD LGRRRE
Sbjct  121  DIGATSGASISLQSAELSGTTWFNLSAVQLGLVVSGSLYGALAGSIIAYPIADLLGRRRE  180

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LYL+GGLIT +AP   +++IGRF+YG+GIGLAMH  P+YIAET P
Sbjct  181  LITAAALYLVGGLITGYAPDLFVLIIGRFLYGIGIGLAMHGGPLYIAETCP  231



>gb|KDP42213.1| hypothetical protein JCGZ_02943 [Jatropha curcas]
Length=559

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SG +W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGR RE
Sbjct  116  DIGATSGATISLQSAELSGTTWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRNRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++S LY++GGLITA+AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIIASALYMLGGLITAYAPELNVLLAGRLLYGLGIGLAMHGAPLYIAETCP  226



>ref|XP_009605730.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=547

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 22/196 (11%)
 Frame = +2

Query  50   NCSRYN*GFLPIFLELAKMATDDPEQLTFSSIG----QPGKSSGEIGSVQEPLLHGQQPH  217
             C+R N  F         MA ++  +L    IG    +   SSGE           +  +
Sbjct  37   QCTRRNCSF---------MARNNERKLPLLPIGRLRLKVSASSGE---------EAESAY  78

Query  218  IENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITS  397
            +E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ+GL+ S
Sbjct  79   LEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQLGLVVS  138

Query  398  GSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGI  577
            GSLYGALIGS LA+  ADFLGRRREL+++++LY +GG +TA+AP    +++GR VYG+GI
Sbjct  139  GSLYGALIGSILAYPFADFLGRRRELIIAALLYAVGGSLTAYAPGLGALLLGRLVYGLGI  198

Query  578  GLAMHAAPMYIAETSP  625
            GLAMH AP+YIAET P
Sbjct  199  GLAMHGAPLYIAETCP  214



>ref|XP_009605737.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=457

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 22/196 (11%)
 Frame = +2

Query  50   NCSRYN*GFLPIFLELAKMATDDPEQLTFSSIG----QPGKSSGEIGSVQEPLLHGQQPH  217
             C+R N  F         MA ++  +L    IG    +   SSGE           +  +
Sbjct  37   QCTRRNCSF---------MARNNERKLPLLPIGRLRLKVSASSGE---------EAESAY  78

Query  218  IENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITS  397
            +E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ+GL+ S
Sbjct  79   LEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQLGLVVS  138

Query  398  GSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGI  577
            GSLYGALIGS LA+  ADFLGRRREL+++++LY +GG +TA+AP    +++GR VYG+GI
Sbjct  139  GSLYGALIGSILAYPFADFLGRRRELIIAALLYAVGGSLTAYAPGLGALLLGRLVYGLGI  198

Query  578  GLAMHAAPMYIAETSP  625
            GLAMH AP+YIAET P
Sbjct  199  GLAMHGAPLYIAETCP  214



>gb|KHN21925.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=552

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGISW+ LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  109  DIGATSGATISLQSPELSGISWFKLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  168

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  169  LITAALLYLFGGVITAYAPELGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  219



>ref|XP_003537973.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Glycine max]
Length=552

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGISW+ LS++Q+GL+ SGSLYGAL+GS +AF IADFLGR+++
Sbjct  109  DIGATSGATISLQSPELSGISWFKLSAIQLGLVVSGSLYGALLGSLVAFAIADFLGRKKQ  168

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL GG+ITA+AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  169  LITAALLYLFGGVITAYAPELGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  219



>gb|KHG28803.1| hypothetical protein F383_00413 [Gossypium arboreum]
Length=559

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + IAD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPIADSLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG++TAFAP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>gb|KJB20002.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=456

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPVADSLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG++TAFAP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>ref|XP_004163808.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG SW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  142  DIGATSGATLSLQSPELSGTSWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  201

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ LY IG L TA++P    ++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  202  LIIAAGLYAIGSLTTAYSPDLGFLLAGRLLYGLGIGLAMHGAPLYIAETCP  252



>ref|XP_009381068.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A+IS++S   SG +W++LS+VQ+GL+ SGSLYGAL GS +A+  +DFLGRRRE
Sbjct  114  DIGATSGASISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALAGSLIAYPTSDFLGRRRE  173

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +S+LYL+GGL+T  AP  V+++IGR +YG+GIG+AMH AP+YIAETSP
Sbjct  174  LITASVLYLVGGLVTGCAPDLVVLIIGRLIYGIGIGMAMHGAPLYIAETSP  224



>gb|KJB20003.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=484

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPVADSLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG++TAFAP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>ref|XP_008457451.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Cucumis 
melo]
Length=585

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG SW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  142  DIGATSGATLSLQSPELSGTSWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  201

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ LY IG L TA++P   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  202  LIIAAGLYAIGSLTTAYSPDLGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  252



>ref|XP_004294661.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 127/169 (75%), Gaps = 4/169 (2%)
 Frame = +2

Query  122  EQLTFS-SIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDI  298
            +QL FS  +G     S   G   + L+    P  E+YS V+ I+PF+FPALGGLL+GYDI
Sbjct  60   KQLRFSVKVGSQNDYSS--GDESQSLIPEASPQ-EDYSWVSVIIPFVFPALGGLLFGYDI  116

Query  299  GATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElm  478
            GATS ATIS+ SA  SG SW++L++VQ+GL+ SGSLYGAL GS L + IADFLGRRREL+
Sbjct  117  GATSGATISLMSAELSGTSWFNLTAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRELI  176

Query  479  lssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +++ LYL+GGLIT  AP   ++++GR +YG+GIG+AMH AP+YIAET P
Sbjct  177  IAATLYLLGGLITGCAPGLGVLLVGRVLYGIGIGMAMHGAPLYIAETCP  225



>gb|KJB20000.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
 gb|KJB20001.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=561

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPVADSLGRRRE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG++TAFAP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>emb|CBI16087.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRR E
Sbjct  64   DIGATSGATISLQSPELSGITWFELSAVQLGLVVSGSLYGALLGSILVYPIADFLGRRGE  123

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ILY +GGLITA AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  124  LITAAILYALGGLITASAPELDVLLVGRLLYGLGIGLAMHGAPLYIAETCP  174



>ref|XP_003606724.1| D-xylose-proton symporter-like protein [Medicago truncatula]
Length=485

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG++W +LSS+Q+GL+ SGSLYGAL+GS LAF IADF+GR+R+
Sbjct  113  DIGATSGATISLQSPELSGVAWSNLSSIQLGLVVSGSLYGALLGSLLAFAIADFIGRKRQ  172

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LY++G  ITA AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  173  LIGAALLYVLGSAITATAPELGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  223



>ref|XP_008777375.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008777383.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
Length=564

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A+IS++SA  SG +W++LS+VQ+GL+ SGSLYGAL GS +A+ IAD LGRRRE
Sbjct  121  DIGATSGASISLQSAELSGTTWFNLSAVQLGLVVSGSLYGALAGSIIAYPIADILGRRRE  180

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ LY++GGLIT +AP  ++++IGR +YG+GIGLAMH  P+YIAET P
Sbjct  181  LITAAALYVVGGLITGYAPDLLVLIIGRLLYGIGIGLAMHGGPLYIAETCP  231



>gb|AES88921.2| sugar transporter [Medicago truncatula]
Length=493

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG++W +LSS+Q+GL+ SGSLYGAL+GS LAF IADF+GR+R+
Sbjct  113  DIGATSGATISLQSPELSGVAWSNLSSIQLGLVVSGSLYGALLGSLLAFAIADFIGRKRQ  172

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LY++G  ITA AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  173  LIGAALLYVLGSAITATAPELGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  223



>ref|XP_002280634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Vitis 
vinifera]
 gb|ADP37178.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=561

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGI+W++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRR E
Sbjct  118  DIGATSGATISLQSPELSGITWFELSAVQLGLVVSGSLYGALLGSILVYPIADFLGRRGE  177

