BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033N10

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR00230.1|  flavonoid 3'-hydroxylase                                343   3e-115   Ipomoea purpurea
dbj|BAD00187.1|  flavonoid 3'-hydroxylase                               347   4e-114   Ipomoea nil [qian niu]
gb|AAR00229.1|  flavonoid 3'-hydroxylase                                342   4e-112   Ipomoea purpurea
gb|ABW69693.1|  flavonoid 3'-hydrogenase                                340   3e-111   Ipomoea purpurea
dbj|BAD00189.1|  flavonoid 3'-hydroxylase                               331   7e-108   Ipomoea tricolor [campanilla]
gb|ACL26685.1|  flavonoid 3'-hydroxylase                                314   2e-101   Ipomoea coccinea [red morning-glory]
gb|ACS71532.1|  flavonoid 3' hydroxylase                                312   1e-100   Ipomoea horsfalliae [Kuhio-vine]
gb|AAS46257.1|  flavonoid 3'-hydroxylase                                312   2e-100   Ipomoea quamoclit [bejuco de cipres]
gb|ACL26686.1|  flavonoid 3'-hydroxylase                                308   6e-99    Ipomoea ternifolia
gb|ABW86861.1|  flavonoid 3'-hydroxylase                                307   1e-98    Ipomoea batatas [batate]
gb|AEH42499.1|  flavonoid 3'-hydroxylase                                307   2e-98    Ipomoea batatas [batate]
gb|AEH42501.1|  flavonoid 3'-hydroxylase                                298   2e-95    Ipomoea batatas [batate]
gb|ACB29666.1|  flavonoid 3'-hydroxylase                                298   2e-95    Ipomoea batatas [batate]
gb|AEH42500.1|  flavonoid 3'-hydroxylase                                298   4e-95    Ipomoea batatas [batate]
dbj|BAJ11756.1|  flavonoid 3'-hydroxylase                               283   4e-89    Calystegia pubescens
dbj|BAJ08322.1|  flavonoid 3'-hydroxylase                               281   2e-88    Calystegia soldanella
dbj|BAE47005.1|  flavonoid 3'-hydroxylase                               261   4e-81    Vitis vinifera
gb|AGM46642.1|  flavonoid 3'-hydroxylase protein                        250   5e-81    Apium graveolens
emb|CAI54278.1|  flavonoid-3'-hydroxylase                               261   7e-81    Vitis vinifera
emb|CAN68303.1|  hypothetical protein VITISV_041731                     261   8e-81    Vitis vinifera
dbj|BAE47003.1|  flavonoid 3'-hydroxylase                               254   3e-80    Vitis vinifera
gb|ACN38268.1|  flavonoid 3' hydroxylase                                259   4e-80    Vitis amurensis
ref|NP_001267916.1|  flavonoid 3' hydroxylase                           259   4e-80    Vitis vinifera
sp|Q9SBQ9.1|F3PH_PETHY  RecName: Full=Flavonoid 3'-monooxygenase;...    259   6e-80    Petunia x hybrida [garden petunia]
emb|CAN62275.1|  hypothetical protein VITISV_007552                     257   9e-80    Vitis vinifera
ref|XP_002284151.1|  PREDICTED: flavonoid 3'-monooxygenase              258   1e-79    Vitis vinifera
ref|XP_009788494.1|  PREDICTED: flavonoid 3'-monooxygenase              257   2e-79    Nicotiana sylvestris
gb|ABA64468.1|  flavonoid 3'-hydroxylase                                257   3e-79    Gerbera hybrid cultivar
dbj|BAE47004.1|  flavonoid 3'-hydroxylase                               256   6e-79    Vitis vinifera
emb|CDP19009.1|  unnamed protein product                                254   4e-78    Coffea canephora [robusta coffee]
gb|AHZ08763.1|  flavonoid 3'-monooxygenase                              254   5e-78    Nicotiana tabacum [American tobacco]
gb|ADB77826.1|  flavonoid 3'-hydroxylase allele 2                       253   6e-78    Dahlia pinnata
dbj|BAO58432.1|  flavonoid 3'-hydroxylase                               253   1e-77    Vaccinium ashei
gb|AGO02167.1|  flavonoid 3'-hydroxylase                                252   2e-77    Nekemias grossedentata
dbj|BAP94456.1|  flavonoid 3'-hydroxylas                                252   2e-77    Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_009597267.1|  PREDICTED: flavonoid 3'-monooxygenase              251   3e-77    Nicotiana tomentosiformis
gb|AHI58943.1|  flavonoid 3'-hydroxylase                                251   4e-77    Nicotiana tabacum [American tobacco]
emb|CDP19008.1|  unnamed protein product                                251   5e-77    Coffea canephora [robusta coffee]
ref|XP_006345132.1|  PREDICTED: flavonoid 3'-monooxygenase-like         251   6e-77    Solanum tuberosum [potatoes]
gb|ABM46853.1|  flavonoid 3'-hydroxylase                                250   1e-76    Ageratina adenophora
ref|XP_008374610.1|  PREDICTED: flavonoid 3'-monooxygenase-like         250   2e-76    Malus domestica [apple tree]
gb|AHA49900.1|  flavonoid 3' hydroxylase                                249   2e-76    Malus hybrid cultivar
gb|ACR14869.1|  flavonoid 3' hydroxylase IIb                            249   2e-76    Malus domestica [apple tree]
gb|AJO67965.1|  flavonoid-3'-hydroxylase                                240   2e-76    Prunus avium [gean]
ref|NP_001289844.1|  flavonoid 3'-monooxygenase                         249   2e-76    Solanum lycopersicum
gb|AIY22749.1|  flavonoid 3'-hydroxylase                                249   3e-76    Iochroma cyaneum
dbj|BAJ17668.1|  flavonoid 3' hydroxylase                               249   3e-76    Gynura bicolor
gb|ACO35753.1|  flavonoid 3'-hydroxylase                                249   4e-76    Bidens aurea
gb|ADA85883.1|  flavonoid 3'-hydroxylase                                248   5e-76    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ADA85882.1|  flavonoid 3'-hydroxylase                                248   5e-76    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010695197.1|  PREDICTED: flavonoid 3'-monooxygenase              248   5e-76    Beta vulgaris subsp. vulgaris [field beet]
gb|ACN65825.1|  flavonoid 3'-hydroxylase                                248   5e-76    Cichorium intybus [radicchio]
gb|ADA85878.1|  flavonoid 3'-hydroxylase                                248   5e-76    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABB29899.1|  flavonoid 3'-hydroxylase                                248   8e-76    Osteospermum hybrid cultivar
gb|AIY22748.1|  flavonoid 3'-hydroxylase                                248   1e-75    Iochroma calycinum
gb|AIY22747.1|  flavonoid 3'-hydroxylase                                247   1e-75    Iochroma calycinum
gb|AFQ92056.1|  flavonoid 3' hydroxylase                                247   2e-75    Pyrus pyrifolia [sha li]
gb|ACO35752.1|  flavonoid 3'-hydroxylase                                247   2e-75    Cosmos sulphureus [orange cosmos]
gb|AEA06595.1|  flavonoid 3'-hydroxylase                                246   5e-75    Chromolaena odorata
gb|ADA85879.1|  flavonoid 3'-hydroxylase                                245   7e-75    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AFI25037.1|  flavonoid 3'-hydroxylase                                235   1e-74    Populus deltoides x Populus tremuloides
gb|KDP31334.1|  hypothetical protein JCGZ_11710                         245   1e-74    Jatropha curcas
gb|ADB77825.1|  flavonoid 3'-hydroxylase allele 1                       244   2e-74    Dahlia pinnata
gb|ACO35754.1|  flavonoid 3'-hydroxylase                                243   4e-74    Dahlia pinnata
gb|ADA85881.1|  flavonoid 3'-hydroxylase                                243   4e-74    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGC29948.1|  CYP75B65                                                243   5e-74    Sinopodophyllum hexandrum [Himalayan mayapple]
dbj|BAJ16330.1|  flavonoid 3'-hydroxylase                               243   5e-74    Antirrhinum kelloggii
dbj|BAN62871.1|  flavonoid 3'-hydroxylase                               243   6e-74    Dianthus caryophyllus [carnation]
ref|XP_007037548.1|  Flavonoid 3'-hydroxylase isoform 2                 243   6e-74    Theobroma cacao [chocolate]
ref|XP_007037547.1|  Flavonoid 3'-hydroxylase isoform 1                 243   7e-74    
ref|XP_002319761.1|  hypothetical protein POPTR_0013s07050g             243   7e-74    Populus trichocarpa [western balsam poplar]
gb|ACO35756.1|  flavonoid 3'-hydroxylase                                242   1e-73    Tagetes erecta [big marigold]
gb|ADA85880.1|  flavonoid 3'-hydroxylase                                242   1e-73    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011011227.1|  PREDICTED: flavonoid 3'-monooxygenase              242   2e-73    Populus euphratica
gb|ABC47161.1|  flavonoid 3'-hydroxylase                                241   3e-73    Pilosella officinarum [mouse-ear hawkweed]
gb|ACV74415.1|  putative flavonoid-3'-hydroxylase                       241   3e-73    Camellia sinensis [black tea]
ref|XP_009338402.1|  PREDICTED: flavonoid 3'-monooxygenase              241   3e-73    Pyrus x bretschneideri [bai li]
ref|XP_010259651.1|  PREDICTED: flavonoid 3'-monooxygenase              241   3e-73    Nelumbo nucifera [Indian lotus]
gb|AAG49298.1|AF313488_1  putative flavonoid 3'-hydroxylase             241   5e-73    Callistephus chinensis [Chinese aster]
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              241   5e-73    Prunus avium [gean]
gb|AEF30421.1|  flavonoid 3'-hydroxylase                                233   8e-73    Fagopyrum tataricum [Kangra buckwheat]
ref|XP_010030596.1|  PREDICTED: flavonoid 3'-monooxygenase-like         240   9e-73    Eucalyptus grandis [rose gum]
ref|XP_007209917.1|  hypothetical protein PRUPE_ppa004433mg             239   1e-72    Prunus persica
gb|ACR14867.1|  flavonoid 3' hydroxylase                                239   2e-72    Malus domestica [apple tree]
ref|XP_008393217.1|  PREDICTED: flavonoid 3'-monooxygenase-like         239   2e-72    
gb|AJA79074.1|  flavonoid 3' hydroxylase                                239   2e-72    Prunus persica
gb|ADK56126.1|  putative flavonoid 3'-hydroxylase                       239   3e-72    Coreopsis grandiflora
dbj|BAF49324.1|  flavonoid 3'-hydroxylase                               238   3e-72    Lobelia erinus
dbj|BAF96945.1|  flavonoid 3'-hydroxylase                               237   6e-72    Rhododendron x pulchrum
ref|XP_011072866.1|  PREDICTED: flavonoid 3'-monooxygenase              238   7e-72    Sesamum indicum [beniseed]
ref|XP_008240031.1|  PREDICTED: flavonoid 3'-monooxygenase              237   1e-71    Prunus mume [ume]
gb|ADM26615.1|  flavonoid 3'-hydroxylase                                237   1e-71    Cynara cardunculus var. scolymus [artichoke]
ref|XP_009771410.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    237   1e-71    Nicotiana sylvestris
gb|KDO54631.1|  hypothetical protein CISIN_1g020877mg                   231   2e-71    Citrus sinensis [apfelsine]
ref|XP_010258076.1|  PREDICTED: flavonoid 3'-monooxygenase-like         236   2e-71    Nelumbo nucifera [Indian lotus]
dbj|BAN05297.1|  flavonoid 3'-hydroxylase                               236   3e-71    Dianthus caryophyllus [carnation]
gb|KJB51033.1|  hypothetical protein B456_008G198200                    233   3e-71    Gossypium raimondii
gb|ACO35757.1|  flavonoid 3'-hydroxylase                                236   4e-71    Rudbeckia hirta
gb|KDO37751.1|  hypothetical protein CISIN_1g042286mg                   229   7e-71    Citrus sinensis [apfelsine]
gb|AEN71546.1|  flavanone 3'-hydroxylase                                235   9e-71    Paeonia suffruticosa [moutan peony]
gb|AIU98513.1|  flavonoid 3'-hydroxylase                                235   1e-70    Paeonia suffruticosa [moutan peony]
gb|ACN65826.1|  flavonoid 3'-hydroxylase                                234   1e-70    Echinops bannaticus
gb|ACM62746.1|  flavonoid 3'-hydroxylase                                234   1e-70    Garcinia mangostana [mangosteen]
gb|KHG07922.1|  Flavonoid 3',5'-hydroxylase                             233   3e-70    Gossypium arboreum [tree cotton]
gb|ACN65827.1|  flavonoid 3'-hydroxylase                                233   3e-70    Centaurea cyanus [bachelor's-button]
gb|ABB53383.1|  flavonoid-3'-hydroxylase                                233   4e-70    Antirrhinum majus [garden snapdragon]
gb|KJB51032.1|  hypothetical protein B456_008G198200                    233   5e-70    Gossypium raimondii
gb|AIY51699.1|  flavonoid 3'-hydroxylase                                233   6e-70    Penstemon barbatus
gb|AEX07282.1|  F3'H                                                    233   8e-70    Arachis hypogaea [goober]
ref|XP_006399285.1|  hypothetical protein EUTSA_v10013289mg             232   9e-70    Eutrema salsugineum [saltwater cress]
gb|AHY35313.1|  flavonoid 3'-hydroxylase 1                              232   1e-69    Morus notabilis
gb|ACO35755.1|  chalcone 3-hydroxylase                                  232   1e-69    Cosmos sulphureus [orange cosmos]
ref|XP_010105826.1|  Flavonoid 3'-monooxygenase                         232   1e-69    Morus notabilis
gb|KEH32010.1|  flavonoid hydroxylase                                   232   1e-69    Medicago truncatula
gb|ADP24158.1|  flavonoid 3'-hydroxylase                                231   1e-69    Gossypium hirsutum [American cotton]
gb|AAO47850.1|  defective flavonoid 3'-hydroxylase                      225   2e-69    Glycine max [soybeans]
gb|AHZ31753.1|  flavonoid 3'-hydroxylase                                231   2e-69    Viola x wittrockiana
dbj|BAE71221.1|  putative flavonoid 3'-hydroxylase                      231   2e-69    Trifolium pratense [peavine clover]
gb|ACY06905.1|  flavonoid 3'-hydroxylase                                231   3e-69    Gossypium hirsutum [American cotton]
gb|ADT63065.1|  flavonoid 3'-hydroxylase                                229   3e-69    Fagopyrum esculentum
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         231   3e-69    Camelina sativa [gold-of-pleasure]
ref|XP_006440736.1|  hypothetical protein CICLE_v10019637mg             231   4e-69    
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               231   4e-69    Gentiana triflora
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      229   8e-69    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ABY89688.1|  flavonoid 3` hydroxylase 2 protein                      229   9e-69    Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AIY51698.1|  flavonoid 3'-hydroxylase                                229   1e-68    Penstemon neomexicanus
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              229   1e-68    Brassica rapa
emb|CDX69984.1|  BnaA10g23330D                                          229   1e-68    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                229   1e-68    Brassica napus [oilseed rape]
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                229   1e-68    Epimedium sagittatum
gb|ADZ28515.1|  flavonoid-3'-hydroxylase                                229   1e-68    Camellia nitidissima
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         229   1e-68    Camelina sativa [gold-of-pleasure]
gb|AAO47844.1|  gray pubescence flavonoid 3'-hydroxylase                226   1e-68    Glycine max [soybeans]
ref|XP_006477655.1|  PREDICTED: flavonoid 3'-monooxygenase-like         229   1e-68    Citrus sinensis [apfelsine]
gb|AGL81348.1|  flavanone 3' hydroxylase                                229   2e-68    Pyrus communis
ref|XP_007138248.1|  hypothetical protein PHAVU_009G192400g             228   3e-68    Phaseolus vulgaris [French bean]
ref|XP_002871298.1|  hypothetical protein ARALYDRAFT_487632             228   3e-68    
gb|AGI16386.1|  flavonoid 3' hydroxylase                                228   4e-68    Ribes nigrum [European black currant]
gb|AFI71898.1|  flavonoid 3'-hydroxylase                                228   4e-68    Paeonia lactiflora [common garden peony]
gb|KEH33153.1|  flavonoid hydroxylase                                   227   7e-68    Medicago truncatula
ref|XP_003598945.1|  Flavonoid 3'-hydroxylase                           227   7e-68    Medicago truncatula
gb|AIT52346.1|  flavonoid 3'-monooxygenase 1                            227   9e-68    Daucus carota [carrots]
ref|XP_004508739.1|  PREDICTED: flavonoid 3'-monooxygenase-like         226   1e-67    
gb|EPS57881.1|  flavonoid 3'-hydroxylase                                224   2e-67    Genlisea aurea
gb|AAG49301.1|AF313491_1  flavonoid 3'-hydroxylase                      226   2e-67    Matthiola incana
emb|CDX99037.1|  BnaC09g47980D                                          230   2e-67    
gb|EYU23554.1|  hypothetical protein MIMGU_mgv1a004224mg                226   3e-67    Erythranthe guttata [common monkey flower]
gb|AGO03824.1|  flavonoid 3`5`-hydroxylase                              225   4e-67    Echinops bannaticus
gb|KHN17812.1|  Flavonoid 3'-monooxygenase                              225   4e-67    Glycine soja [wild soybean]
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              225   4e-67    Camelina sativa [gold-of-pleasure]
ref|NP_001237015.1|  flavonoid 3'-hydroxylase                           225   5e-67    Glycine max [soybeans]
gb|ACR33790.1|  flavonoid 3'-hydroxylase                                225   5e-67    Glycine max [soybeans]
dbj|BAB59005.1|  flavonoid 3'-hydroxylase                               224   1e-66    Perilla frutescens var. crispa
gb|AJD25177.1|  cytochrome P450 CYP75B79                                223   2e-66    Salvia miltiorrhiza [Chinese salvia]
gb|ACJ85671.1|  unknown                                                 220   6e-66    Medicago truncatula
gb|AAG49315.1|AF315465_1  flavonoid 3'-hydroxylase                      222   7e-66    Pelargonium x hortorum [bedding geranium]
ref|NP_196416.1|  Flavonoid 3'-monooxygenase                            222   1e-65    Arabidopsis thaliana [mouse-ear cress]
gb|AIB06740.1|  flavanone 3'-hydroxylase                                221   2e-65    Mangifera indica
ref|XP_004515962.1|  PREDICTED: flavonoid 3'-monooxygenase-like         221   2e-65    
gb|AGY55961.1|  flavonoid 3'-hydroxylase                                215   4e-65    Punica granatum [granado]
gb|AJD25178.1|  cytochrome P450 CYP75B80                                219   1e-64    Salvia miltiorrhiza [Chinese salvia]
gb|AEE60888.1|  flavonoid 3'-hydroxylase                                219   1e-64    Fragaria chiloensis
gb|AES69199.2|  flavonoid hydroxylase                                   219   1e-64    Medicago truncatula
gb|AGO03825.1|  flavonoid 3`5`-hydroxylase                              219   2e-64    Cichorium intybus [radicchio]
dbj|BAL63027.1|  flavonoid 3'-hydroxylase                               218   2e-64    Fragaria x ananassa
ref|NP_001274347.1|  uncharacterized protein LOC101314754               218   3e-64    Fragaria vesca [alpine strawberry]
gb|AEE60883.1|  flavonoid 3'-hydroxylase                                218   3e-64    Fragaria vesca [alpine strawberry]
gb|AEE60887.1|  flavonoid 3'-hydroxylase                                218   3e-64    Fragaria virginiana
gb|ABB43031.1|  flavonoid 3'5'-hydroxylase                              218   3e-64    Osteospermum hybrid cultivar
gb|AEE60886.1|  flavonoid 3'-hydroxylase                                218   3e-64    Fragaria x ananassa
gb|AGT28741.1|  flavonoid 3'-hydroxylase                                217   5e-64    Fragaria x ananassa
gb|AEE60885.1|  flavonoid 3'-hydroxylase                                216   1e-63    Fragaria x ananassa
ref|XP_003598948.1|  Flavonoid 3'-hydroxylase                           218   1e-63    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             215   2e-63    Capsella rubella
gb|ABB43030.1|  flavonoid 3'5'-hydroxylase                              214   4e-63    Pericallis cruenta
ref|XP_010030575.1|  PREDICTED: flavonoid 3'-monooxygenase-like         215   4e-63    Eucalyptus grandis [rose gum]
emb|CDP16533.1|  unnamed protein product                                211   5e-62    Coffea canephora [robusta coffee]
gb|AAX19888.1|  flavonoid-3',5'-hydroxylase                             211   8e-62    Pericallis cruenta
gb|AGO03826.1|  flavonoid 3`5`-hydroxylase                              211   9e-62    Billardiera heterophylla
gb|AGT50310.1|  flavonoid 3'-hydroxylase                                209   3e-61    Meconopsis simplicifolia
gb|AGT50309.1|  flavonoid 3'-hydroxylase                                209   4e-61    Meconopsis delavayi
gb|AGT50311.1|  flavonoid 3'-hydroxylase                                208   9e-61    Meconopsis horridula [prickly blue-poppy]
gb|AAG49299.1|AF313489_1  flavonoid 3',5'-hydroxylase                   208   1e-60    Callistephus chinensis [Chinese aster]
ref|XP_010522799.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    205   1e-60    
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                207   2e-60    Meconopsis lancifolia
ref|XP_010522791.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    206   4e-60    Tarenaya hassleriana [spider flower]
gb|AGT50318.1|  flavonoid 3'-hydroxylase                                206   5e-60    Meconopsis punicea [red poppywort]
ref|XP_010522758.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    206   8e-60    Tarenaya hassleriana [spider flower]
ref|XP_010522775.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    205   1e-59    Tarenaya hassleriana [spider flower]
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               203   3e-59    Torenia hybrid cultivar
ref|XP_010105825.1|  Flavonoid 3'-monooxygenase                         204   4e-59    Morus notabilis
ref|XP_010522750.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    205   6e-59    
ref|XP_010522740.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    205   7e-59    Tarenaya hassleriana [spider flower]
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  202   9e-59    
ref|XP_003525447.1|  PREDICTED: flavonoid 3'-monooxygenase-like         203   1e-58    Glycine max [soybeans]
gb|KHN18348.1|  Flavonoid 3'-monooxygenase                              203   1e-58    Glycine soja [wild soybean]
dbj|BAE72874.1|  flavonoid 3'-hydroxylase                               201   2e-58    Glandularia x hybrida [garden verbena]
gb|AHL83556.1|  flavonoid-3'-hydroxylase                                201   5e-58    Iris x hollandica [Dutch iris]
ref|XP_003550701.1|  PREDICTED: flavonoid 3'-monooxygenase-like         201   1e-57    
dbj|BAB87838.1|  flavonoid 3'-hydroxylase                               199   3e-57    Torenia hybrid cultivar
ref|XP_003525448.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    199   4e-57    Glycine max [soybeans]
gb|KHN48735.1|  Flavonoid 3'-monooxygenase                              198   6e-57    Glycine soja [wild soybean]
ref|XP_010030579.1|  PREDICTED: flavonoid 3'-monooxygenase-like         198   7e-57    Eucalyptus grandis [rose gum]
gb|AFK73718.1|  cytochrome P450                                         197   8e-57    Papaver somniferum
dbj|BAM28972.1|  flavonoid 3'-hydroxylase                               198   1e-56    Lilium hybrid division I
dbj|BAM28971.1|  flavonoid 3'-hydroxylase                               196   4e-56    Lilium hybrid division I
ref|XP_006665050.1|  PREDICTED: flavonoid 3'-monooxygenase-like         193   8e-55    Oryza brachyantha
ref|XP_009394321.1|  PREDICTED: flavonoid 3'-monooxygenase              192   1e-54    
gb|AAS48419.1|  flavonoid 3'-hydroxylase                                191   3e-54    Allium cepa
emb|CDP16353.1|  unnamed protein product                                181   3e-54    Coffea canephora [robusta coffee]
gb|AHY35314.1|  flavonoid 3'-hydroxylase 2                              191   3e-54    Morus notabilis
gb|AFW72123.1|  red aleurone1                                           191   7e-54    
gb|AFP95893.1|  F3'H                                                    191   8e-54    Narcissus tazetta
ref|XP_008453263.1|  PREDICTED: flavonoid 3'-monooxygenase              190   1e-53    Cucumis melo [Oriental melon]
gb|AIC73642.1|  flavonoid 3'-hydroxylase                                190   1e-53    Anthurium andraeanum [flamingo-lily]
ref|XP_004983036.1|  PREDICTED: flavonoid 3'-monooxygenase-like         189   2e-53    Setaria italica
gb|AGG40645.1|  flavanone 3'-hydroxylase                                187   1e-52    Narcissus tazetta
ref|NP_001064338.1|  Os10g0320100                                       186   4e-52    
ref|XP_004138192.1|  PREDICTED: flavonoid 3'-monooxygenase-like         185   7e-52    Cucumis sativus [cucumbers]
gb|KGN63720.1|  Flavonoid 3' hydroxylase                                184   7e-52    Cucumis sativus [cucumbers]
gb|AGJ50589.1|  flavonoid 3'-hydroxylase                                185   8e-52    Tulipa fosteriana
dbj|BAH22519.1|  flavonoid 3' hydroxylase                               184   2e-51    Tricyrtis hirta
gb|KCW83706.1|  hypothetical protein EUGRSUZ_B00580                     182   2e-51    Eucalyptus grandis [rose gum]