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ILY +GGLITA AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  178  LITAAILYALGGLITASAPELDVLLVGRLLYGLGIGLAMHGAPLYIAETCP  228



>ref|XP_004145283.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004153144.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65747.1| hypothetical protein Csa_1G524690 [Cucumis sativus]
Length=585

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG SW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  142  DIGATSGATLSLQSPELSGTSWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  201

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ LY IG L TA++P    ++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  202  LIIAAGLYAIGSLTTAYSPDLGFLLAGRLLYGLGIGLAMHGAPLYIAETCP  252



>ref|XP_010535453.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=531

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS VQ+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  114  DIGATSGATISLQSPELSGTAWFNLSPVQLGLVVSGSLYGALFGSLLVYGIADFLGRRRE  173

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G L+TA AP   I++ GR +YG+GIG+AMH AP+YIAET P
Sbjct  174  LIIAAVLYLLGSLVTACAPDLGILLFGRLLYGLGIGMAMHGAPLYIAETCP  224



>ref|XP_010535452.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=557

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS VQ+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  114  DIGATSGATISLQSPELSGTAWFNLSPVQLGLVVSGSLYGALFGSLLVYGIADFLGRRRE  173

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G L+TA AP   I++ GR +YG+GIG+AMH AP+YIAET P
Sbjct  174  LIIAAVLYLLGSLVTACAPDLGILLFGRLLYGLGIGMAMHGAPLYIAETCP  224



>ref|XP_010106537.1| D-xylose-proton symporter-like 3 [Morus notabilis]
 gb|EXC10713.1| D-xylose-proton symporter-like 3 [Morus notabilis]
Length=500

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 127/170 (75%), Gaps = 7/170 (4%)
 Frame = +2

Query  122  EQLTFSSIG--QPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyD  295
             +L FS+    Q G SS E     E  L       E +S V+ ILPFLFPALGGLL+GYD
Sbjct  3    RRLRFSAKAGAQEGYSSEE-----EAALVSDAGDREEFSWVSVILPFLFPALGGLLFGYD  57

Query  296  IGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRREl  475
            IGATS ATIS++S   SG +WY+LS+VQ+GL+ SGSLYGAL+G  + + IADFLGRRREL
Sbjct  58   IGATSGATISLQSPELSGTNWYNLSAVQLGLVVSGSLYGALLGCSIVYPIADFLGRRREL  117

Query  476  mlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +++++LYL+GGLITA+AP   +++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  118  IIAAVLYLLGGLITAYAPELGVLLAGRLLYGLGIGLAMHGAPLYIAETCP  167



>ref|XP_009779937.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  200  HGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQ  379
            + +  ++E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ
Sbjct  78   NAESAYLEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQ  137

Query  380  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  559
            +GL+ SGSLYGALIGS LA+  ADFLGRRREL+++++LY  GG +TA+AP    +++GR 
Sbjct  138  LGLVVSGSLYGALIGSILAYPFADFLGRRRELIIAALLYAAGGSLTAYAPGLGALLLGRL  197

Query  560  VYGVGIGLAMHAAPMYIAETSP  625
            VYG+GIGLAMH AP+YIAET P
Sbjct  198  VYGLGIGLAMHGAPLYIAETCP  219



>ref|XP_008349595.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++LS++Q+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  120  DIGATSGATLSLQSPELSGTAWFNLSAIQLGLVVSGSLYGALFGSLLVYPIADFLGRRRE  179

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL+G LITA AP   ++++GR +YG+GIG+AMH AP+YIAET P
Sbjct  180  LITAAVLYLLGALITATAPGLSVLLVGRVLYGLGIGMAMHGAPLYIAETCP  230



>ref|XP_008384924.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++LS++Q+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  120  DIGATSGATLSLQSPELSGTAWFNLSAIQLGLVVSGSLYGALFGSLLVYPIADFLGRRRE  179

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL+G LITA AP   ++++GR +YG+GIG+AMH AP+YIAET P
Sbjct  180  LITAAVLYLLGALITATAPGLSVLLVGRVLYGLGIGMAMHGAPLYIAETCP  230



>ref|XP_009779936.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=552

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  200  HGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQ  379
            + +  ++E +S  + ILPFLFPALGGLL+GYDIGATS ATIS++SA  SG +WY+ S+VQ
Sbjct  78   NAESAYLEEFSWSSVILPFLFPALGGLLFGYDIGATSGATISLQSAELSGTTWYNFSAVQ  137

Query  380  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  559
            +GL+ SGSLYGALIGS LA+  ADFLGRRREL+++++LY  GG +TA+AP    +++GR 
Sbjct  138  LGLVVSGSLYGALIGSILAYPFADFLGRRRELIIAALLYAAGGSLTAYAPGLGALLLGRL  197

Query  560  VYGVGIGLAMHAAPMYIAETSP  625
            VYG+GIGLAMH AP+YIAET P
Sbjct  198  VYGLGIGLAMHGAPLYIAETCP  219



>ref|XP_009375941.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Pyrus 
x bretschneideri]
Length=563

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S+VQ+GL+ SGSLYGAL GS L + IADFLGRRRE
Sbjct  120  DIGATSGATLSLQSPELSGTAWFNFSAVQLGLVVSGSLYGALFGSLLVYPIADFLGRRRE  179

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL+G LITA AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  180  LITAAVLYLLGALITATAPGLSVLLVGRVLYGLGIGLAMHGAPLYIAETCP  230



>ref|XP_011089518.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Sesamum 
indicum]
Length=558

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++ S+VQ+GL+ SGSLYGAL GS + + +ADFLGRRRE
Sbjct  115  DIGATSGATISLQSPELSGTNWFNFSAVQLGLVVSGSLYGALAGSLVVYPLADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++S+ YL G L+TA+AP   ++++ RF+YG+GIG+AMH AP+YIAET P
Sbjct  175  LIIASLFYLTGALLTAYAPGLGVLLVARFLYGLGIGMAMHGAPLYIAETCP  225



>gb|EYU45952.1| hypothetical protein MIMGU_mgv1a003885mg [Erythranthe guttata]
Length=558

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++ S+VQ+GL+ SGSLYGAL+GS + + +ADFLGRRRE
Sbjct  115  DIGATSGATISLQSPELSGTTWFNFSAVQLGLVVSGSLYGALLGSLIVYPLADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++S+LYL G L+TA+AP   ++++ R +YG+GIG+AMH AP+YIAET P
Sbjct  175  LIIASLLYLTGALLTAYAPGLGVLLVARLLYGLGIGMAMHGAPLYIAETCP  225



>ref|XP_006342314.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Solanum tuberosum]
Length=545

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 122/155 (79%), Gaps = 7/155 (5%)
 Frame = +2

Query  161  SSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESAT  340
            SSGE G   EP       +IE +S  + ILPF+FPALGGLL+GYDIGATS ATIS++S  
Sbjct  65   SSGE-GEEAEP------GYIEEFSWSSVILPFIFPALGGLLFGYDIGATSGATISLQSPE  117

Query  341  SSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTA  520
             SG+SWY+LS+VQ+GL+ SGSLYGALIGS LA+  ADFLGRRREL++++ILYL GG +TA
Sbjct  118  LSGMSWYNLSAVQLGLVVSGSLYGALIGSILAYPFADFLGRRRELIIAAILYLAGGSLTA  177

Query  521  FAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
             AP    +++GR VYG+GIGLAMH AP+YIAET P
Sbjct  178  CAPGLGALLLGRLVYGLGIGLAMHGAPLYIAETCP  212



>ref|XP_006401006.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
 gb|ESQ42459.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
Length=558

 Score =   125 bits (314),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G LIT  AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  175  LIIAAVLYLLGSLITGSAPNLNVLLVGRLLYGLGIGLAMHGAPLYIAETCP  225



>gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=552

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SG +WY+ S+VQ+GL+ SGSLYGAL GS LA+  ADFLGRRRE
Sbjct  109  DIGATSGATISLQSAELSGTTWYNFSAVQLGLVVSGSLYGALFGSILAYPFADFLGRRRE  168

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY  GG +TA+AP    +++GR VYG+GIGLAMH AP+YIAET P
Sbjct  169  LIIAALLYAAGGSLTAYAPGLGALLLGRLVYGLGIGLAMHGAPLYIAETCP  219



>emb|CDX74227.1| BnaA03g28200D [Brassica napus]
Length=483

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 113/172 (66%), Gaps = 23/172 (13%)
 Frame = +2

Query  116  DPEQLTFSSIGQPGKSSG-EIGSVQEPLLHGQQPHI-ENYSVVACIlpflfpalggllyg  289
            D E+ +   + Q G  S   + SVQEPL+  +Q H  ENYSV+A I PFLFPALG  L+G
Sbjct  4    DAEKQSIVHVEQVGDLSLIGLSSVQEPLI--KQKHTPENYSVLAAIPPFLFPALGTFLFG  61

Query  290  yDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRR  469
            Y+IGATSCATISI+S T SGISWY+LSSV +G+ITSGSL   LI +   + I   +    
Sbjct  62   YEIGATSCATISIKSPTLSGISWYNLSSVDVGIITSGSLRKGLITAAFLYLIGAIV----  117

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
                           TA APV+ +++IGR VYG+G+GL MHAAPMYIAET+P
Sbjct  118  ---------------TAVAPVFPVLIIGRVVYGIGVGLTMHAAPMYIAETAP  154



>ref|XP_002992213.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
 gb|EFJ06710.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
Length=470

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A+IS+ S   SG  WY L+S+Q GL+ SGSLYGAL+GS LA+N+AD LGRR+E
Sbjct  21   DIGATSGASISLTSPELSGTDWYQLTSIQTGLVVSGSLYGALLGSILAYNVADRLGRRKE  80

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ +Y IG L+T  AP + +++ GR  +G GIGLAMH APMYI+ETSP
Sbjct  81   LISAAAIYCIGSLVTGLAPNFPVILAGRLAFGFGIGLAMHGAPMYISETSP  131



>ref|XP_002982112.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
 gb|EFJ16780.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
Length=470

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A+IS+ S   SG  WY L+S+Q GL+ SGSLYGAL+GS LA+N+AD LGRR+E
Sbjct  21   DIGATSGASISLTSPELSGTDWYQLTSIQTGLVVSGSLYGALLGSILAYNVADRLGRRKE  80

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ ++ +Y IG L+T  AP + +++ GR  +G GIGLAMH APMYI+ETSP
Sbjct  81   LISAAAIYCIGSLVTGLAPNFPVILAGRLAFGFGIGLAMHGAPMYISETSP  131



>ref|XP_002866311.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42570.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  116  DIGATSGATLSLQSPVLSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G LIT  AP   I+++GR +YG GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCP  226



>ref|NP_001287653.1| D-xylose-proton symporter-like 3, chloroplastic-like [Solanum 
lycopersicum]
 ref|XP_004235087.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
 dbj|BAO96238.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
 dbj|BAQ03806.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
Length=545

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 113/137 (82%), Gaps = 0/137 (0%)
 Frame = +2

Query  215  HIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLIT  394
            +IE +S  + ILPF FPALGGLL+GYDIGATS ATIS++S   SG+SWY+LS+VQ+GL+ 
Sbjct  76   YIEEFSWSSVILPFFFPALGGLLFGYDIGATSGATISLQSPELSGMSWYNLSAVQLGLVV  135

Query  395  SGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVG  574
            SGSLYGALIGS LA+  ADFLGR REL++++ILYL GG +TA AP    +++GR VYG+G
Sbjct  136  SGSLYGALIGSILAYPFADFLGRSRELIIAAILYLAGGSLTACAPGLGALLLGRLVYGLG  195

Query  575  IGLAMHAAPMYIAETSP  625
            IGLAMH AP+YIAET P
Sbjct  196  IGLAMHGAPLYIAETCP  212



>ref|XP_010443656.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 132/201 (66%), Gaps = 32/201 (16%)
 Frame = +2

Query  35   ISFPGNCSRYN*GFLPIFLELAKMATDDPEQLTFSSIGQPGK--SSGEIGSV--QEPLLH  202
            +S PG  SRY                    Q+  + IG  G+   SGE+ SV   EP   
Sbjct  53   VSKPGLVSRYR-------------------QILQAGIGAGGEFADSGEVASVASDEP---  90

Query  203  GQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQI  382
                  E++S  + ILPF+FPALGGLL+GYDIGATS AT+S++S   SG +W++ S VQ+
Sbjct  91   ------ESFSWSSVILPFIFPALGGLLFGYDIGATSGATLSLQSPALSGTTWFNFSPVQL  144

Query  383  GLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFV  562
            GL+ SGSLYGAL+GS   + +ADFLGRRREL+++++LYL+G LIT  AP   ++++GR +
Sbjct  145  GLVVSGSLYGALLGSISVYGVADFLGRRRELIIAAVLYLLGSLITGCAPDLNVLLVGRLL  204

Query  563  YGVGIGLAMHAAPMYIAETSP  625
            YG GIGLAMH AP+YIAET P
Sbjct  205  YGFGIGLAMHGAPLYIAETCP  225



>ref|NP_200733.2| Major facilitator superfamily protein [Arabidopsis thaliana]
 sp|Q0WWW9.2|XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09770.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AAU05477.1| At5g59250 [Arabidopsis thaliana]
 gb|AAV85693.1| At5g59250 [Arabidopsis thaliana]
 gb|AED97162.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=558

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G LIT  AP   I+++GR +YG GIGLAMH AP+YIAET P
Sbjct  175  LIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCP  225



>gb|KDO66624.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=496

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  226



>dbj|BAE98379.1| D-xylose-H+ symporter - like protein [Arabidopsis thaliana]
Length=558

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G LIT  AP   I+++GR +YG GIGLAMH AP+YIAET P
Sbjct  175  LIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAETCP  225



>ref|XP_006279761.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
 gb|EOA12659.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
Length=559

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + IADFLGRRRE
Sbjct  115  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGIADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G LIT  AP   ++++GR +YG GIGLAMH AP+YIAET P
Sbjct  175  LIIAAVLYFLGSLITGSAPDLNVLLVGRLLYGFGIGLAMHGAPLYIAETCP  225



>ref|XP_010454633.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  116  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G LIT  AP   ++++GR +YG GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYLLGSLITGCAPDLNVLLVGRLLYGFGIGLAMHGAPLYIAETCP  226



>ref|XP_010483521.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=560

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++S   SG +W++ S VQ+GL+ SGSLYGAL+GS   + +ADFLGRRRE
Sbjct  116  DIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISVYGVADFLGRRRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LYL+G LIT  AP   ++++GR +YG GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYLLGSLITGCAPDLNVLLVGRLLYGFGIGLAMHGAPLYIAETCP  226



>ref|XP_006488378.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=559

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  226



>gb|KDO66619.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  226



>gb|KDO66618.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=553

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  110  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  169

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  170  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  220



>ref|XP_006488379.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=553

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  110  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  169

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  170  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  220



>ref|XP_006424897.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38137.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=553

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  110  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  169

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  170  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  220



>ref|XP_006424895.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38135.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=534

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  226



>gb|KDO66623.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+RE
Sbjct  116  DIGATSGATISLQSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY +G L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  226



>gb|EEE60202.1| hypothetical protein OsJ_13164 [Oryza sativa Japonica Group]
Length=488

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  484
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  140  KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  199

Query  485  silyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + LY+ G L+T FAP +V+++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  200  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGLAMHGAPLYIAETSP  246



>gb|AAO18445.1| putative sugar transporter protein [Oryza sativa Japonica Group]
Length=525

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  484
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  86   KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  145

Query  485  silyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + LY+ G L+T FAP +V+++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  146  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGLAMHGAPLYIAETSP  192



>gb|EEC76432.1| hypothetical protein OsI_14118 [Oryza sativa Indica Group]
Length=579

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  484
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  140  KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  199

Query  485  silyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            + LY+ G L+T FAP +V+++IGR +YG+GIGLAMH AP+YIAETSP
Sbjct  200  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGLAMHGAPLYIAETSP  246



>emb|CDP09100.1| unnamed protein product [Coffea canephora]
Length=567

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS+ S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L + +ADFLGRRRE
Sbjct  124  DIGATSGATISLLSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSLLVYPLADFLGRRRE  183

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ILY IG   TA+AP   ++++ R VYG+GIGLAMH AP+YIAET P
Sbjct  184  LIMAAILYAIGSASTAYAPGLAVLLLARLVYGLGIGLAMHGAPLYIAETCP  234



>ref|XP_008681530.1| PREDICTED: uncharacterized protein LOC100274077 isoform X1 [Zea 
mays]
Length=586

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 91/138 (66%), Gaps = 27/138 (20%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG  W+ LSS+Q+GL+ SGSLYGAL GS LA+ IADFLGRR E
Sbjct  116  DIGATSGATISVQSPDLSGTDWFSLSSLQLGLVASGSLYGALGGSLLAYRIADFLGRRIE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGL-----------------------  583
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GIGL                       
Sbjct  176  LVTAAALYILGALVTGFAPNFVALIIGRVLYGIGIGLGMICLDETWTSHVSLTVSNKELR  235

Query  584  ----AMHAAPMYIAETSP  625
                AMH AP+YIAETSP
Sbjct  236  KTAMAMHGAPLYIAETSP  253



>emb|CAN83894.1| hypothetical protein VITISV_039113 [Vitis vinifera]
Length=606

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 92/127 (72%), Gaps = 16/127 (13%)
 Frame = +2

Query  293  DIGATSCATISIE----------------SATSSGISWYDLSSVQIGLITSGSLYGALIG  424
            DIGATS ATIS++                S   SGI+W++LS+VQ+GL+ SGSLYGAL+G
Sbjct  118  DIGATSGATISLQRPVLLKLIFIILTILKSPELSGITWFELSAVQLGLVVSGSLYGALLG  177

Query  425  SFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPM  604
            S L + IADFLGRR EL+ ++ILY +GGLITA AP   ++++GR +YG GIGLAMH AP+
Sbjct  178  SILVYPIADFLGRRGELITAAILYALGGLITASAPELDVLLVGRLLYGJGIGLAMHGAPL  237

Query  605  YIAETSP  625
            YIAET P
Sbjct  238  YIAETCP  244



>ref|XP_004951635.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Setaria italica]
Length=157

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 80/99 (81%), Gaps = 0/99 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SG +W++ SSVQ+GL+ SGSLYGAL GS LA  IADFLGRR E
Sbjct  51   DIGATSGATISVQSADLSGTTWFNRSSVQLGLVASGSLYGALGGSILAHRIADFLGRRIE  110

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAM  589
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GIGL +
Sbjct  111  LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGLRL  149



>ref|XP_004951634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Setaria italica]
Length=160

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++SA  SG +W++ SSVQ+GL+ SGSLYGAL GS LA  IADFLGRR E
Sbjct  51   DIGATSGATISVQSADLSGTTWFNRSSVQLGLVASGSLYGALGGSILAHRIADFLGRRIE  110

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGL  583
            L+ ++ LY++G L+T FAP +V ++IGR +YG+GIGL
Sbjct  111  LVTAAALYILGALVTGFAPNFVGLIIGRILYGIGIGL  147



>ref|XP_008455658.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Cucumis 
melo]
Length=408

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +2

Query  389  ITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYG  568
            +TSGSLYGALIGS LAFN+ADFLGRRREL+LS+++YL+G +IT  AP + I++IGRF+ G
Sbjct  1    MTSGSLYGALIGSVLAFNVADFLGRRRELILSALMYLVGAIITGLAPNFAILIIGRFISG  60

Query  569  VGIGLAMHAAPMYIAETSP  625
             GIGLAMHAAPMYIAETSP
Sbjct  61   TGIGLAMHAAPMYIAETSP  79



>ref|XP_002300123.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
 gb|EEE84928.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
Length=559

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++SA  SGISW++LS+VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  116  DIGATSGATLSLQSAELSGISWFNLSAVQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  175

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +++LYL GGL+T +AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  176  LIAAALLYLFGGLVTGYAPGLNVLLLGRLLYGLGIGLAMHGAPLYIAETCP  226



>gb|KDO66622.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=436

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 83/99 (84%), Gaps = 0/99 (0%)
 Frame = +2

Query  329  ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyligg  508
            +S   SG +W++LS+VQ+GL+ SGSLYGAL+GS L ++IADFLGR+REL+++++LY +G 
Sbjct  5    QSPELSGTTWFNLSAVQLGLVVSGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGA  64

Query  509  liTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L TA+AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  65   LTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCP  103



>ref|XP_002520519.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41932.1| sugar transporter, putative [Ricinus communis]
Length=505

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SG +W++LS++Q+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  62   DIGATSGATISLQSPELSGTTWFNLSAIQLGLVVSGSLYGALLGSLLVYPIADFLGRRRE  121

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GGLITA+AP   I++ GR +YG+GIGLAMH AP+YIAET P
Sbjct  122  LIIAAVLYMLGGLITAYAPSLGILLGGRLLYGLGIGLAMHGAPLYIAETCP  172



>ref|XP_009120413.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brassica 
rapa]
Length=555

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++SAT SG +W++LS VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  111  DIGATSGATLSLQSATLSGTTWFNLSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  170

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ LYL+G LIT  AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  171  LIIAAGLYLLGSLITGCAPDLNVLLLGRLLYGLGIGLAMHGAPLYIAETCP  221



>emb|CDY33006.1| BnaA10g12120D [Brassica napus]
Length=555

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 93/111 (84%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++SAT SG +W++LS VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  111  DIGATSGATLSLQSATLSGTTWFNLSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  170

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++S LYL+G LIT  AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  171  LIIASGLYLLGSLITGCAPDLNVLLLGRLLYGLGIGLAMHGAPLYIAETCP  221



>ref|XP_005845570.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
 gb|EFN53468.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
Length=502

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A +S+ S   SG  WY LS+ Q GL+ S SL GAL+GS  A    D LGRRRE
Sbjct  70   DIGATSGALVSMTSQQYSGTDWYSLSAFQSGLVVSLSLAGALLGSGAALLYGDKLGRRRE  129

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +S LY    L+ A AP    ++ GR +YGVGIG AMHAAP YIAETSP
Sbjct  130  LLGASALYGAASLVVALAPGLPTVMAGRLLYGVGIGFAMHAAPAYIAETSP  180



>emb|CDY54245.1| BnaC09g53840D [Brassica napus]
Length=559

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS AT+S++SA  SG +W++LS VQ+GL+ SGSLYGAL+GS L + IADFLGRRRE
Sbjct  115  DIGATSGATLSLQSAALSGTTWFNLSPVQLGLVVSGSLYGALLGSTLVYGIADFLGRRRE  174

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++ LYL+G LIT  AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  175  LIIAAGLYLLGSLITGCAPDLNVLLLGRLLYGLGIGLAMHGAPLYIAETCP  225



>ref|XP_010043498.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW85511.1| hypothetical protein EUGRSUZ_B02309 [Eucalyptus grandis]
Length=570

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 128/178 (72%), Gaps = 4/178 (2%)
 Frame = +2

Query  92   ELAKMATDDPEQLTFSSIGQPGKSSGEIGSVQEPLLHGQQPHIENYSVVACIlpflfpal  271
            EL  +      +L F+ +G   +     G  + P+     P+ E +S  + ILPFLFPAL
Sbjct  64   ELPNLPLLPSSKLEFA-VGAQREYDSSAGDAELPI---SDPNQEEFSWSSVILPFLFPAL  119