gb|KCW83705.1|  hypothetical protein EUGRSUZ_B00580                     182   3e-51    Eucalyptus grandis [rose gum]
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                182   3e-51    Meconopsis pseudohorridula
gb|ABG54319.1|  flavonoid 3'-hydroxylase                                183   3e-51    Sorghum bicolor [broomcorn]
ref|XP_002439914.1|  hypothetical protein SORBIDRAFT_09g022480          184   3e-51    Sorghum bicolor [broomcorn]
ref|XP_008678758.1|  PREDICTED: flavonoid 3'-monooxygenase-like         183   5e-51    Zea mays [maize]
ref|XP_002452380.1|  hypothetical protein SORBIDRAFT_04g024710          182   7e-51    Sorghum bicolor [broomcorn]
gb|ABG54320.1|  flavonoid 3'-hydroxylase                                182   8e-51    Sorghum bicolor [broomcorn]
dbj|BAM28973.1|  flavonoid 3'-hydroxylase                               181   1e-50    Lilium hybrid division I
gb|AII26680.1|  flavonoid 3'-hydroxylase                                182   1e-50    Indosasa hispida
gb|AEF33624.1|  flavonoid 3' hydroxylase                                181   2e-50    Zea mays [maize]
gb|AGT50315.1|  flavonoid 3'-hydroxylase                                180   2e-50    Meconopsis betonicifolia [Himalayan blue-poppy]
ref|XP_002454110.1|  hypothetical protein SORBIDRAFT_04g024750          181   2e-50    
gb|AGT50314.1|  flavonoid 3'-hydroxylase                                179   2e-50    Meconopsis henrici
gb|AGT50312.1|  flavonoid 3'-hydroxylase                                179   3e-50    Meconopsis racemosa
gb|ABG54321.1|  flavonoid 3'-hydroxylase                                181   3e-50    Sorghum bicolor [broomcorn]
ref|XP_002452385.1|  hypothetical protein SORBIDRAFT_04g024730          181   3e-50    Sorghum bicolor [broomcorn]
gb|AGT50317.1|  flavonoid 3'-hydroxylase                                179   3e-50    Meconopsis zangnanensis
ref|XP_003525450.1|  PREDICTED: flavonoid 3'-monooxygenase-like         180   4e-50    Glycine max [soybeans]
gb|AGT50324.1|  flavonoid 3'-hydroxylase                                179   4e-50    Papaver nudicaule [Arctic poppy]
gb|KHN48734.1|  Flavonoid 3'-monooxygenase                              180   6e-50    Glycine soja [wild soybean]
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                178   9e-50    Papaver radicatum
gb|AGT50316.1|  flavonoid 3'-hydroxylase                                178   1e-49    Meconopsis integrifolia [Farrer's lampshade-poppy]
gb|AGT50321.1|  flavonoid 3'-hydroxylase                                177   1e-49    Meconopsis wilsonii
gb|ADX95997.1|  flavonoid 3'-hydroxylase                                169   1e-49    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|AGT50319.1|  flavonoid 3'-hydroxylase                                178   1e-49    Meconopsis quintuplinervia
gb|AFW62812.1|  putative cytochrome P450 superfamily protein            182   2e-49    
gb|AAV74194.1|  flavonoid 3'-hydroxylase                                179   2e-49    Sorghum bicolor [broomcorn]
gb|AII26679.1|  flavonoid 3'-monooxygenase                              177   6e-49    Indosasa hispida
dbj|BAB17054.1|  unnamed protein product                                167   1e-48    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939156.1|  PREDICTED: flavonoid 3'-monooxygenase-like         176   2e-48    Elaeis guineensis
ref|XP_008791304.1|  PREDICTED: flavonoid 3'-monooxygenase-like         175   4e-48    Phoenix dactylifera
gb|AGT50322.1|  flavonoid 3'-hydroxylase                                173   6e-48    Meconopsis gracilipes
ref|XP_006661696.1|  PREDICTED: flavonoid 3'-monooxygenase-like         174   1e-47    
dbj|BAJ95115.1|  predicted protein                                      173   2e-47    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146311.1|  uncharacterized protein LOC100279887               173   4e-47    Zea mays [maize]
gb|ACG38346.1|  flavonoid 3-monooxygenase                               172   4e-47    Zea mays [maize]
ref|XP_008678806.1|  PREDICTED: flavonoid 3'-monooxygenase-like         172   4e-47    
ref|NP_001141292.1|  uncharacterized protein LOC100273383               171   5e-47    
ref|XP_003574810.2|  PREDICTED: flavonoid 3'-monooxygenase-like         171   1e-46    Brachypodium distachyon [annual false brome]
dbj|BAJ98136.1|  predicted protein                                      170   3e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT50320.1|  flavonoid 3'-hydroxylase                                168   4e-46    Meconopsis paniculata
ref|NP_001064333.1|  Os10g0317900                                       170   5e-46    
gb|EAY78004.1|  hypothetical protein OsI_33044                          170   5e-46    Oryza sativa Indica Group [Indian rice]
gb|EMS47585.1|  Flavonoid 3'-monooxygenase                              163   3e-45    Triticum urartu
dbj|BAH89259.1|  putative flavonoid 3'-hydroxylase                      165   4e-45    Diospyros kaki [Japanese persimmon]
ref|XP_003577475.1|  PREDICTED: flavonoid 3'-monooxygenase-like         166   8e-45    Brachypodium distachyon [annual false brome]
ref|XP_010233685.1|  PREDICTED: flavonoid 3'-monooxygenase-like         167   8e-45    Brachypodium distachyon [annual false brome]
dbj|BAJ93256.1|  predicted protein                                      163   1e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABR16821.1|  unknown                                                 160   9e-43    Picea sitchensis
gb|ABV53919.1|  flavonoid 3'-hydroxylase                                149   3e-42    Gerbera hybrid cultivar
gb|AAO47856.1|  flavonoid 3'-hydroxylase                                150   4e-42    Glycine max [soybeans]
gb|AHX02955.1|  flavonoid 3'5'-hydroxylase                              156   4e-41    Iris x hollandica [Dutch iris]
ref|XP_003562884.1|  PREDICTED: flavonoid 3'-monooxygenase-like         156   5e-41    
gb|EMT24087.1|  Flavonoid 3'-monooxygenase                              152   8e-40    
gb|EEE50732.1|  hypothetical protein OsJ_31043                          150   5e-39    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002314004.1|  hypothetical protein POPTR_0009s07320g             150   6e-39    
ref|XP_010247486.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      148   7e-39    
dbj|BAF93855.1|  flavonoid 3',5'-hydroxylase                            149   8e-39    
ref|XP_006579509.1|  PREDICTED: flavonoid 3'-monooxygenase-like i...    147   1e-38    
dbj|BAL61235.1|  flavonoid 3',5'-hydroxylase                            149   2e-38    
gb|AGA82781.1|  flavonoid 3' hydroxylase 1                              145   2e-38    
sp|Q96418.1|C75A5_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    148   3e-38    
dbj|BAK64099.1|  flavonoid 3',5'-hydroxylase                            148   3e-38    
ref|XP_010031713.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      148   3e-38    
ref|XP_010247479.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      147   5e-38    
ref|XP_011009110.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      147   5e-38    
ref|XP_007155246.1|  hypothetical protein PHAVU_003G1855000g            139   6e-38    
dbj|BAH98132.1|  flavonoid 3',5'-hydroxylase                            147   6e-38    
gb|AGC30728.1|  flavonoid 3',5'-hydroxylase                             143   7e-38    
dbj|BAF96946.1|  flavonoid 3',5'-hydroxylase                            147   8e-38    
dbj|BAH98133.1|  flavonoid 3',5'-hydroxylase                            147   8e-38    
gb|AFD04990.1|  flavonoid 3'5'-hydroxylase                              140   1e-37    
gb|KDP43193.1|  hypothetical protein JCGZ_22745                         146   2e-37    
dbj|BAE86871.1|  flavonoid 3',5'-hydroxylase                            146   2e-37    
ref|XP_006837147.1|  hypothetical protein AMTR_s00110p00149730          146   2e-37    
ref|XP_003636773.1|  Flavonoid 3' 5'-hydroxylase                        140   2e-37    
ref|XP_010045076.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      145   3e-37    
gb|ACL26688.1|  flavonoid 3'-hydroxylase                                141   3e-37    
gb|ACL26687.1|  flavonoid 3'-hydroxylase                                141   3e-37    
gb|KCW87228.1|  hypothetical protein EUGRSUZ_B03742                     145   4e-37    
gb|EMS66050.1|  Flavonoid 3'-monooxygenase                              141   4e-37    
gb|KCW87229.1|  hypothetical protein EUGRSUZ_B03742                     145   4e-37    
dbj|BAC10997.1|  flavonoid 3',5'-hydroxylase                            145   4e-37    
gb|ACN60403.1|  flavonoid-3',5'-hydroxylase                             143   5e-37    
ref|XP_010045081.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      144   6e-37    
sp|O04790.1|C75A7_EUSER  RecName: Full=Flavonoid 3',5'-hydroxylas...    144   6e-37    
ref|XP_006446310.1|  hypothetical protein CICLE_v10018289mg             144   8e-37    
dbj|BAH89265.1|  flavonoid 3'5' hydroxylase                             144   9e-37    
gb|AIM58719.1|  flavonoid 3'hydroxylase                                 144   9e-37    
gb|AAV85472.1|  flavonoid 3',5'-hydroxylase                             140   9e-37    
dbj|BAK74845.1|  mutated flavonoid 3', 5' hydroxylase                   141   9e-37    
gb|AFD05037.1|  flavonoid 3'5'-hydroxylase                              139   9e-37    
ref|NP_001234840.1|  putative flavonoid 3'5' hydroxylase                144   1e-36    
gb|AFD04984.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05051.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05005.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05046.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD04986.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05023.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05026.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
sp|Q96581.1|C75A4_GENTR  RecName: Full=Flavonoid 3',5'-hydroxylas...    144   1e-36    
gb|ACN58569.1|  flavonoid 3',5'-hydroxylase                             144   1e-36    
dbj|BAF64483.1|  flavonoid-3',5'-hydroxylase                            140   1e-36    
gb|AFD05019.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD04975.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD04973.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05042.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05017.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05065.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05035.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05011.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05012.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD04970.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD05008.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD04985.1|  flavonoid 3'5'-hydroxylase                              138   1e-36    
gb|AFD04980.1|  flavonoid 3'5'-hydroxylase                              138   2e-36    
gb|AFD05024.1|  flavonoid 3'5'-hydroxylase                              138   2e-36    
gb|AFD04969.1|  flavonoid 3'5'-hydroxylase                              138   2e-36    
ref|XP_007015254.1|  Flavonoid 3',5'-hydroxylase 2 isoform 1            143   2e-36    
gb|AFD04971.1|  flavonoid 3'5'-hydroxylase                              137   2e-36    
gb|AAP31058.1|  flavonoid 3',5'-hydroxylase                             143   2e-36    
gb|KJB09328.1|  hypothetical protein B456_001G134900                    143   2e-36    
gb|AIX10138.1|  flavonoid 3',5'-hydroxylase                             142   2e-36    
gb|AFD04978.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AIY22750.1|  flavonoid 3',5'-hydroxylase                             142   3e-36    
gb|AFD05057.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|ACH56524.1|  flavonoid 3'5'-hydroxylase                              142   3e-36    
gb|AFD05032.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05020.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05050.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05052.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05064.1|  flavonoid 3'5'-hydroxylase                              137   3e-36    
gb|AFD05010.1|  flavonoid 3'5'-hydroxylase                              137   4e-36    
gb|ADV39278.1|  flavonoid 3',5'-hydroxylase                             138   4e-36    
gb|ADV39279.1|  flavonoid 3',5'-hydroxylase                             138   4e-36    
gb|ADV39275.1|  flavonoid 3',5'-hydroxylase                             138   4e-36    
gb|ADV39277.1|  flavonoid 3',5'-hydroxylase                             138   4e-36    
gb|AIY22751.1|  flavonoid 3',5'-hydroxylase                             142   4e-36    
dbj|BAJ08041.1|  flavonoid 3',5'-hydroxylase                            142   4e-36    
ref|XP_010045077.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      142   4e-36    
gb|ADV39281.1|  flavonoid 3',5'-hydroxylase                             138   4e-36    
sp|P37120.1|C75A2_SOLME  RecName: Full=Flavonoid 3',5'-hydroxylas...    142   5e-36    
gb|ADV39282.1|  flavonoid 3',5'-hydroxylase                             138   5e-36    
gb|ADV39273.1|  flavonoid 3',5'-hydroxylase                             137   5e-36    
gb|AIY22752.1|  flavonoid 3',5'-hydroxylase                             142   5e-36    
gb|AFD04991.1|  flavonoid 3'5'-hydroxylase                              136   5e-36    
gb|AFD04994.1|  flavonoid 3'5'-hydroxylase                              136   6e-36    
gb|AGI16385.1|  flavonoid 3', 5'-hydroxylase                            141   6e-36    
dbj|BAF64482.1|  flavonoid-3',5'-hydroxylase                            140   6e-36    
gb|ACX37698.1|  flavonoid 3',5'-hydroxylase                             141   8e-36    
gb|ACY06904.1|  flavonoid 3'5'-hydroxylase                              141   8e-36    
gb|AAY23287.1|  flavonoid 3',5'-hydroxylase                             141   8e-36    
gb|ADV39276.1|  flavonoid 3',5'-hydroxylase                             137   9e-36    
gb|ACZ63206.1|  flavonoid 3',5'-hydroxylase                             141   9e-36    
gb|ACZ63205.1|  flavonoid 3',5'-hydroxylase                             140   1e-35    
dbj|BAF34566.1|  flavonoid 3',5'-hydroxylase                            140   1e-35    
gb|ABA40923.1|  flavonoid 3',5'-hydroxylase                             140   1e-35    
gb|AFD04977.1|  flavonoid 3'5'-hydroxylase                              135   1e-35    
ref|XP_009619846.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1           140   2e-35    
gb|KHF97502.1|  Flavonoid 3',5'-hydroxylase 2                           140   2e-35    
emb|CAA50442.1|  P450 hydroxylase                                       139   2e-35    
gb|AFD05049.1|  flavonoid 3'5'-hydroxylase                              135   2e-35    
gb|ADV39274.1|  flavonoid 3',5'-hydroxylase                             136   2e-35    
dbj|BAK74846.1|  flavonoid 3', 5' hydroxylase                           140   2e-35    
gb|AFD05059.1|  flavonoid 3'5'-hydroxylase                              135   2e-35    
dbj|BAC97831.1|  Flavonoid 3',5'-hydroxylase                            140   2e-35    
ref|XP_003638766.1|  Flavonoid 3' 5'-hydroxylase                        140   2e-35    
dbj|BAF34559.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
gb|AFD05054.1|  flavonoid 3'5'-hydroxylase                              135   2e-35    
dbj|BAF34571.1|  flavonoid 3',5'-hydroxylase                            140   2e-35    
gb|KEH33357.1|  flavonoid hydroxylase                                   140   3e-35    
dbj|BAF34557.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
dbj|BAF34572.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
dbj|BAF34569.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
sp|P48418.1|C75A1_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    139   3e-35    
dbj|BAF34560.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
dbj|BAF34563.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
gb|AIX10137.1|  flavonoid 3',5'-hydroxylase                             139   3e-35    
dbj|BAF34561.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
dbj|BAF34575.1|  flavonoid 3',5'-hydroxylase                            139   3e-35    
gb|ABY77007.1|  flavonoid 3',5'-hydroxylase                             139   3e-35    
gb|ABN42195.1|  flavonoid-3',5'-hydroxylase                             139   4e-35    
dbj|BAF34562.1|  flavonoid 3',5'-hydroxylase                            139   4e-35    
gb|AAG49300.1|AF313490_1  flavonoid 3',5'-hydroxylase                   139   5e-35    
dbj|BAF34558.1|  flavonoid 3',5'-hydroxylase                            139   5e-35    
gb|AIX10136.1|  flavonoid 3',5'-hydroxylase                             139   6e-35    
dbj|BAF34568.1|  flavonoid 3',5'-hydroxylase                            139   6e-35    
gb|AIX10140.1|  flavonoid 3',5'-hydroxylase                             139   6e-35    
gb|AIX10142.1|  flavonoid 3',5'-hydroxylase                             139   6e-35    
dbj|BAJ09746.1|  flavonoid 3',5'-hydroxylase                            139   7e-35    
ref|NP_001274807.1|  flavonoid 3',5'-hydroxylase                        139   7e-35    
ref|XP_006349127.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    139   7e-35    
gb|AFL91704.1|  flavonoid-3',5'-hydroxylase                             138   7e-35    
gb|AIX10139.1|  flavonoid 3',5'-hydroxylase                             138   7e-35    
gb|AIX10135.1|  flavonoid 3',5'-hydroxylase                             138   8e-35    
dbj|BAO66642.1|  flavonoid 3',5'-hydroxylase                            138   8e-35    
gb|AAX51796.1|  flavonoid 3'5'-hydroxylase                              138   9e-35    
dbj|BAF34567.1|  flavonoid 3',5'-hydroxylase                            138   9e-35    
gb|AIX10133.1|  flavonoid 3',5'-hydroxylase                             138   1e-34    
gb|AIX10134.1|  flavonoid 3',5'-hydroxylase                             138   1e-34    
gb|AFD05053.1|  flavonoid 3'5'-hydroxylase                              133   1e-34    
dbj|BAO04188.1|  flavonoid 3'5'-hydroxylase                             138   1e-34    
dbj|BAJ16328.1|  flavonoid 3',5'-hydroxylase                            138   1e-34    
gb|AIX10141.1|  flavonoid 3',5'-hydroxylase                             137   1e-34    
gb|ABQ96219.1|  flavonoid 3'5' hydroxylase                              137   1e-34    
gb|AEY80043.1|  flavonoid-3',5'-hydroxylase                             137   1e-34    
dbj|BAE47007.1|  flavonoid 3',5'-hydroxylase                            137   2e-34    
ref|XP_010651523.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      137   2e-34    
gb|ABQ96218.1|  flavonoid 3'5' hydroxylase                              137   2e-34    
gb|AJA40049.1|  flavonoid 3'5'-hydroxylase                              137   2e-34    
ref|NP_001236632.1|  flavonoid 3', 5'-hydroxylase                       137   2e-34    
dbj|BAJ14025.1|  flavonoid 3'5'-hydroxylase                             137   2e-34    
dbj|BAM09186.1|  flavonoid 3'5'-hydroxylase                             137   2e-34    
ref|XP_006593479.1|  PREDICTED: flavonoid 3', 5'-hydroxylase isof...    137   2e-34    
dbj|BAE72871.1|  flavonoid 3',5'-hdyroxylase                            137   2e-34    
gb|AAV85470.1|  flavonoid 3',5'-hydroxylase                             137   2e-34    
gb|AAT34974.1|  flavonoid 3',5'-hydroxylase                             137   2e-34    
dbj|BAB20076.1|  flavonoid 3',5'-hydroxylase                            137   2e-34    
dbj|BAJ16329.1|  flavonoid 3',5'-hydroxylase                            137   2e-34    
emb|CAN82588.1|  hypothetical protein VITISV_038260                     137   2e-34    
gb|AJD25176.1|  cytochrome P450 CYP75A57                                137   3e-34    
ref|NP_001268164.1|  uncharacterized protein LOC100261319               137   3e-34    
gb|AHK10251.1|  flavonoid-3',5'-hydroxylase                             137   3e-34    
gb|AFR67330.1|  flavonoid-3',5'-hydroxylase                             137   3e-34    
ref|XP_007146175.1|  hypothetical protein PHAVU_006G018800g             136   3e-34    
dbj|BAF34573.1|  flavonoid 3',5'-hydroxylase                            136   4e-34    
ref|XP_003632209.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           136   5e-34    
gb|AIY51702.1|  flavonoid 3',5'-hydroxylase                             136   5e-34    
emb|CAN81079.1|  hypothetical protein VITISV_007550                     136   5e-34    
ref|XP_003632242.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           136   5e-34    
emb|CAN61852.1|  hypothetical protein VITISV_020443                     136   6e-34    
ref|XP_011024984.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      136   6e-34    
emb|CAN82604.1|  hypothetical protein VITISV_005589                     135   6e-34    
ref|XP_010651525.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           135   7e-34    
ref|XP_008794133.1|  PREDICTED: flavonoid 3'-monooxygenase-like         135   7e-34    
ref|XP_002280939.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           135   7e-34    
ref|XP_002298464.1|  hypothetical protein POPTR_0001s28140g             135   8e-34    
ref|XP_007146174.1|  hypothetical protein PHAVU_006G018800g             135   8e-34    
gb|ABC86840.1|  flavonoid 3',5'-hydroxylase                             135   8e-34    
gb|ACN38269.1|  flavonoid-3',5'-hydroxylase                             135   9e-34    
ref|XP_003638760.1|  Flavonoid 3' 5'-hydroxylase                        135   1e-33    
emb|CAN60738.1|  hypothetical protein VITISV_042284                     133   1e-33    
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          135   2e-33    
dbj|BAF34570.1|  flavonoid 3',5'-hydroxylase                            135   2e-33    
ref|XP_007015255.1|  Flavonoid 3',5'-hydroxylase 2 isoform 2            134   2e-33    
gb|AFF59221.1|  flavonoid 3'5'-hydroxylase                              134   2e-33    
gb|AAM51564.1|  flavonoid 3', 5'-hydroxylase                            134   3e-33    
gb|AGO02173.1|  flavonoid 3'5'-hydroxylase                              134   3e-33    
dbj|BAF49293.1|  flavonoid 3',5'-hydroxylase                            134   3e-33    
dbj|BAE72872.1|  flavonoid 3',5'-hdyroxylase                            134   4e-33    
dbj|BAE72870.1|  flavonoid 3',5'-hdyroxylase                            134   4e-33    
gb|ADW66657.1|  flavonoid-3',5'-hydroxylase                             133   5e-33    
gb|KDO54767.1|  hypothetical protein CISIN_1g047593mg                   132   1e-32    
ref|XP_004513234.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    132   1e-32    
gb|ADW66160.1|  flavonoid 3' 5' hydroxylase                             132   1e-32    
ref|XP_006470529.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      132   1e-32    
gb|ADE80942.1|  flavonoid 3',5'-hydroxylase                             132   1e-32    
ref|XP_009383085.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      131   2e-32    
sp|P48419.1|C75A3_PETHY  RecName: Full=Flavonoid 3',5'-hydroxylas...    131   2e-32    
ref|XP_003556788.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    131   3e-32    
ref|XP_010910221.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      131   4e-32    
ref|XP_002271739.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2           131   4e-32    
emb|CBI30128.3|  unnamed protein product                                130   5e-32    
sp|O04773.1|C75A6_CAMME  RecName: Full=Flavonoid 3',5'-hydroxylas...    130   5e-32    
emb|CAN80142.1|  hypothetical protein VITISV_038979                     130   6e-32    
emb|CAA09850.1|  flavonoid 3',5'-hydroxylase                            130   7e-32    
ref|XP_010936313.1|  PREDICTED: flavonoid 3'-monooxygenase-like         130   8e-32    
ref|XP_009411862.1|  PREDICTED: flavonoid 3',5'-hydroxylase 1-like      129   1e-31    
ref|XP_003632212.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      129   1e-31    
gb|ABR18019.1|  unknown                                                 127   1e-31    
gb|ABC86841.1|  flavonoid 3',5'-hydroxylase                             129   2e-31    
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         129   2e-31    
gb|AGC74041.1|  flavonoid-3',5'-hydroxylase                             129   2e-31    
gb|ABR16345.1|  unknown                                                 129   2e-31    
ref|NP_001268157.1|  flavonoid-3,5'-hydroxylase                         128   3e-31    
ref|XP_010651527.1|  PREDICTED: flavonoid 3',5'-hydroxylase 2-like      128   3e-31    
emb|CAN82592.1|  hypothetical protein VITISV_038264                     128   3e-31    



>gb|AAR00230.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=323

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 194/198 (98%), Positives = 198/198 (100%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDGGSKS
Sbjct  181  LARVMLGRKVFNDGGSKS  198



>dbj|BAD00187.1| flavonoid 3'-hydroxylase [Ipomoea nil]
 dbj|BAD00190.1| flavonoid 3'-hydroxylase [Ipomoea nil]
Length=519

 Score =   347 bits (890),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 198/198 (100%), Positives = 198/198 (100%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGKKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ERYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDGGSKS
Sbjct  181  LARVMLGRKVFNDGGSKS  198



>gb|AAR00229.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00188.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
 dbj|BAD00191.1| flavonoid 3'-hydroxylase [Ipomoea purpurea]
Length=519

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 194/198 (98%), Positives = 198/198 (100%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDGGSKS
Sbjct  181  LARVMLGRKVFNDGGSKS  198



>gb|ABW69693.1| flavonoid 3'-hydrogenase [Ipomoea purpurea]
Length=519

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 193/198 (97%), Positives = 197/198 (99%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLIFCTLVFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ER+GPLMHLR+GFVDVVVAASAAVAAQFLKVHD+NFSNRPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   ERHGPLMHLRMGFVDVVVAASAAVAAQFLKVHDANFSNRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDG SKS
Sbjct  181  LARVMLGRKVFNDGSSKS  198



>dbj|BAD00189.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
 dbj|BAD00192.1| flavonoid 3'-hydroxylase [Ipomoea tricolor]
Length=522

 Score =   331 bits (848),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 190/198 (96%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLI CTLVFAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLVFAICLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QSYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDG SKS
Sbjct  181  LARVMLGRKVFNDGSSKS  198



>gb|ACL26685.1| flavonoid 3'-hydroxylase [Ipomoea coccinea]
Length=519

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 190/198 (96%), Positives = 196/198 (99%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLI CTL+FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDGGSKS
Sbjct  181  LARVMLGRKVFNDGGSKS  198



>gb|ACS71532.1| flavonoid 3' hydroxylase [Ipomoea horsfalliae]
Length=517

 Score =   312 bits (800),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 190/198 (96%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLI CT VFA+FLYFL LR+K RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A
Sbjct  1    MATLTLILCTSVFAVFLYFL-LRLK-RYPLPLPPGPKPWPVVGNLPHLGQKPHQSIAALA  58

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  59   QSYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPY  118

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATL RSLASAGKTPVKLGQLLNVCTTNA
Sbjct  119  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLARSLASAGKTPVKLGQLLNVCTTNA  178

Query  542  LARVMLGRKVFNDGGSKS  595
            L RVMLGRKVFNDGGSKS
Sbjct  179  LGRVMLGRKVFNDGGSKS  196



>gb|AAS46257.1| flavonoid 3'-hydroxylase [Ipomoea quamoclit]
Length=519

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 189/198 (95%), Positives = 195/198 (98%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLI CTL+FAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAIFLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGAEHIAYNYQDLVFAPY
Sbjct  61   QKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAEHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDG SKS
Sbjct  181  LARVMLGRKVFNDGSSKS  198



>gb|ACL26686.1| flavonoid 3'-hydroxylase [Ipomoea ternifolia]
Length=519

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 188/198 (95%), Positives = 195/198 (98%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLI CTL+FAI LYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLG+KPHQSIAAMA
Sbjct  1    MATLTLILCTLLFAISLYFLILRVKQRYPLPLPPGPKPWPVLGNLPHLGEKPHQSIAAMA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   KKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKITSVHLFSAKALDDF HVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  121  GPRWRMLRKITSVHLFSAKALDDFSHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDGGSKS
Sbjct  181  LARVMLGRKVFNDGGSKS  198



>gb|ABW86861.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=517

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 188/198 (95%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MATLTLIFCT+VF IFLY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A
Sbjct  1    MATLTLIFCTIVFTIFLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALA  58

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  59   QSYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPY  118

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR LRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNA
Sbjct  119  GPRWRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNA  178

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGRKVFNDG SKS
Sbjct  179  LARVMLGRKVFNDGSSKS  196