Query  272  ggllygyDIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD  451
            GGLL+GYDIGATS AT+S++S   SG +WY+LS+VQ+GL+ SGSLYGAL+GS L + IAD
Sbjct  120  GGLLFGYDIGATSGATLSMQSPQLSGTTWYNLSAVQLGLVVSGSLYGALLGSLLVYPIAD  179

Query  452  FLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            FLGRRREL+ +++LY+ GG IT+ AP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  180  FLGRRRELITAAVLYVSGGAITSLAPGLGVLLLGRLLYGLGIGLAMHGAPLYIAETCP  237



>gb|KJB20004.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=541

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 20/111 (18%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++                     SGSLYGAL+GS L + +AD LGRRRE
Sbjct  118  DIGATSGATISLQ--------------------VSGSLYGALLGSLLVYPVADSLGRRRE  157

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+++++LY++GG++TAFAP   ++++GR +YG+GIGLAMH AP+YIAET P
Sbjct  158  LLIAALLYVLGGVLTAFAPGLSVLLVGRLLYGLGIGLAMHGAPLYIAETCP  208



>gb|ABF99614.1| sugar transporter family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=545

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  308  SCATISIE-SATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmls  484
              A +SI  SA  SG +W+ LSS+Q+GL+ SGSLYGAL GS LA+ +ADFLGRR EL+ +
Sbjct  140  KIAPLSISLSAELSGTTWFSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTA  199

Query  485  silyliggliTAFAPVYVIMVIGRFVYGVGIGL  583
            + LY+ G L+T FAP +V+++IGR +YG+GIGL
Sbjct  200  AALYISGALVTGFAPDFVLLIIGRLLYGIGIGL  232



>dbj|BAH19966.1| AT5G59250 [Arabidopsis thaliana]
Length=415

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = +2

Query  380  IGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  559
            +GL+ SGSLYGAL+GS   + +ADFLGRRREL+++++LYL+G LIT  AP   I+++GR 
Sbjct  1    LGLVVSGSLYGALLGSISVYGVADFLGRRRELIIAAVLYLLGSLITGCAPDLNILLVGRL  60

Query  560  VYGVGIGLAMHAAPMYIAETSP  625
            +YG GIGLAMH AP+YIAET P
Sbjct  61   LYGFGIGLAMHGAPLYIAETCP  82



>ref|XP_011400947.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27940.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
Length=529

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGA+S A +S+ S T SG  WY LS +  GL+ S SL GAL+GS  AF + D LGRR E
Sbjct  81   DIGASSGAIVSMTSPTLSGTDWYALSPLLTGLVVSSSLGGALLGSAAAFVVGDRLGRRGE  140

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+L++ LY  G    A AP    ++  R ++G+GIG AMHAAP YIAETSP
Sbjct  141  LLLAAGLYAGGAAGGALAPSLGAVLAARALFGLGIGFAMHAAPAYIAETSP  191



>gb|KHN18956.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=90

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS ATIS++S   SGISW++LS++Q+GL+ SGSLYGAL+GS +AF  ADFLGR+++
Sbjct  16   DIGATSGATISLQSPELSGISWFNLSAIQLGLVVSGSLYGALLGSLVAFARADFLGRKKQ  75



>gb|EPS59382.1| hypothetical protein M569_15426, partial [Genlisea aurea]
Length=411

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +2

Query  392  TSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGV  571
             SGSLYGAL+GS + + IADFLGR REL+++S+ YLIG L+TA+AP   +++I R +YG+
Sbjct  1    VSGSLYGALLGSLIVYPIADFLGRNRELIIASVFYLIGALLTAYAPGLGVLLIARLIYGL  60

Query  572  GIGLAMHAAPMYIAETSP  625
            GIG+AMH AP+YIAET P
Sbjct  61   GIGMAMHGAPLYIAETCP  78



>emb|CBJ33077.1| conserved unknown protein [Ectocarpus siliculosus]
Length=523

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 81/122 (66%), Gaps = 11/122 (9%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDL---SSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            DIGATS     +ES+T S +SWY++   S++  G+ITS ++ GA+IGS + F + D LGR
Sbjct  63   DIGATSSVLTQLESSTYSDVSWYNVVASSTLLQGIITSNAVLGAMIGSIICFRVGDALGR  122

Query  464  RRElmlssilyliggliTAFA--PVY------VIMVIGRFVYGVGIGLAMHAAPMYIAET  619
            RRE++++++L+  G +I A +   V+      V+++IGR  YGVG G AMH AP YI E 
Sbjct  123  RREILVAAVLFFFGAIIEAVSGSSVWSGDWGLVVLMIGRVSYGVGCGFAMHGAPAYIGEM  182

Query  620  SP  625
            SP
Sbjct  183  SP  184



>ref|XP_003062688.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH53507.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=510

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 93/142 (65%), Gaps = 1/142 (1%)
 Frame = +2

Query  203  GQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLSSVQI  382
            G++P  ++  V A  L F+FPA+ GLL+G+DIG+TS A  S+    ++G+ WY L   Q 
Sbjct  42   GERPIADDVDVRATALLFIFPAIAGLLFGWDIGSTSGALQSLTDPNTAGMDWYALDPFQR  101

Query  383  GLITSGSLYGALIGSFLA-FNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRF  559
            GL+ S SL GAL+ S  A   + D LG R+EL L+++LY  G L+   A     +V+GRF
Sbjct  102  GLVVSTSLAGALVASATAALKLGDKLGSRKELQLAALLYAGGALVQGGAISLETLVLGRF  161

Query  560  VYGVGIGLAMHAAPMYIAETSP  625
             YG+GIG AMH AP+YIAET+P
Sbjct  162  TYGLGIGFAMHGAPLYIAETAP  183



>gb|KIZ01781.1| hypothetical protein MNEG_6180 [Monoraphidium neglectum]
Length=537

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS    S+ +   SG  W +LS+ Q GL+ S SL GAL GS +A    + LGRR E
Sbjct  72   DIGATSGVLTSLTNPQLSGTDWSNLSAFQSGLVVSTSLLGALAGSLVALAAGNRLGRRTE  131

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+++LY +       A     ++  R  YG+GIGLAMHAAP YIAETSP
Sbjct  132  ILLAALLYGVSSASLGAADSLNWLLACRLGYGLGIGLAMHAAPAYIAETSP  182



>gb|KDO66620.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
 gb|KDO66621.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=443

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  386  LITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVY  565
            L   GSLYGAL+GS L ++IADFLGR+REL+++++LY +G L TA+AP   ++++GR +Y
Sbjct  31   LALCGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGALTTAYAPGLGVLLVGRLLY  90

Query  566  GVGIGLAMHAAPMYIAETSP  625
            G+GIGLAMH AP+YIAET P
Sbjct  91   GLGIGLAMHGAPLYIAETCP  110



>ref|XP_006424896.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38136.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=443

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  386  LITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVY  565
            L   GSLYGAL+GS L ++IADFLGR+REL+++++LY +G L TA+AP   ++++GR +Y
Sbjct  31   LALCGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGALTTAYAPGLGVLLVGRLLY  90

Query  566  GVGIGLAMHAAPMYIAETSP  625
            G+GIGLAMH AP+YIAET P
Sbjct  91   GLGIGLAMHGAPLYIAETCP  110



>ref|XP_002179486.1| TRD4 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49309.1| TRD4, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=467

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 78/123 (63%), Gaps = 12/123 (10%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYD--LSS-VQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            DIGATS A + ++S   SG+SW+   LSS +  G I S    GALIGS LAF I D +GR
Sbjct  34   DIGATSYAIVQMQSPVLSGVSWFHTVLSSPILRGTILSSGSAGALIGSSLAFAIGDKIGR  93