>gb|AEH42499.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 188/197 (95%), Gaps = 2/197 (1%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            ATLTLI CT+VF IFLYFL LRVK RYPLPLPPGPKPWPV+GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTIVFTIFLYFL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPHQSIAALAQ  60

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYG  120

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  544
            PRWR LRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRRLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  545  ARVMLGRKVFNDGGSKS  595
            ARV+LGRKVFNDGGSKS
Sbjct  181  ARVVLGRKVFNDGGSKS  197



>gb|AEH42501.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 2/197 (1%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            ATLTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQ  60

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYG  120

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  544
            PRWRMLRKITSVHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  545  ARVMLGRKVFNDGGSKS  595
            ARVMLGRKVFNDG SKS
Sbjct  181  ARVMLGRKVFNDGSSKS  197



>gb|ACB29666.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   298 bits (764),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 2/197 (1%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            ATLTLI CT VF IFLY L LRVK RYPLPLPPGPKPWP++GNLPHLG+KPHQSIAA+A+
Sbjct  3    ATLTLILCTSVFTIFLYCL-LRVK-RYPLPLPPGPKPWPIVGNLPHLGEKPHQSIAALAQ  60

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAY+YQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYSYQDLVFAPYG  120

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  544
            PRWRMLRKITSVHLFSAKALDDF HVRQ  VATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGVVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  545  ARVMLGRKVFNDGGSKS  595
            ARVMLGRKVFNDG SKS
Sbjct  181  ARVMLGRKVFNDGSSKS  197



>gb|AEH42500.1| flavonoid 3'-hydroxylase [Ipomoea batatas]
Length=518

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 185/197 (94%), Gaps = 2/197 (1%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            ATLTLI CT V  I LY L LRVK RYPLPLPPGPKPWPV+GNLPHLG+KP+QS+AA+A+
Sbjct  3    ATLTLILCTSVITISLYCL-LRVK-RYPLPLPPGPKPWPVVGNLPHLGEKPNQSLAALAQ  60

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             YGPLMHLRLGFV VVVAASAAVAAQFLKVHD+NFSNRPPNSGA+HIAYNYQDLVFAPYG
Sbjct  61   SYGPLMHLRLGFVHVVVAASAAVAAQFLKVHDANFSNRPPNSGAKHIAYNYQDLVFAPYG  120

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  544
            PRWRMLRKITSVHLFSAKALDDF HVRQ EVATLTRSLASAGKTPVKLGQLLNVCTTNAL
Sbjct  121  PRWRMLRKITSVHLFSAKALDDFSHVRQGEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  180

Query  545  ARVMLGRKVFNDGGSKS  595
            ARVMLGRKVFNDGGSKS
Sbjct  181  ARVMLGRKVFNDGGSKS  197



>dbj|BAJ11756.1| flavonoid 3'-hydroxylase [Calystegia pubescens]
Length=520

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 162/204 (79%), Positives = 180/204 (88%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  172
            MA LTL   T +FAIFLYFL+ ++    +RYPL LPPGP PWPV+GNLPHLG KPHQ++A
Sbjct  1    MAILTLFLFTSIFAIFLYFLVCQLLISNKRYPLLLPPGPSPWPVVGNLPHLGPKPHQTLA  60

Query  173  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  352
            A+A+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  61   ALAQNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVF  120

Query  353  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  532
            APYGPRWRMLRKITSVHLFS+KALDDF HVRQEE+  LTR+LASAGKTPVKLGQLLNVCT
Sbjct  121  APYGPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGKTPVKLGQLLNVCT  180

Query  533  TNALARVMLGRKVFND---GGSKS  595
            TNAL+RV+LGRKVFND    G KS
Sbjct  181  TNALSRVLLGRKVFNDQTNAGGKS  204



>dbj|BAJ08322.1| flavonoid 3'-hydroxylase [Calystegia soldanella]
Length=520

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 161/204 (79%), Positives = 181/204 (89%), Gaps = 6/204 (3%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRV---KQRYplplppgpkpwpvlGNLPHLGKKPHQSIA  172
            MA LTL   T +FAIF+YFL+ ++    +RYPLPLPPGP PWPV+GNLPHLG KPHQ++A
Sbjct  1    MAILTLFLFTSIFAIFIYFLVCQLLISNKRYPLPLPPGPSPWPVVGNLPHLGPKPHQTLA  60

Query  173  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  352
            A+A+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVF
Sbjct  61   ALAQNYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVF  120

Query  353  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  532
            APYGPRWRMLRKITSVHLFS+KALDDF HVRQEE+  LTR+LASAG+TPVKLGQLLNVCT
Sbjct  121  APYGPRWRMLRKITSVHLFSSKALDDFRHVRQEEIGVLTRALASAGRTPVKLGQLLNVCT  180

Query  533  TNALARVMLGRKVFND---GGSKS  595
            TNAL+RV+LGRKVFND    G KS
Sbjct  181  TNALSRVLLGRKVFNDQTNAGGKS  204



>dbj|BAE47005.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>gb|AGM46642.1| flavonoid 3'-hydroxylase protein, partial [Apium graveolens]
Length=153

 Score =   250 bits (638),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG KPH S+AA+A+ YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  6    GNLPHLGAKPHHSLAALAKNYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFSSRPPN  65

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDF HVRQEEV  LTR+LASA
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFRHVRQEEVGILTRALASA  125

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKV  571
            GKTPVKLGQLLNVCTTNALARVMLGR+V
Sbjct  126  GKTPVKLGQLLNVCTTNALARVMLGRRV  153



>emb|CAI54278.1| flavonoid-3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   261 bits (667),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 158/194 (81%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L LIFCT +F + LY  + R   R P  L P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCVLLYHFLTRRSVRLPPGLKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>emb|CAN68303.1| hypothetical protein VITISV_041731 [Vitis vinifera]
Length=509

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 157/194 (81%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L LIFCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>dbj|BAE47003.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=334

 Score =   254 bits (649),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALSFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>gb|ACN38268.1| flavonoid 3' hydroxylase [Vitis amurensis]
Length=509

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>ref|NP_001267916.1| flavonoid 3' hydroxylase [Vitis vinifera]
 dbj|BAE47006.1| flavonoid 3'-hydroxylase [Vitis vinifera]
 gb|ABH06586.1| flavonoid 3' hydroxylase [Vitis vinifera]
Length=509

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L L FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALFFCTALFCVLLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR+LA AG+TPV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLTRALARAGQTPVNLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>sp|Q9SBQ9.1|F3PH_PETHY RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B2; AltName: Full=Flavonoid 3'-hydroxylase [Petunia 
x hybrida]
 gb|AAD56282.1|AF155332_1 flavonoid 3'-hydroxylase [Petunia x hybrida]
Length=512

 Score =   259 bits (661),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 174/196 (89%), Gaps = 3/196 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILR--VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  175
            M  L+LI  T++F+  L F ILR   ++RYPLPLPPGPKPWP++GNL HLG KPHQS AA
Sbjct  1    MEILSLILYTVIFSFLLQF-ILRSFFRKRYPLPLPPGPKPWPIIGNLVHLGPKPHQSTAA  59

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            MA+ YGPLM+L++GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGAEH+AYNYQDLVFA
Sbjct  60   MAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFA  119

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWRMLRKI SVHLFS KALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTT
Sbjct  120  PYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTT  179

Query  536  NALARVMLGRKVFNDG  583
            NALARVMLG++VF DG
Sbjct  180  NALARVMLGKRVFADG  195



>emb|CAN62275.1| hypothetical protein VITISV_007552 [Vitis vinifera]
Length=471

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>ref|XP_002284151.1| PREDICTED: flavonoid 3'-monooxygenase [Vitis vinifera]
 emb|CAN75347.1| hypothetical protein VITISV_002956 [Vitis vinifera]
Length=509

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA AG+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALARAGQTPVKLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>ref|XP_009788494.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana sylvestris]
Length=514

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 171/197 (87%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA  +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI  VHLFSAKALDDF HVRQ+EV TLTR+LASAG+ PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICFVHLFSAKALDDFSHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDGGS  589
            ALARVMLGR+VF D  S
Sbjct  181  ALARVMLGRRVFADASS  197



>gb|ABA64468.1| flavonoid 3'-hydroxylase [Gerbera hybrid cultivar]
Length=512

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 169/198 (85%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  LTL+  T V  +FLY L+ R   R P  LPPGP PWPV+GNLPHLG  PH S+AAMA
Sbjct  1    MTPLTLLIGTCVTGLFLYVLLNRC-TRNPNRLPPGPTPWPVVGNLPHLGTIPHHSLAAMA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFADRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF HVRQEEVA L R+L  AGK+PVKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGKSPVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF+ G +++
Sbjct  180  LARVMLGRRVFDSGDAQA  197



>dbj|BAE47004.1| flavonoid 3'-hydroxylase [Vitis vinifera]
Length=509

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L LIFCT +F I LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNPLALIFCTALFCILLYHFLTRRSVRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS +ALDDF H+RQEEV  L R+LA  G+TPVKLGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSVHLFSGQALDDFRHIRQEEVLALMRALAREGQTPVKLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  177  LGRVMLGRRVFGDG  190



>emb|CDP19009.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+TLTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTN  538
            GPRWR+LRKI S+HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTN
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTN  179

Query  539  ALARVMLGRKVFNDG  583
            AL RVMLGR+VF DG
Sbjct  180  ALGRVMLGRRVFGDG  194



>gb|AHZ08763.1| flavonoid 3'-monooxygenase [Nicotiana tabacum]
Length=515

 Score =   254 bits (648),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA  +L+  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLLLYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            ALA+VMLGR+VF D 
Sbjct  181  ALAQVMLGRRVFADA  195



>gb|ADB77826.1| flavonoid 3'-hydroxylase allele 2 [Dahlia pinnata]
Length=508

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ LTL+    + A+ LY L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MSILTLLLYASITALPLYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            E+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPNSGAEHIAYNYQDLVFAPY
Sbjct  60   EKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPNSGAEHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR LA AG + VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGAGNSTVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF DG  K+
Sbjct  180  LARVMLGRRVFGDGDPKA  197



>dbj|BAO58432.1| flavonoid 3'-hydroxylase [Vaccinium ashei]
Length=517

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 165/196 (84%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MA+L  I  +L+  IFLYF++  ++ RYP PLPPGPKPWPV+GNLPHLG  PH SIAA+A
Sbjct  1    MASLAFIIYSLLIGIFLYFVLSLLRNRYPRPLPPGPKPWPVIGNLPHLGTMPHHSIAALA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPLMHL +G V VVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   RTYGPLMHLWMGSVHVVVAASASVAXQFLKTHDQNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTT  535
            GPRWRMLRKI SVHLFSAKALDDF HVRQEEVA LTR+LASA   KT V LGQLLN+CTT
Sbjct  121  GPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALASAAKSKTTVNLGQLLNLCTT  180

Query  536  NALARVMLGRKVFNDG  583
            NA+ RVMLGR+VF DG
Sbjct  181  NAIGRVMLGRRVFGDG  196



>gb|AGO02167.1| flavonoid 3'-hydroxylase [Ampelopsis grossedentata]
Length=509

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 154/194 (79%), Gaps = 4/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M +L L+FCT +F + LY  + R   R P    P P      GNLPHLG  PH SIAA+A
Sbjct  1    MNSLALLFCTALFCVLLYRFLTRRSPRLPPGPKPWPIV----GNLPHLGPVPHHSIAALA  56

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLR+GFVDVVVAASA+VA+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPY
Sbjct  57   KTYGPLMHLRMGFVDVVVAASASVASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPY  116

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI S+HLFS KALDDF H+RQEE++ LT +LA AG  PV LGQLLNVCTTNA
Sbjct  117  GPRWRMLRKICSIHLFSGKALDDFRHIRQEEISVLTSALARAGPAPVNLGQLLNVCTTNA  176

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+ F DG
Sbjct  177  LGRVMLGRRAFGDG  190



>dbj|BAP94456.1| flavonoid 3'-hydroxylas [Eustoma exaltatum subsp. russellianum]
Length=519

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  17   LIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            L+  T +F++ +Y  L L  ++     LPPGPKPWP++GNLPHLG KPHQ++AAMA+ YG
Sbjct  9    LVVYTAIFSLLIYAILKLLRRENRRPSLPPGPKPWPIIGNLPHLGTKPHQTLAAMAKTYG  68

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHL+LGFVDVVVAASA+VA QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYGPRW
Sbjct  69   PLMHLKLGFVDVVVAASASVAEQFLKKHDANFSNRPPNSGAKHIAYNYQDLVFAPYGPRW  128

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRKI SVHLFSAKALDDF HVRQEEV  LTRS+ASAG+ P+ LGQLL VCTTNALARV
Sbjct  129  RLLRKICSVHLFSAKALDDFQHVRQEEVGILTRSIASAGENPINLGQLLGVCTTNALARV  188

Query  554  MLGRKVFNDG  583
            MLGR+VF DG
Sbjct  189  MLGRRVFGDG  198



>ref|XP_009597267.1| PREDICTED: flavonoid 3'-monooxygenase [Nicotiana tomentosiformis]
Length=515

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA  +LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            ALA+VMLGR+VF D 
Sbjct  181  ALAQVMLGRRVFADA  195



>gb|AHI58943.1| flavonoid 3'-hydroxylase [Nicotiana tabacum]
Length=515

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA  +LI  T++F+  L+ +  L  ++RYPL LPPGPKPWP++GNL H+G KPHQS AAM
Sbjct  1    MAIFSLILYTVIFSFLLHSIFSLFFRKRYPLTLPPGPKPWPIIGNLVHMGPKPHQSTAAM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHL++GFVDVVV ASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVVASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQ+EV TLTR+LASA + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFSHVRQDEVRTLTRALASAAQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            ALA+VMLGR+VF D 
Sbjct  181  ALAQVMLGRRVFADA  195



>emb|CDP19008.1| unnamed protein product [Coffea canephora]
 emb|CDP16354.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+TLTLIF + + A FL + I +        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSIHKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCTTN  538
            GPRWR+LRKI S+HLFSAKALDDF  VRQEEV TL R+ LASAGKTPV LGQLLNVCTTN
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQEEVGTLARALLASAGKTPVNLGQLLNVCTTN  179

Query  539  ALARVMLGRKVFNDG  583
            AL RVMLGR+VF DG
Sbjct  180  ALGRVMLGRRVFGDG  194



>ref|XP_006345132.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=514

 Score =   251 bits (641),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 172/195 (88%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA  +LI  T++ +  L+F++ L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+M
Sbjct  1    MAIFSLILYTIISSFILHFILSLFFRKRYPVPLPPGPKPWPIIGNIVQLGPKPHQSTASM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANAGQKPIKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            ALARVMLG++VF DG
Sbjct  181  ALARVMLGKRVFADG  195



>gb|ABM46853.1| flavonoid 3'-hydroxylase [Ageratina adenophora]
Length=510

 Score =   250 bits (639),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  LTL+  T + A+  Y L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTILTLLLYTSISALAFY-LLLNLRTRHPKRLPPGPTPWPIVGNLPHLGTVPHHSLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   TKYGPLMHLRLGFVDVVVAASASVASQFLKSHDANFASRPPNSGAKHIAYNYHDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR L SAG+T VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRVLISAGETTVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARV+LGR+VF DG   S
Sbjct  180  LARVLLGRRVFGDGSRDS  197



>ref|XP_008374610.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
 gb|ACR14868.1| flavonoid 3' hydroxylase IIa [Malus domestica]
Length=511

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDGGSKS  595
            M+GR++F DGG + 
Sbjct  183  MVGRRLFGDGGGRE  196



>gb|AHA49900.1| flavonoid 3' hydroxylase [Malus hybrid cultivar]
Length=511

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LIF T+V A FLY L      R+  PLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHAQPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDGGSKS  595
            M+GR++F DGG + 
Sbjct  183  MVGRRLFGDGGGRE  196



>gb|ACR14869.1| flavonoid 3' hydroxylase IIb [Malus domestica]
Length=511

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 161/194 (83%), Gaps = 0/194 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LIF T+V A FLY L      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGGSRHALPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVSLGQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDGGSKS  595
            M+GR++F DGG + 
Sbjct  183  MVGRRLFGDGGGRE  196



>gb|AJO67965.1| flavonoid-3'-hydroxylase, partial [Prunus avium]
Length=215

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  196
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  197  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  376
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  377  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  556
            MLRKI+SVHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRVM  182

Query  557  LGRKVFNDG  583
            +G+K+F DG
Sbjct  183  VGKKLFADG  191



>ref|NP_001289844.1| flavonoid 3'-monooxygenase [Solanum lycopersicum]
 gb|ADK56284.1| putative flavonoid 3' hydroxylase CYP75B49 [Solanum lycopersicum]
Length=514

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 170/195 (87%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYF-LILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA   LI  T++ +I L+F L L  ++RYP+PLPPGPKPWP++GN+  LG KPHQS A+M
Sbjct  1    MAIFFLILYTIISSIILHFSLSLFFRKRYPVPLPPGPKPWPIIGNIIQLGPKPHQSTASM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKNHDANFSSRPPNSGAKHMAYNYHDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFS KALDDF HVRQEEV TLTR+LA+AG+ P+KLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSTKALDDFRHVRQEEVRTLTRALANAGQNPIKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            ALARVMLG++VF DG
Sbjct  181  ALARVMLGKRVFADG  195



>gb|AIY22749.1| flavonoid 3'-hydroxylase [Iochroma cyaneum]
Length=515

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA   +I CT++ +  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQS A M
Sbjct  1    MAIFFIILCTIIISFLLHTILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSTADM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPLMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            +LARVMLG++VF DG
Sbjct  181  SLARVMLGKRVFADG  195



>dbj|BAJ17668.1| flavonoid 3' hydroxylase [Gynura bicolor]
Length=511

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  LTL+  T + A+ LY L L +  R+P  LPPGP PWP++GNLPHLG  PH  +AA+A
Sbjct  1    MTILTLVLYTSIIALVLYVL-LNLFTRHPNRLPPGPTPWPIVGNLPHLGSIPHHGLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFS+KALDDF HVRQEEVA LTR L  A K+PVKLGQLLNVCTTNA
Sbjct  120  GPRWRLLRKICSVHLFSSKALDDFRHVRQEEVAILTRDLVGAKKSPVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDGGSK  592
            LARVMLGR+VF  GG  
Sbjct  180  LARVMLGRRVFGSGGGD  196



>gb|ACO35753.1| flavonoid 3'-hydroxylase [Bidens aurea]
Length=512

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTVPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDD+ HVRQEEVA LTR+L  A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDYRHVRQEEVAILTRALVGA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            GK PVKLGQLLNVCTTNALARVMLGR+VF DG
Sbjct  162  GKAPVKLGQLLNVCTTNALARVMLGRRVFGDG  193



>gb|ADA85883.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
 gb|AGX01487.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF DG  +S
Sbjct  180  LARVMLGRRVFGDGIDRS  197



>gb|ADA85882.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF DG  +S
Sbjct  180  LARVMLGRRVFGDGIDRS  197



>ref|XP_010695197.1| PREDICTED: flavonoid 3'-monooxygenase [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 171/199 (86%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ L L F T+  AIF+Y+LI  +  RYP PLPPGPKPWP++GNLPH+G  PHQ +A +A
Sbjct  1    MSPLELTFYTIALAIFIYYLITTIFSRYPGPLPPGPKPWPIVGNLPHMGPVPHQGLAKLA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL+HLRLG+V VVVAASA+VAA+FLK HD+NFS+RPPNSGA++IAYNYQDLVFAPY
Sbjct  61   QKYGPLLHLRLGYVHVVVAASASVAAEFLKAHDANFSSRPPNSGAKYIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTN  538
            GPRWRMLRKI+S+HLFSAKAL+D+  +RQEEVA LT++LA +G   P++LGQLLNVCTTN
Sbjct  121  GPRWRMLRKISSLHLFSAKALEDYKPIRQEEVAILTKALAKSGSNNPIQLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDGGSKS  595
            AL+R MLGR+VF DG  KS
Sbjct  181  ALSRAMLGRRVFGDGTGKS  199



>gb|ACN65825.1| flavonoid 3'-hydroxylase [Cichorium intybus]
Length=511

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 162/194 (84%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTLLTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVMLGR+VF DG
Sbjct  180  LARVMLGRRVFGDG  193



>gb|ADA85878.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF DG  +S
Sbjct  180  LARVMLGRRVFGDGIDRS  197



>gb|ABB29899.1| flavonoid 3'-hydroxylase [Osteospermum hybrid cultivar]
Length=514

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 166/194 (86%), Gaps = 2/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L L+  + +  + +Y L L ++ R+   LPPGP PWP++GNLPHLG  PH S+AAMA
Sbjct  1    MTILPLVLYSCITGLVIYVL-LNLRTRHSNRLPPGPTPWPIVGNLPHLGVVPHHSLAAMA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            E+YGPLMHLRLGFVDVVVAASAAVAAQFLKVHD+NF++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   EKYGPLMHLRLGFVDVVVAASAAVAAQFLKVHDANFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  -GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
             GPRWRMLRKI SVHLFS+KALDDF HVRQEEVA LTR+L  AG +PVKLGQLLNVCTTN
Sbjct  120  YGPRWRMLRKICSVHLFSSKALDDFRHVRQEEVAILTRALIGAGDSPVKLGQLLNVCTTN  179

Query  539  ALARVMLGRKVFND  580
            ALARVMLG++VF D
Sbjct  180  ALARVMLGKRVFGD  193



>gb|AIY22748.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA   +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA M
Sbjct  1    MAIFFIILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGP MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            +LARVMLG++VF DG
Sbjct  181  SLARVMLGKRVFADG  195



>gb|AIY22747.1| flavonoid 3'-hydroxylase [Iochroma calycinum]
Length=516

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 168/195 (86%), Gaps = 1/195 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA   +I  T++F+  L+  L L   +RYP+PLPPGPKPWP++GN+ HLG KPHQSIA M
Sbjct  1    MAIFFIILYTIIFSFLLHSILSLFFLKRYPVPLPPGPKPWPIIGNIVHLGPKPHQSIADM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGP MHLR+GFVDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNY DLVFAP
Sbjct  61   ARTYGPFMHLRMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAKALDDF HVRQEEV TLTR+LA+A + PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVRTLTRALANASQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDG  583
            +LARVMLG++VF DG
Sbjct  181  SLARVMLGKRVFADG  195



>gb|AFQ92056.1| flavonoid 3' hydroxylase [Pyrus pyrifolia]
Length=511

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LIF T+V A FLY L    + R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIFFTVVLAFFLYRLFAPGRSRHGLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLGQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDG  583
            M+GR++F DG
Sbjct  183  MVGRRLFGDG  192



>gb|ACO35752.1| flavonoid 3'-hydroxylase [Cosmos sulphureus]
Length=508

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH S+AA+A +YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NF++RPPN
Sbjct  42   GNLPHLGTTPHHSLAALAAKYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFASRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEH+AYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR+LA A
Sbjct  102  SGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALAGA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            GK+PVKLGQLL+VCTTNALARVMLGR+VF +  +K+
Sbjct  162  GKSPVKLGQLLSVCTTNALARVMLGRRVFGERDAKA  197



>gb|AEA06595.1| flavonoid 3'-hydroxylase [Chromolaena odorata]
Length=507

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ L  +  T + A+ +++L+L ++ R+   LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MSILISLLYTFITAL-VFYLLLNLRPRHSKRLPPGPSPWPIVGNLPHLGTIPHHSLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   KKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHIAYNYHDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA LTR L  AG++ VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSTKALDDFRHIRQEEVAILTRVLVGAGESTVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVMLGR+VF DG
Sbjct  180  LARVMLGRRVFGDG  193



>gb|ADA85879.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF  G  +S
Sbjct  180  LARVMLGRRVFGGGIDRS  197



>gb|AFI25037.1| flavonoid 3'-hydroxylase, partial [Populus deltoides x Populus 
tremuloides]
Length=201

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = +2

Query  44   IFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLG  217
            IF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ YGPLMHLR G
Sbjct  1    IFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPVPHHSMAALAKTYGPLMHLRFG  60

Query  218  FvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITS  397
            FVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+S
Sbjct  61   FVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISS  120

Query  398  VHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALARVMLGRKVF  574
            VHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL RVMLGR+VF
Sbjct  121  VHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALGRVMLGRRVF  180

Query  575  NDG  583
             DG
Sbjct  181  GDG  183



>gb|KDP31334.1| hypothetical protein JCGZ_11710 [Jatropha curcas]
Length=511

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG KPHQS+AA+A  YGPLMHLR+GFVDVVVAASAAVA QFLKVHD+NFS+RPPN
Sbjct  39   GNLPHLGPKPHQSLAALARSYGPLMHLRMGFVDVVVAASAAVATQFLKVHDANFSSRPPN  98

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
             GA+++AYNYQDLVFAPYGPRWRMLRKI+SVHLFS KALDDF H+RQ+EV+ LTR+LASA
Sbjct  99   CGAKYVAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDFRHIRQQEVSVLTRALASA  158

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            G TPV LGQLLNVCT NAL RVM+GR+VF DG
Sbjct  159  GPTPVNLGQLLNVCTANALGRVMIGRRVFGDG  190



>gb|ADB77825.1| flavonoid 3'-hydroxylase allele 1 [Dahlia pinnata]
Length=508

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH S+AA+AE+YGPLMHLR GFVDVVVAASA+VA+QFLK HD+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLAALAEKYGPLMHLRFGFVDVVVAASASVASQFLKTHDAKFASRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEHIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVRQEEVA LTR LA A
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSGKALDDFRHVRQEEVAILTRVLAGA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            G + VKLGQLLNVCTTNALARVML R+VF DG  K+
Sbjct  162  GNSTVKLGQLLNVCTTNALARVMLSRRVFGDGDPKA  197



>gb|ACO35754.1| flavonoid 3'-hydroxylase [Dahlia pinnata]
Length=509

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MA LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MAILTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   VKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDGGS  589
            LARVMLGR+VF D G 
Sbjct  180  LARVMLGRRVFGDTGD  195



>gb|ADA85881.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 164/198 (83%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   KKYGPLMHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFSAKALDDF HVRQE+VA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEKVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+V  DG  +S
Sbjct  180  LARVMLGRRVSGDGIDRS  197



>gb|AGC29948.1| CYP75B65 [Sinopodophyllum hexandrum]
Length=510

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ + LI  TLV    +Y +I ++  R PLPLPPGPKPWP++GNLPHLG  PH S+A++A
Sbjct  1    MSPIELILSTLVIGTIVYTIISKLINRTPLPLPPGPKPWPIVGNLPHLGPVPHHSLASLA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             +YGPLMHLRLG V+V+VAAS++VA Q  K HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   SKYGPLMHLRLGSVNVIVAASSSVAVQIFKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GP+WRMLRKI SVHLFSAKALDDF H+RQEEV  LT+ L  AGK PV L +LLNVCTTNA
Sbjct  121  GPKWRMLRKICSVHLFSAKALDDFRHIRQEEVMVLTKVLLGAGKAPVDLAKLLNVCTTNA  180

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  181  LGRVMLGRRVFGDG  194



>dbj|BAJ16330.1| flavonoid 3'-hydroxylase [Antirrhinum kelloggii]
Length=509

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +2

Query  8    TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  187
            ++TLI  TL+    L ++ L  K +   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  
Sbjct  4    SITLIASTLILGFLLLYIFLNRKAKAAAPLPPGPKPWPIVGNLPHLGPKPHQSMAALARV  63

Query  188  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  367
            +GPL+HL++GFV VVVAASA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGP
Sbjct  64   HGPLIHLKMGFVHVVVAASASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGP  123

Query  368  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  547
            RWRMLRKI ++HLFSAKAL DF HVRQEEV  LTR+LA AGKTPVKLGQ+LN C TNA+A
Sbjct  124  RWRMLRKICALHLFSAKALTDFTHVRQEEVGILTRALADAGKTPVKLGQMLNTCATNAIA  183

Query  548  RVMLGRKV  571
            RVMLGR+V
Sbjct  184  RVMLGRRV  191



>dbj|BAN62871.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=513

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ L L F T+V A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A
Sbjct  1    MSPLELTFYTIVLATILYYLITTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   QKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GP+WRMLRKI S+H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQLLNVCTTNA
Sbjct  121  GPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLNVCTTNA  180

Query  542  LARVMLGRKVFNDGGSKS  595
            L+RVMLG++V  DG  KS
Sbjct  181  LSRVMLGKRVLGDGTGKS  198



>ref|XP_007037548.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
 gb|EOY22049.1| Flavonoid 3'-hydroxylase isoform 2 [Theobroma cacao]
Length=507

 Score =   243 bits (620),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRV  181

Query  554  MLGRKVFNDGGSKS  595
            MLG++VF DG  K+
Sbjct  182  MLGKRVFGDGSGKA  195



>ref|XP_007037547.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY22048.1| Flavonoid 3'-hydroxylase isoform 1 [Theobroma cacao]
Length=501

 Score =   243 bits (619),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 168/194 (87%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            + +  +++ A+FLYF+   +++R+ LPLPPGPKPWP++GNLPH+G  PH S+AA+A+ YG
Sbjct  3    SFLLYSILSAVFLYFIFATLRKRHRLPLPPGPKPWPIIGNLPHMGPVPHHSLAALAKVYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VAAQFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVAAQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDDF HVRQ+EV  L R+LA A KT V LGQLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDFRHVRQDEVGVLVRALADA-KTKVNLGQLLNVCTVNALGRV  181

Query  554  MLGRKVFNDGGSKS  595
            MLG++VF DG  K+
Sbjct  182  MLGKRVFGDGSGKA  195



>ref|XP_002319761.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
 gb|EEE95684.1| hypothetical protein POPTR_0013s07050g [Populus trichocarpa]
Length=521

 Score =   243 bits (620),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            LI  + + AIF+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALLAIFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALA  547
            WRMLRKI+SVHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  548  RVMLGRKVFNDG  583
            RVMLGR+VF DG
Sbjct  184  RVMLGRRVFGDG  195



>gb|ACO35756.1| flavonoid 3'-hydroxylase [Tagetes erecta]
Length=509

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/196 (73%), Positives = 167/196 (85%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ LTL+  T + +  LY L+L ++ R+P  LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MSILTLLLYTSITSPVLY-LLLNLRTRHPNRLPPGPTPWPIVGNLPHLGTIPHHSLARLA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   VKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  AG++ VKLGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGAGESTVKLGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDGGS  589
            LARVMLGR+VF D G 
Sbjct  180  LARVMLGRRVFGDTGD  195



>gb|ADA85880.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=508

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 163/198 (82%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +F  L+    LY + L +  R    LPPGP PWP++GNLPHLG  PH ++AA+A
Sbjct  1    MNILPFVFYALILGSVLY-VFLNLSSRKSARLPPGPTPWPIVGNLPHLGPIPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL HLRLG+VDVVVAASA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAP 
Sbjct  60   KKYGPLTHLRLGYVDVVVAASASVAAQFLKVHDANFASRPPNSGAKHVAYNYQDLVFAPC  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFSAKALDDF HVRQEEVA LTR L SAG +PV+LGQLLNVC TNA
Sbjct  120  GPRWRLLRKICSVHLFSAKALDDFRHVRQEEVAVLTRVLVSAGNSPVQLGQLLNVCATNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            LARVMLGR+VF DG  +S
Sbjct  180  LARVMLGRRVFGDGIDRS  197



>ref|XP_011011227.1| PREDICTED: flavonoid 3'-monooxygenase [Populus euphratica]
Length=521

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 3/192 (2%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            LI  + + A+F+Y L+ LR ++ R+  PLPPGPKPWP++GNLPHLG  PH S+AA+A+ Y
Sbjct  4    LILYSALVAVFVYCLLQLRSLRDRHGKPLPPGPKPWPLVGNLPHLGPMPHHSMAALAKTY  63

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GPLMHLR GFVDVVVAASA+VAAQFLKVHDSNFS+RPPNSGA+HIAYNYQDLVFAPYGPR
Sbjct  64   GPLMHLRFGFVDVVVAASASVAAQFLKVHDSNFSSRPPNSGAKHIAYNYQDLVFAPYGPR  123

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG-KTPVKLGQLLNVCTTNALA  547
            WRMLRKI+SVHLFSAK+LDDF H+RQEEVA LT +L  +G  TPV LGQLLNVCT NAL 
Sbjct  124  WRMLRKISSVHLFSAKSLDDFRHIRQEEVAVLTGALTRSGPTTPVNLGQLLNVCTANALG  183

Query  548  RVMLGRKVFNDG  583
            RVMLGR+VF DG
Sbjct  184  RVMLGRRVFGDG  195



>gb|ABC47161.1| flavonoid 3'-hydroxylase [Pilosella officinarum]
Length=512

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 161/194 (83%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L+LI    +  +  Y L+  ++ R    LPPGP PWP++GNLPHLG  PH S+A +A
Sbjct  1    MTLLSLIIYLCITGVTAYVLV-NLRTRRANRLPPGPTPWPIVGNLPHLGTIPHHSLADLA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFSAK+LDDF HVRQEEVA LTR+L  AGK+ VKLGQLL+VCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSAKSLDDFRHVRQEEVAILTRALVGAGKSTVKLGQLLHVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  180  LVRVMLGRRVFGDG  193



>gb|ACV74415.1| putative flavonoid-3'-hydroxylase [Camellia sinensis]
Length=518

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 163/198 (82%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIA  172
            M +L  +  +L+ A+FLY L+ LR     R+P PLPPGP PWPV+GNLPHLG  PH SIA
Sbjct  1    MTSLAFVLYSLLIAVFLYCLLNLRTLLFNRHPRPLPPGPTPWPVIGNLPHLGTMPHHSIA  60

Query  173  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  352
             MA  YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF
Sbjct  61   TMARTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVF  120

Query  353  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-TPVKLGQLLNVC  529
            APYGPRWRMLRKI SVHLFS KALDDF HVRQEE+A LTR+L SAG+   V LGQLLNVC
Sbjct  121  APYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALESAGQAAAVNLGQLLNVC  180

Query  530  TTNALARVMLGRKVFNDG  583
            TTNAL RVMLG +VF DG
Sbjct  181  TTNALGRVMLGHRVFGDG  198



>ref|XP_009338402.1| PREDICTED: flavonoid 3'-monooxygenase [Pyrus x bretschneideri]
Length=511

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPSGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RMLRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RMLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDG  583
            M+GR++F +G
Sbjct  183  MVGRRLFGNG  192



>ref|XP_010259651.1| PREDICTED: flavonoid 3'-monooxygenase [Nelumbo nucifera]
Length=513

 Score =   241 bits (615),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L  +  TL  A  +YFL   +  RYP PLPPGPKPWP++GNLPHLG  PH S+AAMA
Sbjct  1    MTLLAFVSFTLFVAFLIYFL-FNLLNRYPRPLPPGPKPWPIIGNLPHLGTVPHHSLAAMA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPL+HLRLG V VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   RTYGPLLHLRLGSVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLFS KALDDF H+RQEEVA L R+LA AGK  V +GQLL+VCTTNA
Sbjct  120  GPRWRMLRKICSVHLFSGKALDDFRHIRQEEVAVLIRALAGAGKAAVNVGQLLSVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVMLGR+VF  G
Sbjct  180  LARVMLGRRVFGSG  193



>gb|AAG49298.1|AF313488_1 putative flavonoid 3'-hydroxylase [Callistephus chinensis]
Length=518