Query  464  RRElmlssilyliggliTAFAPV---------YVIMVIGRFVYGVGIGLAMHAAPMYIAE  616
            RREL L S+LYL+G L+  +              ++++GR VYG+GIG++MHAAP YIAE
Sbjct  94   RRELQLGSLLYLLGALLEVWTAQSSSWGAVLGITVLILGRVVYGIGIGISMHAAPTYIAE  153

Query  617  TSP  625
              P
Sbjct  154  MGP  156



>gb|KDD76485.1| sugar transporter [Helicosporidium sp. ATCC 50920]
Length=587

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGA+S A +SI +  +SG  W+ +S+++ G++ S SL GAL+GS  A      LGRR+E
Sbjct  73   DIGASSGALVSITTPATSGTLWHGMSTLRSGMVVSSSLLGALLGSLAALLWGQALGRRKE  132

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++++  Y  G ++   AP Y +M+ GR +YG+GIGLAMHAAP YIAETSP
Sbjct  133  LLMAAWFYGGGSVLVGIAPAYSLMLAGRVLYGIGIGLAMHAAPAYIAETSP  183



>emb|CDY47336.1| BnaCnng14730D, partial [Brassica napus]
Length=261

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  392  TSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGV  571
            TS S YGAL GS +AFNIAD +G + EL+ ++ LYL+G ++TA APV+ +++ GR VYG+
Sbjct  36   TSCSHYGALNGSIVAFNIADIIGLK-ELVTAAFLYLVGAILTATAPVFPVLISGRVVYGI  94

Query  572  GIGLAMHAAPMYIAETSP  625
            G+GL MHAAP+YIAET+P
Sbjct  95   GLGLTMHAAPIYIAETAP  112



>ref|XP_002501745.1| sugar transporter [Micromonas sp. RCC299]
 gb|ACO63003.1| sugar transporter [Micromonas sp. RCC299]
Length=506

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 67/112 (60%), Gaps = 1/112 (1%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITS-GSLYGALIGSFLAFNIADFLGRRR  469
            DIG TS A  SI    +SG+ WY L S Q G++ S       L  +  A  + D  G + 
Sbjct  71   DIGTTSGALTSIMDPNTSGVDWYALDSFQQGMVVSTSLAGALLASAAAAVKVGDEFGSKT  130

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL L+++ Y  G ++   AP   ++++GRF YG+GIG AMHAAPMYIAET+P
Sbjct  131  ELQLAALFYGAGAIVQGLAPSLGVLIMGRFTYGLGIGFAMHAAPMYIAETAP  182



>ref|XP_009036253.1| general sugar transporter [Aureococcus anophagefferens]
 gb|EGB09136.1| general sugar transporter [Aureococcus anophagefferens]
Length=498

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 14/125 (11%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDL---SSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            DIGATS     ++SA  SG+SWYDL   SS   GL+TSG + GA +G+ + F +AD LGR
Sbjct  26   DIGATSYVLTQLQSAKFSGVSWYDLVARSSALQGLVTSGGVGGAFVGASIVFKVADDLGR  85

Query  464  RRElmlssilyliggl-----------iTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYI  610
            RREL+L + LY++G              +       ++V+GRFVYGVG G  MH AP YI
Sbjct  86   RRELLLGAALYVLGAACEFLGGGVGPYESGAGDGLFLLVLGRFVYGVGCGFVMHGAPSYI  145

Query  611  AETSP  625
            AE SP
Sbjct  146  AEMSP  150



>ref|XP_005708849.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
 gb|EME32329.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
Length=592

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 77/114 (68%), Gaps = 5/114 (4%)
 Frame = +2

Query  293  DIGATSCATI---SIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            D+G TS       +I+++ SS  S+ +LSS+ +G I + SL+GAL  S LAF   D +GR
Sbjct  139  DVGCTSSVLRVLGNIQASQSS--SFGELSSLTLGFIAAASLFGALGSSLLAFRFGDSIGR  196

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++EL+LS+ILY IG L+ A +P   ++ + R ++G GIG +MHAAP+YIAE  P
Sbjct  197  KKELLLSAILYSIGTLMEALSPNLPLLFLARLIFGAGIGFSMHAAPIYIAECVP  250



>ref|XP_005645204.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20660.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
Length=564

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIGATS A +S++SA +SG SWY+LSS Q G + S SL GAL GS  AF + D LGR+RE
Sbjct  130  DIGATSGALVSLKSAVTSGTSWYELSSFQSGFVVSSSLLGALAGSAAAFVVGDKLGRKRE  189

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMH  592
            LML ++LY     + AFAP   ++++GR +YG+GIG  MH
Sbjct  190  LMLGAVLYGTSAALMAFAPNLELLLLGRTLYGLGIGFTMH  229



>emb|CEF97100.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 
3 [Ostreococcus tauri]
Length=499

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLA-FNIADFLGRRR  469
            DIG +S A  +I ++ ++G   + L+S+Q G   S SL+GAL+ S +A   I D LG RR
Sbjct  55   DIGISSGALENITTSAANGGDGFALNSIQSGQFVSASLFGALMASAVAGAGIGDRLGARR  114

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL L+++LYLIG +  + A  + ++V  + VYG+G+G AM +AP+YIAET+P
Sbjct  115  ELALAAMLYLIGSVSGSAANGFELLVFSKLVYGLGVGFAMQSAPVYIAETAP  166



>ref|XP_009032417.1| hypothetical protein AURANDRAFT_18763 [Aureococcus anophagefferens]
 gb|EGB12775.1| hypothetical protein AURANDRAFT_18763 [Aureococcus anophagefferens]
Length=501

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 69/121 (57%), Gaps = 10/121 (8%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDL--SSVQIGLITSGSLYGALIGSFLAFNIADFLGRR  466
            DIGAT+ A   + S   SG SW+    +SV  G+I S  + GA +GS L        GR 
Sbjct  41   DIGATAVALDDMGSEQWSGTSWHAAAANSVVRGVIVSAVMVGAALGSLLVLRYETDWGRV  100

Query  467  RElmlssilyliggliTAF-------APV-YVIMVIGRFVYGVGIGLAMHAAPMYIAETS  622
            +E+ L+S LY  G L+          AP+   +++ GR VYGVGIGLAMH AP YIAET+
Sbjct  101  KEMRLASALYGAGALVEGLSGSPGLSAPLGLTVLLFGRVVYGVGIGLAMHGAPTYIAETA  160

Query  623  P  625
            P
Sbjct  161  P  161



>ref|XP_005831465.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
 gb|EKX44485.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
Length=431

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 72/114 (63%), Gaps = 8/114 (7%)
 Frame = +2

Query  293  DIGATSCATISI--ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIAD-FLGR  463
            DIGA+S A + I  E  T  G     L  VQ+GL+ SGSL+GA+  S     I D + GR
Sbjct  46   DIGASS-AVVRILGEKQTLFG----TLDPVQLGLVASGSLFGAVAASGALIFIGDRYFGR  100

Query  464  RRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++EL+ S  LY +G  + A +  + +++  R +YG+GIG AMHAAP+YIAET+P
Sbjct  101  KQELIASGFLYTLGTALQAASSSFGMLIGSRILYGLGIGTAMHAAPLYIAETAP  154



>ref|XP_005783754.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
 gb|EOD31325.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
Length=502

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 9/115 (8%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG+TS A  S+          ++   +    ITS SL GA +GS LAF + + LGRRRE
Sbjct  36   DIGSTSGAVRSLRLLVG-----FEAKGMWTSAITSASLMGATLGSVLAFWVGEPLGRRRE  90

Query  473  lmlssilyliggliTAFAP----VYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L++ S LYL G L+   AP     Y  +  GR++YG+G+  +MHAAP+YI+E +P
Sbjct  91   LLVGSSLYLFGSLLCVAAPESGAAYGAVFAGRWLYGLGVAFSMHAAPVYISEMAP  145



>ref|XP_001416926.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95219.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
Length=530