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH S+AA+A++YGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RPPN
Sbjct  42   GNLPHLGMIPHHSLAALAQKYGPLMHLRLGFVDVVVAASASVAAQFLKTHDANFASRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFS KALDDF HVR+EEVA LTR L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVREEEVAILTRVLVHA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
            G++ VKLGQLLNVCTTNALARVMLGR+VF DG  
Sbjct  162  GESAVKLGQLLNVCTTNALARVMLGRRVFADGSE  195



>gb|ADZ54783.1| flavonoid 3'-monooxygenase [Prunus avium]
Length=510

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  196
            LIF T+VFA FLY L++    R+ LPL PGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLVP-GNRHSLPLAPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  197  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  376
            LMHLRLGFVDV+VAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVIVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  377  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  556
            MLRKI+SVHLFS KALDD  HVRQEEVA L  SLA AG   V L QLLN+CT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHSLAGAGSKTVNLAQLLNICTVNALGRVM  182

Query  557  LGRKVFNDG  583
            +G+K+F DG
Sbjct  183  VGKKLFADG  191



>gb|AEF30421.1| flavonoid 3'-hydroxylase, partial [Fagopyrum tataricum]
Length=277

 Score =   233 bits (594),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LTR+L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTRALSKA  125

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            GK  V+LGQLLNVCTTNAL RVMLGR+VF DG  K+
Sbjct  126  GKNAVQLGQLLNVCTTNALGRVMLGRRVFGDGSGKA  161



>ref|XP_010030596.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83708.1| hypothetical protein EUGRSUZ_B00582 [Eucalyptus grandis]
Length=514

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MA L+LI  T+  + FLY L L    R   PLPPGP+PWP++GNLPHLG  PH SIAA+A
Sbjct  1    MALLSLILATVAISAFLYSL-LGYLSRPARPLPPGPRPWPLVGNLPHLGPVPHHSIAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPLMHLRLGFVDVVVAASA+VAA+FLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   RTYGPLMHLRLGFVDVVVAASASVAAEFLKTHDTNFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI+SVHLFS KAL+D+ HVRQEEVA LT +LA AG  P  L QLLNVCT NA
Sbjct  120  GPRWRMLRKISSVHLFSGKALEDYRHVRQEEVAILTSALARAGSAPANLAQLLNVCTVNA  179

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR++F DG
Sbjct  180  LGRVMLGRRMFGDG  193



>ref|XP_007209917.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
 gb|AFC62055.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|EMJ11116.1| hypothetical protein PRUPE_ppa004433mg [Prunus persica]
Length=510

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  196
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  197  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  376
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  377  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  556
            MLRKI+SVHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRVM  182

Query  557  LGRKVFNDG  583
            +G+++F DG
Sbjct  183  VGKRLFGDG  191



>gb|ACR14867.1| flavonoid 3' hydroxylase [Malus domestica]
Length=511

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDG  583
            M+GR++F +G
Sbjct  183  MVGRRLFGNG  192



>ref|XP_008393217.1| PREDICTED: flavonoid 3'-monooxygenase-like [Malus domestica]
Length=511

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 158/190 (83%), Gaps = 0/190 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LI  T+VFA FLY +      R+ LPLPPGPKPWPV+GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGGSRHSLPLPPGPKPWPVVGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPPNSGAKHLAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RLLRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSKPVNLAQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDG  583
            M+GR++F +G
Sbjct  183  MVGRRLFGNG  192



>gb|AJA79074.1| flavonoid 3' hydroxylase [Prunus persica]
 gb|AJA79081.1| flavonoid 3' hydroxylase [Prunus persica]
Length=509

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  196
            LIF T+VFA  LY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  9    LIFITVVFAALLYRLLFS-GNRHSLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  67

Query  197  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  376
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  68   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  127

Query  377  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  556
            MLRKI+SVHLFS KALDD  HVRQEEVA L   LA AG  PV L QLLNVCT NAL RVM
Sbjct  128  MLRKISSVHLFSGKALDDLRHVRQEEVAVLAHGLAGAGSKPVNLAQLLNVCTVNALGRVM  187

Query  557  LGRKVFNDG  583
            +G+++F DG
Sbjct  188  VGKRLFGDG  196



>gb|ADK56126.1| putative flavonoid 3'-hydroxylase [Coreopsis grandiflora]
Length=512

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  LTLI    V  I  Y L L ++ R    LPPGP PWP++GNLPHLG  PH S+AA+A
Sbjct  1    MTLLTLIIYACVTGIAAYVL-LNLRNRRAKRLPPGPTPWPIVGNLPHLGTIPHHSLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             RYGPLMHLRLGFVDVVVAASA+VAAQFLK HD+NF++RP +SG +H+AYNYQDLVFAPY
Sbjct  60   TRYGPLMHLRLGFVDVVVAASASVAAQFLKAHDANFASRPLSSGGKHMAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI SVHLF AK+LDDF HVRQEEVA LTR+L  AGK+ V LGQLLNVCTTNA
Sbjct  120  GPRWRMLRKICSVHLFPAKSLDDFRHVRQEEVAILTRALVDAGKSTVILGQLLNVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVMLGR+VF DG
Sbjct  180  LARVMLGRRVFGDG  193



>dbj|BAF49324.1| flavonoid 3'-hydroxylase [Lobelia erinus]
Length=515

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 159/200 (80%), Gaps = 7/200 (4%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLI-------LRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  169
            ++LIF T + A  LY L+       L        PLPPGPKPWP++GNLPHLG  PHQ++
Sbjct  1    MSLIFYTCIIAFLLYVLLSTLRTFLLNRNPASRKPLPPGPKPWPIVGNLPHLGTMPHQTM  60

Query  170  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  349
            AA+A  YGPLMHLRLG VDVVVAAS AVA QFLKVHD+NF NRPPNSGA HIAYNYQDLV
Sbjct  61   AALARTYGPLMHLRLGSVDVVVAASGAVAEQFLKVHDANFLNRPPNSGAVHIAYNYQDLV  120

Query  350  FAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVC  529
            FAPYGPRWR+LRK+++VHLFSAKALDDF HVRQEEVA LTR LASAG  PV L QLL+VC
Sbjct  121  FAPYGPRWRLLRKVSAVHLFSAKALDDFRHVRQEEVAVLTRDLASAGNAPVHLNQLLSVC  180

Query  530  TTNALARVMLGRKVFNDGGS  589
            TTNAL+RVM G++VF  GG 
Sbjct  181  TTNALSRVMFGKRVFGGGGD  200



>dbj|BAF96945.1| flavonoid 3'-hydroxylase [Rhododendron x pulchrum]
Length=480

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH SIAA+A  YGPLMHL +G V VVVAASA+VAAQFLK HD+NFS+RPPN
Sbjct  7    GNLPHLGTMPHHSIAALAREYGPLMHLWMGSVHVVVAASASVAAQFLKTHDANFSSRPPN  66

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSAKALDDF HVRQEEVA LTR+LA+A
Sbjct  67   SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHVRQEEVAILTRALANA  126

Query  488  GK-TPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            GK T V LGQLLN+CTTNA+ARVMLGR+VF DG
Sbjct  127  GKSTTVNLGQLLNLCTTNAIARVMLGRRVFGDG  159



>ref|XP_011072866.1| PREDICTED: flavonoid 3'-monooxygenase [Sesamum indicum]
Length=511

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 161/188 (86%), Gaps = 3/188 (2%)
 Frame = +2

Query  8    TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  187
            TLTLI  T +  +FLY  + R   R  + LPPGP+PWP++GNL  LG KPHQS+AA+A  
Sbjct  4    TLTLIVYTSILCLFLYSFLRR---RRSVRLPPGPRPWPIVGNLLQLGPKPHQSMAALARV  60

Query  188  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  367
            YGPLMHL++GFV+VVVAASA VA QFLKVHD+NFSNRPPN+GAE++AYNYQD+VFAPYGP
Sbjct  61   YGPLMHLKMGFVNVVVAASAGVAEQFLKVHDANFSNRPPNAGAEYVAYNYQDMVFAPYGP  120

Query  368  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  547
            RWR+LRKI +VH+FSAKALDDF HVRQEEV  LTR+LASAG+TP +LGQ+LNVC TNA+A
Sbjct  121  RWRLLRKICAVHVFSAKALDDFRHVRQEEVGILTRALASAGQTPARLGQMLNVCATNAIA  180

Query  548  RVMLGRKV  571
            RVMLGR+V
Sbjct  181  RVMLGRRV  188



>ref|XP_008240031.1| PREDICTED: flavonoid 3'-monooxygenase [Prunus mume]
Length=510

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 158/189 (84%), Gaps = 1/189 (1%)
 Frame = +2

Query  17   LIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGP  196
            LIF T+VFA FLY L+     R+ LPLPPGPKPWP++GNLPHLG  PH S+AA+A +YGP
Sbjct  4    LIFITVVFAAFLYRLLFS-GNRHFLPLPPGPKPWPIVGNLPHLGPVPHHSLAALARQYGP  62

Query  197  LMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWR  376
            LMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+H+AYNY DLVFAPYGPRWR
Sbjct  63   LMHLRLGFVDVVVAASASVASQFLKTHDTNFSSRPPNSGAKHLAYNYHDLVFAPYGPRWR  122

Query  377  MLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVM  556
            MLRKI+SVHLFS KALDD  HVRQEE+A L   LA AG   V L QLLNVCT NAL RVM
Sbjct  123  MLRKISSVHLFSGKALDDLRHVRQEEIAVLAHGLAGAGSKTVNLAQLLNVCTVNALGRVM  182

Query  557  LGRKVFNDG  583
            +G+++F DG
Sbjct  183  VGKRLFGDG  191



>gb|ADM26615.1| flavonoid 3'-hydroxylase [Cynara cardunculus var. scolymus]
Length=512

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG+ PH ++AAMA +YGPLMHLRLG VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  42   GNLPHLGRIPHHALAAMATKYGPLMHLRLGVVDVVVAASASVAAQFLKVHDANFASRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAY+YQDLVFAPYGP+WRMLRKI SVHLFS KALDDF HVR+EEVA L R+LA A
Sbjct  102  SGAKHIAYDYQDLVFAPYGPKWRMLRKICSVHLFSNKALDDFRHVREEEVAILARALAGA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            G++ V LGQLLNVCTTNALARVMLGR+VF DG
Sbjct  162  GRSTVALGQLLNVCTTNALARVMLGRRVFGDG  193



>ref|XP_009771410.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Nicotiana sylvestris]
Length=515

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 164/192 (85%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLY-FLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA  +LI  T++F+  L+  L L  ++RYPLPLPPGPKPWP++GNL H+G KPHQSIAAM
Sbjct  1    MAIFSLILYTVIFSFLLHSILTLFFRKRYPLPLPPGPKPWPIIGNLVHMGPKPHQSIAAM  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A  YGPLMHL++GFVDVVVAASA+VAAQFLK HD+NFS+RP NS  +H+AYN QDLVFAP
Sbjct  61   ARTYGPLMHLKMGFVDVVVAASASVAAQFLKTHDANFSSRPQNSCTKHLAYNSQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGPRWRMLRKI SVHLFSAK LDDF HVRQ EV  LTR+LASAG+ PVKLGQLLNVCTTN
Sbjct  121  YGPRWRMLRKICSVHLFSAKPLDDFRHVRQNEVRILTRALASAGQKPVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVF  574
            AL +VMLGR+VF
Sbjct  181  ALTQVMLGRRVF  192



>gb|KDO54631.1| hypothetical protein CISIN_1g020877mg [Citrus sinensis]
Length=320

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A LTR+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASA  166

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            G  PV L Q LN+C  NAL RVMLG +VF DG   S
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGS  202



>ref|XP_010258076.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
 ref|XP_010258077.1| PREDICTED: flavonoid 3'-monooxygenase-like [Nelumbo nucifera]
Length=516

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/197 (71%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L L+  T  F  FL +  L    RYP PLPPGPKPWP++GNLPHLG  PH +IAA+A
Sbjct  1    MTPLALVALT-SFVAFLIYFFLNFSNRYPRPLPPGPKPWPIIGNLPHLGPVPHHTIAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPL+HLRLG V VVVAASA+VA+QFLK HD+NFS+RPPNSGA+HIAYNY DLVFAPY
Sbjct  60   RVYGPLLHLRLGSVHVVVAASASVASQFLKTHDANFSSRPPNSGAKHIAYNYHDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI SVHLFS KALDDF HVRQEEVA LTR+L+ +G +P+ +GQLLNVCTTNA
Sbjct  120  GPRWRLLRKICSVHLFSGKALDDFRHVRQEEVAVLTRALSRSGTSPLNVGQLLNVCTTNA  179

Query  542  LARVMLGRKVF-NDGGS  589
            LARVMLGR+VF +D G+
Sbjct  180  LARVMLGRRVFESDDGT  196



>dbj|BAN05297.1| flavonoid 3'-hydroxylase [Dianthus caryophyllus]
Length=514

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 166/199 (83%), Gaps = 1/199 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ L L F T+  A  LY+LI  V + +  PLPPGP+PWP++GNLPH+G+ PHQ +AA+A
Sbjct  1    MSPLELTFYTIALATILYYLIPTVFRGHQKPLPPGPRPWPIVGNLPHMGQAPHQGLAALA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL+++RLG+VDVVVAASA+VA QFLK HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   QKYGPLLYMRLGYVDVVVAASASVATQFLKTHDLNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ-LLNVCTTN  538
            GP+WRMLRKI S+H+FS+KALDDF  VRQEEV+ L  ++A AG  PV+LGQ LLNVCTTN
Sbjct  121  GPKWRMLRKICSLHMFSSKALDDFRLVRQEEVSILVNAIAKAGTKPVQLGQLLLNVCTTN  180

Query  539  ALARVMLGRKVFNDGGSKS  595
            AL+RVMLG++V  DG  KS
Sbjct  181  ALSRVMLGKRVLGDGTGKS  199



>gb|KJB51033.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=422

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRKI+S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  554  MLGRKVFNDGGSKS  595
            M+G++VF DG   S
Sbjct  182  MMGKRVFGDGSGGS  195



>gb|ACO35757.1| flavonoid 3'-hydroxylase [Rudbeckia hirta]
Length=509

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH S+A +A +YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+ F++RPPN
Sbjct  42   GNLPHLGTIPHHSLARLAAKYGPLMHLRLGFVDVVVAASASVAAQFLKTNDAIFASRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI SVHLFSAKALDDF H+RQEEVA LTR+L  A
Sbjct  102  SGAKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSAKALDDFRHIRQEEVAILTRALIGA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
            G++ VKLGQLLNVCTTNALARVMLGR+VF+D G 
Sbjct  162  GESTVKLGQLLNVCTTNALARVMLGRRVFSDTGD  195



>gb|KDO37751.1| hypothetical protein CISIN_1g042286mg, partial [Citrus sinensis]
Length=303

 Score =   229 bits (584),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PHQSIA +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPN
Sbjct  47   GNLPHLGPMPHQSIAGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPN  106

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQD+VF PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A L R+LASA
Sbjct  107  SGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASA  166

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            G  PV L Q LN+C  NAL RVMLG +VF DG   S
Sbjct  167  GTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGS  202



>gb|AEN71546.1| flavanone 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 166/196 (85%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  175
            M  +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A+
Sbjct  1    MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            +A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFA
Sbjct  61   LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA LT +LASA  + V LGQLLNVCTT
Sbjct  121  PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLLNVCTT  180

Query  536  NALARVMLGRKVFNDG  583
            NALARVMLG++VF DG
Sbjct  181  NALARVMLGKRVFGDG  196



>gb|AIU98513.1| flavonoid 3'-hydroxylase [Paeonia suffruticosa]
Length=512

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 166/196 (85%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LR-VKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  175
            M  +T +  TL    F+Y L+ LR +   +P  LPPGP+PWP++GNLPHLG KPHQS+A+
Sbjct  1    MTPVTFLLFTLAVTCFVYLLVNLRTLVNSHPHRLPPGPRPWPIVGNLPHLGSKPHQSLAS  60

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            +A  YGPLMHLRLGFVDVVVAASA+VAAQFLK +D+NF+NRPPNSGA++IAYNYQDLVFA
Sbjct  61   LARSYGPLMHLRLGFVDVVVAASASVAAQFLKTNDANFANRPPNSGAKYIAYNYQDLVFA  120

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWR+LRK++S+HLFS KALDDF H+RQEEVA LT +LASA  + V LGQLLNVCTT
Sbjct  121  PYGPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLTHALASARDSLVNLGQLLNVCTT  180

Query  536  NALARVMLGRKVFNDG  583
            NALARVMLG++VF DG
Sbjct  181  NALARVMLGKRVFGDG  196



>gb|ACN65826.1| flavonoid 3'-hydroxylase [Echinops bannaticus]
Length=508

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 159/192 (83%), Gaps = 1/192 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFL-ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            M  LT +  T +  +  Y L +  ++  +   LPPGP PWP++GNLPHLG+ PH S+A +
Sbjct  1    MTILTFLLYTCITGLVFYALHLFNLRTPHRNRLPPGPTPWPIVGNLPHLGRVPHHSLADL  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A +YGPL+HLRLGFVDVVVA SA+VAAQFLKVHD+NF++RPPNSGA+H+AYNYQD+VFAP
Sbjct  61   ATKYGPLLHLRLGFVDVVVAGSASVAAQFLKVHDANFASRPPNSGAKHMAYNYQDMVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGP+WRMLRKI SVHLFS KALDDF HVRQEEVA L R+L  AG++ VKLGQLLNVCTTN
Sbjct  121  YGPKWRMLRKICSVHLFSTKALDDFRHVRQEEVAILARALVGAGESTVKLGQLLNVCTTN  180

Query  539  ALARVMLGRKVF  574
            ALARVMLGR+VF
Sbjct  181  ALARVMLGRRVF  192



>gb|ACM62746.1| flavonoid 3'-hydroxylase [Garcinia mangostana]
Length=507

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +2

Query  20   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  199
            I  +++ AI +Y LI          LPPGP+P P++GNLPHLG  PHQSIA++ ++YGPL
Sbjct  5    ILYSILIAILVYVLIKLGSLSSGRRLPPGPRPLPLVGNLPHLGSMPHQSIASLVKKYGPL  64

Query  200  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  379
            M+LRLG+VDVVVAASA+VAAQ  K HD+NFS+RPPNSGA+++AYNY DLVFAPYGPRWRM
Sbjct  65   MYLRLGYVDVVVAASASVAAQIFKNHDANFSSRPPNSGAKYVAYNYHDLVFAPYGPRWRM  124

Query  380  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  559
            LRKI+SVHLFS KALDDF H+R+ E+A LT++LASAGK PV LGQLLNVCTTNAL RVM+
Sbjct  125  LRKISSVHLFSNKALDDFRHIREAELAVLTQTLASAGKAPVNLGQLLNVCTTNALGRVMV  184

Query  560  GRKVFNDG  583
            GR+VFNDG
Sbjct  185  GRRVFNDG  192



>gb|KHG07922.1| Flavonoid 3',5'-hydroxylase [Gossypium arboreum]
Length=510

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            + +  +++  +FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSTVFLYFVFIISRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRKI+SVHLFS KALDDF H+R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSVHLFSGKALDDFRHIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  554  MLGRKVFNDG  583
            M+G++VF DG
Sbjct  182  MMGKRVFGDG  191



>gb|ACN65827.1| flavonoid 3'-hydroxylase [Centaurea cyanus]
Length=514

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 138/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLGK PH ++AAMA++YGPLMHLR G VDVVVAASA+VAAQFLKVHD+NF++RPPN
Sbjct  43   GNLPHLGKMPHHALAAMADKYGPLMHLRFGVVDVVVAASASVAAQFLKVHDANFASRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+H+AY+YQDLVFAPYG +WRMLRKI SVHLFS KALDDF HVR+EEVA LTR+LA A
Sbjct  103  SGAKHLAYDYQDLVFAPYGLKWRMLRKICSVHLFSNKALDDFRHVREEEVAVLTRALAGA  162

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            G + V LGQLLNVCTTNALARVMLGR+VF DG
Sbjct  163  GGSTVALGQLLNVCTTNALARVMLGRRVFGDG  194



>gb|ABB53383.1| flavonoid-3'-hydroxylase [Antirrhinum majus]
Length=520

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 160/196 (82%), Gaps = 3/196 (2%)
 Frame = +2

Query  8    TLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  187
            T  L+ CT +    L +  L    R   PLPPGPKPWP++GNLPHLG KPHQS+AA+A  
Sbjct  17   TSLLVPCTFILGFLLLYSFL---NRKVKPLPPGPKPWPIVGNLPHLGPKPHQSMAALARV  73

Query  188  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  367
            +GPL+HL++GFV VVVA+SA+VA +FLKVHD+NFS+RPPNSGA+H+AYNYQDLVFAPYGP
Sbjct  74   HGPLIHLKMGFVHVVVASSASVAEKFLKVHDANFSSRPPNSGAKHVAYNYQDLVFAPYGP  133

Query  368  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  547
            RWRMLRKI ++HLFSAKAL+DF HVRQ+EV  LTR LA AG+TP+KLGQ++N C TNA+A
Sbjct  134  RWRMLRKICALHLFSAKALNDFTHVRQDEVGILTRVLADAGETPLKLGQMMNTCATNAIA  193

Query  548  RVMLGRKVFNDGGSKS  595
            RVMLGR+V     SK+
Sbjct  194  RVMLGRRVVGHADSKA  209



>gb|KJB51032.1| hypothetical protein B456_008G198200 [Gossypium raimondii]
Length=510

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRKI+S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKISSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  554  MLGRKVFNDGGSKS  595
            M+G++VF DG   S
Sbjct  182  MMGKRVFGDGSGGS  195



>gb|AIY51699.1| flavonoid 3'-hydroxylase [Penstemon barbatus]
Length=517

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 163/204 (80%), Gaps = 7/204 (3%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplpl---ppgpkpwpvlGNLPHLGKKPHQSIAA  175
            A +TL+ CT +    L + I +  QR        PPGP+PWP++GNLP LG KPHQ++AA
Sbjct  3    AAITLLICTSILGFLLLYWIFQRPQRKAKSTLPLPPGPRPWPIIGNLPQLGPKPHQTMAA  62

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            +A  +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFA
Sbjct  63   LARVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFA  122

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWR+LRKI ++HLFSAKALDDF HVRQEEV  LTR+LASAG+  +KLGQ+LN+C T
Sbjct  123  PYGPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMKLGQMLNICAT  182

Query  536  NALARVMLGRKV----FNDGGSKS  595
            NALARV LGR+V    F DG  K+
Sbjct  183  NALARVALGRRVVGHGFGDGEVKA  206



>gb|AEX07282.1| F3'H [Arachis hypogaea]
Length=517

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 164/192 (85%), Gaps = 3/192 (2%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            ++ F T+  AI +Y  I++   R  LPLPPGPKPWP++GNLPHLG  PH +IAA+A+ +G
Sbjct  6    SIAFATIALAILIY-RIVKFVTRPSLPLPPGPKPWPIIGNLPHLGPVPHHAIAALAKVHG  64

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLG VDVVVAASA VA QFLKVHD+NFS+RPPN+GA++IAYNYQDLVFAPYGPRW
Sbjct  65   PLMHLRLGMVDVVVAASAKVAEQFLKVHDANFSSRPPNAGAKYIAYNYQDLVFAPYGPRW  124

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP--VKLGQLLNVCTTNALA  547
            RMLRKI+S+HLFSAKALDDF H+RQ EVA LT+++AS+  T   V LGQLLNVCTTNALA
Sbjct  125  RMLRKISSLHLFSAKALDDFKHLRQGEVARLTKNIASSTDTSKAVNLGQLLNVCTTNALA  184

Query  548  RVMLGRKVFNDG  583
            RVM+GR+VFNDG
Sbjct  185  RVMIGRRVFNDG  196



>ref|XP_006399285.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
 gb|ESQ40738.1| hypothetical protein EUTSA_v10013289mg [Eutrema salsugineum]
Length=510

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 155/193 (80%), Gaps = 0/193 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T +F T++ A F++ L+L    R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFITILLATFIFLLVLLFSLRRNHRLPPGPNPWPIIGNLPHMGHKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP+++LRLGF DVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILYLRLGFADVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R L+ AG  PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELSRAGTKPVNLGQLVNMCVINALGR  180

Query  551  VMLGRKVFNDGGS  589
             M+GR++F  G  
Sbjct  181  EMIGRRLFGAGAD  193



>gb|AHY35313.1| flavonoid 3'-hydroxylase 1 [Morus notabilis]
Length=508

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MA++T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A
Sbjct  1    MASITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             ++GPLMHLRLG VDVVVAASA++AAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PY
Sbjct  60   RKHGPLMHLRLGQVDVVVAASASMAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            G RWR+LRKITSVHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NA
Sbjct  120  GQRWRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            L R MLG +VF DG  KS
Sbjct  180  LGRTMLGYRVFGDGSGKS  197



>gb|ACO35755.1| chalcone 3-hydroxylase [Cosmos sulphureus]
Length=512

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PHQS+A +A +YGPLM+LRLGFVDVVVAASA+VAAQFLKVHD NF++RP +
Sbjct  42   GNLPHLGASPHQSLATLAAKYGPLMYLRLGFVDVVVAASASVAAQFLKVHDLNFASRPLS  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SG ++IAYNYQD+VFAPYGPRWRMLRKI SVH+FSAKA+D F HVRQEEVA LTR+L SA
Sbjct  102  SGGKYIAYNYQDMVFAPYGPRWRMLRKICSVHMFSAKAMDGFRHVRQEEVAILTRTLVSA  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
            GK+PVKLGQ+LNVCTTNALARV+LGR+VF DG +
Sbjct  162  GKSPVKLGQILNVCTTNALARVVLGRRVFADGSA  195



>ref|XP_010105826.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19303.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06425.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=508

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 161/198 (81%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MA++T I  +++FA+ +Y L+  +  R    LPPGP+ WPV+GNLPHLG+ PHQ++A +A
Sbjct  1    MASITTILLSILFAVLVYRLVNNLI-RSRRKLPPGPRQWPVIGNLPHLGQAPHQTMATLA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             ++GPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF PY
Sbjct  60   RKHGPLMHLRLGQVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFRPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            G RWR+LRKITSVHLFS KAL+DF HVRQEEVA L  +LA+ G T V LGQLLNVCT NA
Sbjct  120  GQRWRLLRKITSVHLFSGKALEDFRHVRQEEVAVLISALANRGSTAVNLGQLLNVCTVNA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            L R MLG +VF DG  KS
Sbjct  180  LGRTMLGYRVFGDGSGKS  197



>gb|KEH32010.1| flavonoid hydroxylase [Medicago truncatula]
Length=510

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ L ++F T+  AI +Y L L +  +  LPLPPGP PWP++GNLPH+G  PH ++A +A
Sbjct  1    MSPLIIVFATIAAAILIYRL-LNLITKPSLPLPPGPSPWPIVGNLPHMGPVPHHALAVLA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             ++GPLMHLRLG+VDV+VAASA+VA QFLKVHD+NFS+RP NSGA+++AYNYQDLVFAPY
Sbjct  60   LKHGPLMHLRLGYVDVIVAASASVAEQFLKVHDTNFSSRPTNSGAKYLAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI+ VH+FS+KALD+F H+RQEEVA L R+LAS+G   V LGQ+LNVCTTNA
Sbjct  120  GPRWRLLRKISYVHMFSSKALDEFRHIRQEEVARLIRNLASSGSKAVNLGQMLNVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVM+GR+VFN+G
Sbjct  180  LARVMIGRRVFNEG  193



>gb|ADP24158.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
 gb|ADP24159.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 165/194 (85%), Gaps = 1/194 (1%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            + +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP++GNLPH+   PHQ +AAMA+ YG
Sbjct  3    SFVLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPIIGNLPHMSPVPHQGLAAMAKVYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            R+LRK++S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +V
Sbjct  123  RLLRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQV  181

Query  554  MLGRKVFNDGGSKS  595
            M+G++VF DG   S
Sbjct  182  MMGKRVFGDGSGGS  195



>gb|AAO47850.1| defective flavonoid 3'-hydroxylase [Glycine max]
Length=298

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
                V LGQLLNVCTTNALAR M+GR+VFNDG
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDG  193



>gb|AHZ31753.1| flavonoid 3'-hydroxylase [Viola x wittrockiana]
Length=508

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH++IAA+A  YGPLMHLRLG V+VVVAASA+VAAQFLK HDSNFS+RPPN
Sbjct  40   GNLPHLGPAPHRNIAALARTYGPLMHLRLGSVNVVVAASASVAAQFLKTHDSNFSSRPPN  99

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFS KALDD  +VRQEEVA LTR+LASA
Sbjct  100  SGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSGKALDDGRYVRQEEVALLTRTLASA  159

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
            G   V L QLLN+C  NAL RVMLGR+VF+DG +
Sbjct  160  GDAAVNLAQLLNICAANALGRVMLGRRVFSDGSA  193



>dbj|BAE71221.1| putative flavonoid 3'-hydroxylase [Trifolium pratense]
Length=510

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 166/194 (86%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   ++F T+V AI +  L+  +K +  LPLPPGP PWP++GNLPH+G  PH ++AA+A
Sbjct  1    MSLWIIVFVTIVAAILINRLLNLIK-KPTLPLPPGPSPWPIVGNLPHMGPVPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             ++GPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPNSGA++IAYNYQDLVFAPY
Sbjct  60   LKHGPLMHLQLGFVDVIVAASASVAEQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI+ VH+FS+KALDDF H+RQ+EVA L R+L+++G     LGQ+LNVCTTNA
Sbjct  120  GPRWRLLRKISYVHMFSSKALDDFRHIRQDEVARLIRNLSNSGSKAANLGQMLNVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVM+GR+VFN+G
Sbjct  180  LARVMIGRRVFNEG  193



>gb|ACY06905.1| flavonoid 3'-hydroxylase [Gossypium hirsutum]
Length=510

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 163/192 (85%), Gaps = 1/192 (1%)
 Frame = +2

Query  20   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  199
            +  +++ A+FLYF+ +  ++R  LPLPPGPKPWP +GNLPH+   PHQ +AAMA+ YGPL
Sbjct  5    VLYSILSAVFLYFVFITSRKRRRLPLPPGPKPWPSIGNLPHMSPVPHQGLAAMAKVYGPL  64

Query  200  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  379
            MHLRLGFVDVVVAASA++AAQFLKVHDSNFS+RPPN+GA+++AYNYQDLVFAPYGPRWR+
Sbjct  65   MHLRLGFVDVVVAASASMAAQFLKVHDSNFSSRPPNAGAKYVAYNYQDLVFAPYGPRWRL  124

Query  380  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  559
            LRK++S+HLFS KALDDF  +R+EE+  L R+LASA KT V LGQLLNVCT NAL +VM+
Sbjct  125  LRKMSSLHLFSGKALDDFRQIREEEIRVLVRALASA-KTKVNLGQLLNVCTVNALGQVMM  183

Query  560  GRKVFNDGGSKS  595
            G++VF DG   S
Sbjct  184  GKRVFGDGSGGS  195



>gb|ADT63065.1| flavonoid 3'-hydroxylase, partial [Fagopyrum esculentum]
Length=457

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A+ YGPLMHLRLG V V++AASA+VA+QFLK HD+NFS+RPPN
Sbjct  6    GNLPHMGAVPHHSLAALAKVYGPLMHLRLGSVHVIIAASASVASQFLKTHDANFSSRPPN  65

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYGPRWRMLRKI  VHLFS KAL+DF  VR+EEV  LT +L+ A
Sbjct  66   SGAKHIAYNYQDLVFAPYGPRWRMLRKICQVHLFSGKALEDFRFVREEEVGILTGALSKA  125

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            GK  V+LGQLLNVCTTNAL RVMLGR+VF DG  K+
Sbjct  126  GKNAVQLGQLLNVCTTNALGRVMLGRRVFGDGSGKA  161



>ref|XP_010491421.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEVAT+TR LA  G   V LGQL+N+C  NAL+R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVATMTRELAQVGTKAVNLGQLVNMCVVNALSR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>ref|XP_006440736.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
 gb|ESR53976.1| hypothetical protein CICLE_v10019637mg [Citrus clementina]
Length=538

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 162/202 (80%), Gaps = 4/202 (2%)
 Frame = +2

Query  2    MATLTL-IFCTLVFAI---FLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  169
            M+TL L I  T + AI   FL+ L+   ++     LPPGPKPWP++GNLPHLG  PHQSI
Sbjct  23   MSTLPLLILYTSLLAIVISFLFSLLRNRRRHSSHRLPPGPKPWPIVGNLPHLGPMPHQSI  82

Query  170  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  349
            A +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPNSGA+HIAYNYQD+V
Sbjct  83   AGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPNSGAKHIAYNYQDIV  142

Query  350  FAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVC  529
            F PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A LTR+LASAG  PV L Q LN+C
Sbjct  143  FRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAQRLNLC  202

Query  530  TTNALARVMLGRKVFNDGGSKS  595
              NAL RVMLG +VF DG   S
Sbjct  203  VVNALGRVMLGFRVFGDGTGGS  224



>dbj|BAD91808.1| flavonoid 3'-hydroxylase [Gentiana triflora]
Length=524

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 157/195 (81%), Gaps = 3/195 (2%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRY--plplppgpkpwpvlGNLPHLGKKPHQSIAAMAER  187
            T +F   V  IF++  ++  K+ +   LPLPPGP+PWP+LGN+PHLG KPHQ++A MA+ 
Sbjct  12   TAVFGLFVVFIFIFLKLVSRKKGHGRSLPLPPGPRPWPILGNIPHLGSKPHQTLAEMAKT  71

Query  188  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  367
            YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFAPYGP
Sbjct  72   YGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFAPYGP  131

Query  368  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALA  547
            RWR+LRKI SVHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTTNALA
Sbjct  132  RWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTTNALA  191

Query  548  RVMLGRKVFN-DGGS  589
            RVMLGR+VF  DGG 
Sbjct  192  RVMLGRRVFEGDGGE  206



>gb|ABY89687.1| flavonoid 3` hydroxylase 1 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLVRELARANTKPVNLGQLVNMCVLNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>gb|ABY89688.1| flavonoid 3` hydroxylase 2 protein [Brassica rapa subsp. oleifera]
Length=511

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>gb|AIY51698.1| flavonoid 3'-hydroxylase [Penstemon neomexicanus]
Length=517

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 156/204 (76%), Gaps = 7/204 (3%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIAA  175
            A +TL+ CT +    L + I +  QR      P P       ++GNLP LG KPHQ++AA
Sbjct  3    AAITLLICTSILGFLLLYWIFQRPQRKAKLTLPLPPGPRPWPIIGNLPQLGPKPHQTMAA  62

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            +A  +GPLMHL++GFV VVVAASA++A QFLKV+D+NFS+RPPN+GA+++AYNYQDLVFA
Sbjct  63   LARVHGPLMHLKMGFVHVVVAASASMAEQFLKVNDANFSSRPPNAGAKYVAYNYQDLVFA  122

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWR+LRKI ++HLFSAKALDDF HVRQEEV  LTR+LASAG+  + LGQ+LN+C T
Sbjct  123  PYGPRWRLLRKICALHLFSAKALDDFRHVRQEEVGILTRTLASAGEMQMILGQMLNICAT  182

Query  536  NALARVMLGRKV----FNDGGSKS  595
            NALARV LGR+V    F DG  K+
Sbjct  183  NALARVALGRRVVGHGFGDGEVKA  206



>ref|XP_009122411.1| PREDICTED: flavonoid 3'-monooxygenase [Brassica rapa]
Length=511