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIA-DFLGRRR  469
            DIG +S A  +I ++ +SG   + L+S+Q G   S SL+GAL  S  A     D LG R+
Sbjct  86   DIGISSGALENITASAASGGDGFALTSIQSGQFVSASLFGALTASAAAGAGVGDRLGSRK  145

Query  470  ElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            EL+L++ LYL+G + ++ AP +  +V+ + +YG+GIG AMH+AP+YIAET+P
Sbjct  146  ELILAATLYLVGSVASSVAPGFEPLVLAKLIYGLGIGFAMHSAPVYIAETAP  197



>gb|EWM26836.1| d-xylose-proton symporter-like protein [Nannochloropsis gaditana]
Length=663

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 76/121 (63%), Gaps = 12/121 (10%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISW---YDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            DIGAT+     ++S   +G++W    + SSV  G  T+ ++ GAL+G+ +   +   +GR
Sbjct  30   DIGATAYVLTQLQS-DKAGVAWGERIESSSVLRGFFTASAVGGALLGTVVVLQVEGSMGR  88

Query  464  RRElmlssilyliggliTAFAPVY-------VIMVIGRFVYGVGIGLAMHAAPMYIAETS  622
            RREL+L+++LY++GG    FA  +       V+ ++GR++YG GI  AMHAAP Y+AE S
Sbjct  89   RRELLLAALLYMMGGGFE-FASSFLSSDAGLVVCLLGRWIYGGGIAFAMHAAPAYLAEMS  147

Query  623  P  625
            P
Sbjct  148  P  148



>gb|AFK44058.1| unknown [Lotus japonicus]
Length=107

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +2

Query  515  TAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            TA AP + ++V+GR V+G+GIGLAMHAAPMYIAET+P
Sbjct  9    TALAPNFPVLVVGRLVFGIGIGLAMHAAPMYIAETAP  45



>gb|KJF15727.1| putative metabolite transport protein CsbC [Acidithrix ferrooxidans]
Length=213

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +2

Query  365  LSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIM  544
            +SS+   L+TS  L GA++G+F A  +AD +GRRR ++++++L+++G L   F+P  +++
Sbjct  57   ISSLDKELVTSLLLVGAMVGAFFAGKLADTIGRRRTVLITAVLFMVGVLGAGFSPSLLVL  116

Query  545  VIGRFVYGVGIGLAMHAAPMYIAETSP  625
            +I RFV GV +G A    P+YI E +P
Sbjct  117  IIMRFVIGVAVGSASMVVPLYIGEAAP  143



>ref|XP_009037217.1| hypothetical protein AURANDRAFT_26890 [Aureococcus anophagefferens]
 gb|EGB07837.1| hypothetical protein AURANDRAFT_26890 [Aureococcus anophagefferens]
Length=582

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 11/121 (9%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISW---YDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGR  463
            DIGATS     +E  +S G+SW      S++  GL+ S S+ GA   SFL F +A+ +GR
Sbjct  52   DIGATSYCVSELER-SSGGVSWGRAVGRSALLRGLVASASVLGAFCASFLVFAMAERIGR  110

Query  464  RRElmlssilyliggliTAFAPVY-------VIMVIGRFVYGVGIGLAMHAAPMYIAETS  622
            R E++  +  + +G + T  +             ++GR +YG G  LA HAAP YIAE +
Sbjct  111  RGEMVRGAACFGVGTVFTFLSAELDDARAGITCFLLGRAIYGCGCALATHAAPAYIAEMA  170

Query  623  P  625
            P
Sbjct  171  P  171



>ref|WP_007109838.1| sugar transporter, partial [Natrinema altunense]
 gb|ELY85262.1| sugar transporter, partial [Natrinema altunense JCM 12890]
Length=433

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 8/116 (7%)
 Frame = +2

Query  293  DIGATSCATISI----ESATSSGISWYDLSSVQI-GLITSGSLYGALIGSFLAFNIADFL  457
            D G  S A + I    E AT  G   Y +++  I G+I SG++ GA+IG+ L   +AD L
Sbjct  32   DTGVISGAMLYIRNTFELATVFG---YSMNASLIEGIIVSGAMIGAIIGAALGGRLADRL  88

Query  458  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GRRR +++ ++++ +G LI A AP   I+++GR V G+G+G A    P+YI+E SP
Sbjct  89   GRRRLILVGAVVFFVGSLIMAIAPTVEILIVGRIVDGIGVGFASVVGPLYISEISP  144



>ref|WP_006185197.1| sugar transporter [Natrinema pallidum]
 gb|ELY78597.1| sugar transporter [Natrinema pallidum DSM 3751]
Length=477

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 8/116 (7%)
 Frame = +2

Query  293  DIGATSCATISI----ESATSSGISWYDLSSVQI-GLITSGSLYGALIGSFLAFNIADFL  457
            D G  S A + I    E AT  G   Y +++  I G+I SG++ GA+IG+ L   +AD L
Sbjct  32   DTGVISGAMLYIRNTFELATVFG---YSMNASLIEGIIVSGAMIGAIIGAALGGRLADRL  88

Query  458  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GRRR +++ ++++ +G LI A AP   I+++GR V G+G+G A    P+YI+E SP
Sbjct  89   GRRRLILVGAVVFFVGSLIMAIAPTVEILIVGRIVDGIGVGFASVVGPLYISEISP  144



>ref|WP_012945178.1| major facilitator transporter [Haloterrigena turkmenica]
 ref|YP_003405607.1| sugar transporter [Haloterrigena turkmenica DSM 5511]
 gb|ADB62934.1| sugar transporter [Haloterrigena turkmenica DSM 5511]
Length=477

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +2

Query  293  DIGATSCATISIESATS-SGISWYDLSSVQI-GLITSGSLYGALIGSFLAFNIADFLGRR  466
            D G  S A + I  A   + +  Y ++   + G+I SG++ GA+IG+ L   +AD LGRR
Sbjct  33   DTGVISGAMLYIRDAFELTAVFGYTMNPSYVEGVIVSGAMVGAIIGAALGGRLADRLGRR  92

Query  467  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R +++S++++ +G LI A AP   I+++GR + GVGIG A    P+YI+E SP
Sbjct  93   RLILVSAVVFFVGSLIMAIAPTVEILIVGRILDGVGIGFASVVGPLYISEISP  145



>ref|WP_014862590.1| major facilitator transporter [Natrinema sp. J7-2]
 ref|YP_006539414.1| sugar transporter [Natrinema sp. J7-2]
 gb|AFO55338.1| sugar transporter [Natrinema sp. J7-2]
Length=477

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 71/116 (61%), Gaps = 8/116 (7%)
 Frame = +2

Query  293  DIGATSCATISI----ESATSSGISWYDLSSVQI-GLITSGSLYGALIGSFLAFNIADFL  457
            D G  S A + I    E AT  G   Y +++  I G+I SG++ GA+IG+ L   +AD L
Sbjct  32   DTGVISGAMLYIRHTFELATVFG---YSMNASLIEGIIVSGAMIGAIIGAALGGRLADRL  88

Query  458  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GRRR +++ ++++ +G  + A AP   I+++GR V G+G+G A    P+YI+E SP
Sbjct  89   GRRRLILVGAVVFFVGSFVMAIAPTVEILIVGRIVDGIGVGFASVVGPLYISEISP  144



>ref|WP_008455808.1| sugar transporter [Natrinema gari]
 gb|ELY79496.1| sugar transporter [Natrinema gari JCM 14663]
Length=477

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 71/116 (61%), Gaps = 8/116 (7%)
 Frame = +2

Query  293  DIGATSCATISI----ESATSSGISWYDLSSVQI-GLITSGSLYGALIGSFLAFNIADFL  457
            D G  S A + I    E AT  G   Y +++  I G+I SG++ GA+IG+ L   +AD L
Sbjct  32   DTGVISGAMLYIRHTFELATVFG---YSMNASLIEGIIVSGAMIGAIIGAALGGRLADRL  88

Query  458  GRRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            GRRR +++ ++++ +G  I A AP   I+++GR V G+G+G A    P+YI+E SP
Sbjct  89   GRRRLILVGAVVFFVGSFIMAIAPTVEILIVGRIVDGIGVGFASVVGPLYISEISP  144



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  51   DIGVMSXASLFIKEN-------LNISDVQVEVLNGTXNIYSLIGSALAGKTSDWIGRRYT  103

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  104  IVLAETIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  154



>ref|WP_013879135.1| major facilitator transporter [Halopiger xanaduensis]
 ref|YP_004596119.1| sugar transporter [Halopiger xanaduensis SH-6]
 gb|AEH36240.1| sugar transporter [Halopiger xanaduensis SH-6]
Length=480

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 72/115 (63%), Gaps = 6/115 (5%)
 Frame = +2

Query  293  DIGATSCATISI----ESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            D G  S A + I    E AT  G+S  D S ++ G+I SG++ GA++G+     +AD LG
Sbjct  34   DTGVISGAMLYIRETFELATVLGVS-LDPSLIE-GVIVSGAMVGAILGAAFGGRLADRLG  91

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RRR +++ ++++ +G LI A AP   I+++GR + G+G+G A    P+YI+E SP
Sbjct  92   RRRLILVGAVVFFVGSLIMAIAPTVEILILGRIIDGIGVGFASVVGPLYISEISP  146



>ref|WP_006431848.1| sugar transporter, partial [Natrinema versiforme]
 gb|ELY65938.1| sugar transporter, partial [Natrinema versiforme JCM 10478]
Length=349

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 71/115 (62%), Gaps = 6/115 (5%)
 Frame = +2

Query  293  DIGATSCATISIESA----TSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLG  460
            D G  S A + I +A    T  G+S    S V+ G++ SG++ GA+IG+ L   +AD LG
Sbjct  34   DTGVISGAMLYIRNAFELTTVFGVS-MSASFVE-GIVVSGAMIGAIIGAALGGRLADRLG  91

Query  461  RRRElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            RRR +++ ++++ +G  I A AP   ++++GR V G+G+G A    P+YI+E SP
Sbjct  92   RRRLILVGAVIFFVGSFIMAIAPTVEVLIVGRIVDGIGVGFASVVGPLYISEISP  146



>ref|WP_033375544.1| major facilitator transporter [Actinopolyspora halophila]
Length=453

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 55/81 (68%), Gaps = 0/81 (0%)
 Frame = +2

Query  383  GLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVIGRFV  562
            GL+TSG L GA++G+  + ++A  LGRR   ++++ ++ +G L  AF+P    +V+ RFV
Sbjct  43   GLVTSGILVGAMVGALTSGSLAARLGRRMMTLIAACVFAVGSLWAAFSPDVANLVLARFV  102

Query  563  YGVGIGLAMHAAPMYIAETSP  625
             G+G+GLA    PMYIAE SP
Sbjct  103  IGIGVGLASVIVPMYIAEISP  123



>ref|WP_022906059.1| major facilitator transporter, partial [Curtobacterium sp. B18]
Length=471

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 79/145 (54%), Gaps = 14/145 (10%)
 Frame = +2

Query  191  PLLHGQQPHIENYSVVACIlpflfpalggllygyDIGATSCATISIESATSSGISWYDLS  370
            P+ HG  PH+    V+A +  F     G      D G  + A + ++           L+
Sbjct  15   PVGHG--PHVRRLGVLALVATFGGLLFGY-----DTGVINGALLPMKQE-------LGLT  60

Query  371  SVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYVIMVI  550
            ++  G++TS  L+GA IG+ L   IAD  GRRR ++L ++ + +G L+  FAPV+ +MV+
Sbjct  61   NLTEGVVTSSLLFGAAIGAMLGGRIADGWGRRRTIILLAVTFFVGTLVCVFAPVFGVMVV  120

Query  551  GRFVYGVGIGLAMHAAPMYIAETSP  625
            GR + G+ +G A    P+++AE +P
Sbjct  121  GRVLLGLAVGGASTVVPVFLAELAP  145



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+           +S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  54   DIGVMSGASLFIKENLK-------ISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYT  106

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRFV GVG+G A+  AP+Y AE SP
Sbjct  107  IVLAGTIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISP  157



>ref|WP_030672845.1| major facilitator transporter [Streptomyces rimosus]
Length=470

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +2

Query  359  YDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRElmlssilyliggliTAFAPVYV  538
            + L+  + GL+ S  ++G+++G+ L   +AD LGR+  +++ +  Y +   ++A AP  V
Sbjct  56   FHLTDTEKGLVNSILVFGSIVGALLGGKLADALGRKAAMLIVAGSYTVFVALSALAPNVV  115

Query  539  IMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            I+ + RF+ G+ IG+++ AAP+YIAE++P
Sbjct  116  ILDVVRFLLGIAIGISIVAAPLYIAESTP  144



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 65/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+           +S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  9    DIGVMSGASLFIKENLK-------ISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRYT  61

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRFV GVG+G A+  AP+Y AE SP
Sbjct  62   IVLAGTIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISP  112



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  9    DIGVMSGASLFIKENL-------NISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  61

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  62   IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  112



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  53   DIGVMSGASLFIKEN-------LNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  105

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  106  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  156



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  53   DIGVMSGASLFIKENL-------NISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  105

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  106  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  156



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  51   DIGVMSGASLFIKEN-------LNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  103

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  104  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  154



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  53   DIGVMSGASLFIKEN-------LNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  105

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  106  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  156



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  51   DIGVMSGASLFIKENL-------NISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  103

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  104  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  154



>ref|WP_007141639.1| major facilitator transporter [Halobiforma lacisalsi]
 gb|EMA33290.1| sugar transporter [Halobiforma lacisalsi AJ5]
Length=480

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +2

Query  293  DIGATSCATISIESATS-SGISWYDLSSVQI-GLITSGSLYGALIGSFLAFNIADFLGRR  466
            D G  + A + I+S+   + +  Y +SS  + GLI SG++ GA++GS     +AD LGRR
Sbjct  34   DTGVIAGAMLYIKSSFELTALLGYPVSSSLVEGLIVSGAMGGAIVGSACGGRLADRLGRR  93

Query  467  RElmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            R +++ ++++ +G L  A AP   ++++ RFV G+GIG A    P+YI+E +P
Sbjct  94   RLILVGAVIFFVGSLAMAIAPNVEVLILARFVNGIGIGFAAVVGPLYISEIAP  146



>ref|WP_040615275.1| major facilitator transporter, partial [Rickettsiella grylli]
Length=454

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 67/111 (60%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            D G  S A + I+         + L++ QI  + S  L GALIGS ++  ++D  GRR+ 
Sbjct  28   DTGIISGAILFIKKD-------FFLTNFQIECVVSAVLLGALIGSGVSGRVSDLFGRRKI  80

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            L+ +S+ +++G LITAF+P    ++IGR V G+ IG+    AP+Y+AE +P
Sbjct  81   LLFTSMTFILGSLITAFSPNLTFLMIGRIVLGLAIGIGSFTAPLYLAEIAP  131



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  53   DIGVMSGASLFIKENL-------NISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  105

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  106  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  156



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 66/111 (59%), Gaps = 7/111 (6%)
 Frame = +2

Query  293  DIGATSCATISIESATSSGISWYDLSSVQIGLITSGSLYGALIGSFLAFNIADFLGRRRE  472
            DIG  S A++ I+          ++S VQ+ ++       +LIGS LA   +D++GRR  
Sbjct  51   DIGVMSGASLFIKENL-------NISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYT  103

Query  473  lmlssilyliggliTAFAPVYVIMVIGRFVYGVGIGLAMHAAPMYIAETSP  625
            ++L+  ++ IG L+  FAP Y  ++ GRF+ GVG+G A+  AP+Y AE SP
Sbjct  104  IVLAGTIFFIGALLMGFAPNYAFLMFGRFIAGVGVGYALMIAPVYTAEISP  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380