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>emb|CDX69984.1| BnaA10g23330D [Brassica napus]
Length=511

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>gb|ABC58722.1| flavonoid 3'-hydroxylase [Brassica napus]
 gb|ABC58723.1| flavonoid 3'-hydroxylase [Brassica napus]
Length=511

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>gb|ADE80941.1| flavonoid 3'-hydroxylase [Epimedium sagittatum]
Length=514

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L L+  TL+ +  LY LI  +    P  LPPGPKPWP++GNL HLG+ PH S+AA+A
Sbjct  1    MTPLELVLATLIISTILYTLINSLLNPAPRGLPPGPKPWPIIGNLLHLGRVPHHSLAALA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPLMHLRLG V V+VAAS++VA Q  K HD NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  61   KKYGPLMHLRLGSVHVIVAASSSVATQIFKTHDVNFSSRPPNSGAKHIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GP+WRMLRKI SVHLFSAKALDDF H+RQEEV  L  +L  AGK P  L +LLNVCTTN 
Sbjct  121  GPKWRMLRKICSVHLFSAKALDDFRHIRQEEVLVLINALFQAGKAPTDLAKLLNVCTTNV  180

Query  542  LARVMLGRKVFNDG  583
            L RVMLGR+VF DG
Sbjct  181  LGRVMLGRRVFGDG  194



>gb|ADZ28515.1| flavonoid-3'-hydroxylase [Camellia nitidissima]
Length=518

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 159/198 (80%), Gaps = 4/198 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLI-LRVK--QRYplplppgpkpwpvlGNLPHLGKKPHQSIA  172
            M +L  +  +L+   FLY L+ LR     R+P PLPPGPKPWPV+GNLPHLG  PH SIA
Sbjct  1    MTSLAFVLYSLLIGFFLYCLLNLRTLLFNRHPRPLPPGPKPWPVIGNLPHLGTMPHHSIA  60

Query  173  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  352
            AMA  YGPLMHLRLG VDVVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVF
Sbjct  61   AMARTYGPLMHLRLGLVDVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVF  120

Query  353  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTR-SLASAGKTPVKLGQLLNVC  529
            APYGPRWRMLRKI SVHLFS KALDDF HVRQEE+A LTR   ++     V LGQLLNVC
Sbjct  121  APYGPRWRMLRKICSVHLFSTKALDDFRHVRQEEIAILTRALASAGQAAAVNLGQLLNVC  180

Query  530  TTNALARVMLGRKVFNDG  583
            TTNAL RVMLG +VF DG
Sbjct  181  TTNALGRVMLGHRVFGDG  198



>ref|XP_010423152.1| PREDICTED: flavonoid 3'-monooxygenase-like [Camelina sativa]
Length=509

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   Y
Sbjct  1    MTTLFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRTLTAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKALDDF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALDDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>gb|AAO47844.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47845.1| gray pubescence flavonoid 3'-hydroxylase [Glycine max]
Length=394

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGG  586
                V LGQLLNVCTTNALAR M+GR+VFNDG 
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDGN  194



>ref|XP_006477655.1| PREDICTED: flavonoid 3'-monooxygenase-like [Citrus sinensis]
Length=516

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 161/202 (80%), Gaps = 4/202 (2%)
 Frame = +2

Query  2    MATLTL-IFCTLVFAI---FLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSI  169
            M+TL L I  T + AI   FL+ L+   ++     LPPGPKPWP++GNLPHLG  PHQSI
Sbjct  1    MSTLPLLILYTSLLAIVISFLFSLLRNRRRHSSHRLPPGPKPWPIVGNLPHLGPMPHQSI  60

Query  170  AAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLV  349
            A +A  +GPLM+LRLGFVDVVVAASA+VAAQFLK+HDSNFSNRPPNSGA+HIAYNYQD+V
Sbjct  61   AGLARTHGPLMYLRLGFVDVVVAASASVAAQFLKIHDSNFSNRPPNSGAKHIAYNYQDIV  120

Query  350  FAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVC  529
            F PYGPRWRMLRKI+SVHLFS KALDD+ HVRQEE+A L R+LASAG  PV L Q LN+C
Sbjct  121  FRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLARALASAGTEPVNLAQRLNLC  180

Query  530  TTNALARVMLGRKVFNDGGSKS  595
              NAL RVMLG +VF DG   S
Sbjct  181  VVNALGRVMLGFRVFGDGTGGS  202



>gb|AGL81348.1| flavanone 3' hydroxylase [Pyrus communis]
Length=511

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 151/190 (79%), Gaps = 0/190 (0%)
 Frame = +2

Query  14   TLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
             LI  T+VFA FLY +      R+ LPLPPGPKPWP+ GNLPHLG  PH S+AA+A +YG
Sbjct  3    VLIVFTVVFAFFLYRIFAPGWSRHSLPLPPGPKPWPIXGNLPHLGPVPHHSLAALARQYG  62

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            PLMHLRLGFVDVVVA SA+VA+QF K  D NFS+RPPNSGA+H+AYNYQ LVFAPYGPRW
Sbjct  63   PLMHLRLGFVDVVVAXSASVASQFXKTXDXNFSSRPPNSGAKHLAYNYQXLVFAPYGPRW  122

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARV  553
            RM RKI+SVHLFS KALDD  HVRQEEV  L   LASAG  PV L QLLNVCT NAL RV
Sbjct  123  RMXRKISSVHLFSGKALDDLKHVRQEEVGVLAHGLASAGSRPVNLAQLLNVCTVNALGRV  182

Query  554  MLGRKVFNDG  583
            M+GR++F +G
Sbjct  183  MVGRRLFGNG  192



>ref|XP_007138248.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
 gb|ESW10242.1| hypothetical protein PHAVU_009G192400g [Phaseolus vulgaris]
Length=506

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 160/194 (82%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   + F T+   I ++ LI  + +   LPLPPGPKPWPV+GN PH+G  PH S+AA+ 
Sbjct  1    MSPFMVAFATVAAVILVHRLIKFLTRNSSLPLPPGPKPWPVVGNFPHMGPVPHHSLAALV  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + +GPLMHLRLGFVD+VVAASA+VA QFLK+HDSNFS+RPPN+GA++IAYNYQDLVFAPY
Sbjct  61   QVHGPLMHLRLGFVDMVVAASASVAEQFLKIHDSNFSSRPPNAGAKYIAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRK+TSVHLFS KALD F H+R+EEV  LTR+L S+    V LGQ+LNVCTTNA
Sbjct  121  GPRWRLLRKLTSVHLFSGKALDVFRHLREEEVGRLTRNLGSSDAKAVNLGQVLNVCTTNA  180

Query  542  LARVMLGRKVFNDG  583
            LARVM+GR+VFNDG
Sbjct  181  LARVMIGRRVFNDG  194



>ref|XP_002871298.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47557.1| hypothetical protein ARALYDRAFT_487632 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            LT++  T++F   L    LR  + + + LPPGP PWP++GNLPH+G KPH+++AAM   Y
Sbjct  6    LTILLATVIFLFLLRVFSLRRNRSHNIRLPPGPNPWPIIGNLPHMGPKPHRTLAAMVSTY  65

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  66   GPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  125

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WR+LRKI+SVHLFSAKAL+DF HVRQEEV TLTR LA  G  PV LGQL+N+C  NAL R
Sbjct  126  WRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELARVGTKPVNLGQLVNMCVVNALGR  185

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  186  EMIGRRLF  193



>gb|AGI16386.1| flavonoid 3' hydroxylase [Ribes nigrum]
Length=524

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG KPHQSIA +A  YGPLMHLRLGFVDVVVAASA+VA+QFLK HD+NFS+RP N
Sbjct  51   GNLPHLGTKPHQSIAELARTYGPLMHLRLGFVDVVVAASASVASQFLKTHDANFSSRPQN  110

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA++IAYNYQDLVFAPYGPRWRMLRKI+ VHLFS KALDDF HVRQEEVA LTR++ + 
Sbjct  111  SGAKYIAYNYQDLVFAPYGPRWRMLRKISQVHLFSNKALDDFRHVRQEEVAVLTRAIVNE  170

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            G   V L +LLNVCTTNALARVMLG++VF +G
Sbjct  171  GDASVDLPRLLNVCTTNALARVMLGKRVFGEG  202



>gb|AFI71898.1| flavonoid 3'-hydroxylase [Paeonia lactiflora]
Length=507

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 158/194 (81%), Gaps = 3/194 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  +T +      A F+Y L   V   +P  LPPGP+PWP++GNLPHLG KPHQS+A++A
Sbjct  1    MTPVTFLLTNFAVASFVYLL---VNNGHPHRLPPGPRPWPIVGNLPHLGPKPHQSLASLA  57

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPLMHLRLG VDVVVAASA+VAAQFLK +D+NF NRPPNSGA++IAYNYQDLVFAPY
Sbjct  58   RSYGPLMHLRLGSVDVVVAASASVAAQFLKTNDANFVNRPPNSGAKYIAYNYQDLVFAPY  117

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRK++S+HLFS KALDDF H+RQEEVA L  +L SA  + V LGQLLNVCTTNA
Sbjct  118  GPRWRLLRKVSSLHLFSGKALDDFRHLRQEEVAVLVHALTSASNSLVNLGQLLNVCTTNA  177

Query  542  LARVMLGRKVFNDG  583
            LARVMLG++VF DG
Sbjct  178  LARVMLGKRVFGDG  191



>gb|KEH33153.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  485  -AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             +    V LGQLLNVCTTNALARVMLGR+VFNDG
Sbjct  163  YSDTKAVNLGQLLNVCTTNALARVMLGRRVFNDG  196



>ref|XP_003598945.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
 gb|AES69196.1| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GN+PHLG  PHQSIAA+A+ +GPLMHL+LGFVDV+VAAS +VA QFLKVHD+NFS+RPPN
Sbjct  43   GNMPHLGPAPHQSIAALAKIHGPLMHLKLGFVDVIVAASGSVAEQFLKVHDANFSSRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            +GA++IAYNYQDLVFAPYGPRWRMLRKI+SVHLFS K +++F H+RQEEVA LT +LAS 
Sbjct  103  TGAKYIAYNYQDLVFAPYGPRWRMLRKISSVHLFSNKVMEEFKHLRQEEVARLTSNLASN  162

Query  485  -AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             +    V LGQLLNVCTTNALARVMLGR+VFNDG
Sbjct  163  YSNTKAVNLGQLLNVCTTNALARVMLGRRVFNDG  196



>gb|AIT52346.1| flavonoid 3'-monooxygenase 1 [Daucus carota]
Length=524

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 151/201 (75%), Gaps = 7/201 (3%)
 Frame = +2

Query  8    TLTLIFCTLVFAIFLYFLIL-------RVKQRYplplppgpkpwpvlGNLPHLGKKPHQS  166
            T  LI  TLV A+ +Y L+        R       P P GPKPWP++GNLPHLG  PH S
Sbjct  5    TPLLILYTLVLALLIYCLLNLRTLFFNRRSSHPLPPGPKGPKPWPIIGNLPHLGAIPHHS  64

Query  167  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  346
            +A MA+ YGPL+HLRLG V VVVA+SA VAAQFLK HD+ FSNRPPNSGA+HIAYNYQDL
Sbjct  65   LAEMAQTYGPLLHLRLGLVHVVVASSAGVAAQFLKTHDAKFSNRPPNSGAKHIAYNYQDL  124

Query  347  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  526
            VFAPYGP+WR LRKI SVHLFSAKALDDF HVRQEEV  L   LA AGK  V LGQLLN+
Sbjct  125  VFAPYGPKWRKLRKICSVHLFSAKALDDFRHVRQEEVGVLVSGLAGAGKRAVHLGQLLNI  184

Query  527  CTTNALARVMLGRKVFNDGGS  589
            C TNAL RVMLG++VF+ G S
Sbjct  185  CATNALGRVMLGKRVFSYGTS  205



>ref|XP_004508739.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=503

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 158/194 (81%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+     F T+  AI +Y  I ++  R  +PLPPGP+PWP++GNLPH+G  PH ++AA+A
Sbjct  1    MSNWISAFATIAAAILIY-RIFKLITRPSIPLPPGPRPWPIVGNLPHMGPVPHHALAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             ++GPLMHLRLGFVDV+VAASA VA QFLKVHD+NFS+RPPNSGA+++AYNYQDLVFAPY
Sbjct  60   HKHGPLMHLRLGFVDVIVAASATVAEQFLKVHDANFSSRPPNSGAKYVAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI  VH+FS KALDD  H+RQEEV  L R+LAS+G   V L Q+LNVCTTNA
Sbjct  120  GPRWRLLRKIAYVHMFSTKALDDVRHLRQEEVGRLIRNLASSGSKAVNLSQMLNVCTTNA  179

Query  542  LARVMLGRKVFNDG  583
            LARVM+GR+VFN+ 
Sbjct  180  LARVMIGRRVFNES  193



>gb|EPS57881.1| flavonoid 3'-hydroxylase, partial [Genlisea aurea]
Length=425

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +2

Query  41   AIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLRLGF  220
            A+FL+     +++R     PPGP PWP+LGN+P LG KPHQS+AA+A  YGPL+HL++GF
Sbjct  10   ALFLFLAYAFIRRRATKRFPPGPTPWPLLGNIPQLGVKPHQSMAALAGVYGPLLHLKMGF  69

Query  221  vdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSV  400
              VVVAASA+VA QFLKVHD+NFS+RPPN+G +++AYNYQDLVFAPYGPRWR+LRKI ++
Sbjct  70   QHVVVAASASVAEQFLKVHDANFSSRPPNAGGKYVAYNYQDLVFAPYGPRWRLLRKICAL  129

Query  401  HLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKV  571
            HLFSAKALDDF HVRQEEV  L R L SAGK PV LGQ+LNVC TNA+ARVMLGR+V
Sbjct  130  HLFSAKALDDFVHVRQEEVGILGRVLVSAGKNPVALGQVLNVCATNAIARVMLGRRV  186



>gb|AAG49301.1|AF313491_1 flavonoid 3'-hydroxylase [Matthiola incana]
Length=513

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G KPHQ++AAM   YGP++HLRLGFV+VVVAAS +VA QFLK+HD+NF++RPPN
Sbjct  43   GNLPHMGPKPHQTLAAMVTTYGPILHLRLGFVNVVVAASKSVAEQFLKIHDANFASRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+DF HVRQEE+  LTR +A A
Sbjct  103  SGAKHIAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDFKHVRQEEIGRLTREVARA  162

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
               PV LGQL+N+C  NAL R M+GR++F DG  
Sbjct  163  DTKPVNLGQLVNMCVVNALGREMIGRRLFGDGAD  196



>emb|CDX99037.1| BnaC09g47980D [Brassica napus]
Length=717

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 154/188 (82%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T ++ T++   F++ ++L + +R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTNLYLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGF DVVVAAS +VA QFLKVHD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF HVRQEEV TL R LA A   PV LGQL+N+C  NAL R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  446  QEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVF  574
            QEEV TL R LA A   PV LGQL+N+C  NAL R M+GR++F
Sbjct  352  QEEVGTLMRELARANTKPVNLGQLVNMCVLNALGREMIGRRLF  394



>gb|EYU23554.1| hypothetical protein MIMGU_mgv1a004224mg [Erythranthe guttata]
Length=538

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPHQS+A +A+ +GPLMHL++G V VVVAASA VA QFLKVHD+NFS+RPPN
Sbjct  65   GNLPQLGPKPHQSMATLAQVHGPLMHLKMGVVHVVVAASAGVAEQFLKVHDANFSSRPPN  124

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+++AYNYQDLVFAPYGPRWRMLRKI ++HLFS KALDDF HVRQEEV  LTRSLASA
Sbjct  125  SGAKYMAYNYQDLVFAPYGPRWRMLRKICTLHLFSTKALDDFRHVRQEEVGILTRSLASA  184

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            GKT   +GQ+LNVCTTNA+ARV+LGR+V   G
Sbjct  185  GKTAASIGQMLNVCTTNAIARVVLGRRVIGYG  216



>gb|AGO03824.1| flavonoid 3`5`-hydroxylase [Echinops bannaticus]
Length=510

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/194 (68%), Positives = 155/194 (80%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFL-ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            M  LTL+  T +  +  Y L +L ++  +P  LPPGP PWP++GNLPH+G  PHQS+AA+
Sbjct  1    MTILTLLLYTCITGLVFYVLQLLNLRTPHPNRLPPGPTPWPIVGNLPHIGTAPHQSLAAL  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A +YGPLMHLRLGFVDVVVA SA+VAAQ  K HD NFSNRP  SG +HIAYNYQDLVFAP
Sbjct  61   ATKYGPLMHLRLGFVDVVVAGSASVAAQIFKAHDVNFSNRPRVSGGKHIAYNYQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGP+WRMLRKI SVHLFS KALDDF HVRQEE A L  +LA AG++ VKLG+L+NVC TN
Sbjct  121  YGPKWRMLRKICSVHLFSTKALDDFRHVRQEEAAILAGTLAGAGESTVKLGELVNVCITN  180

Query  539  ALARVMLGRKVFND  580
            ALARV+LGR+VF D
Sbjct  181  ALARVVLGRRVFVD  194



>gb|KHN17812.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=513

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
                V LGQLLNVCTTNALAR M+GR+VFNDG
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDG  193



>ref|XP_010452770.1| PREDICTED: flavonoid 3'-monooxygenase [Camelina sativa]
Length=509

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = +2

Query  20   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  199
            +F T+V A  L+ L+    +R    LPPGP PWP++GNLPH+G KPH+++ AM   YGP+
Sbjct  4    LFLTVVLATVLFCLLFLFSRRRNPRLPPGPNPWPIIGNLPHMGPKPHRALTAMVTTYGPI  63

Query  200  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  379
            +HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDLVFAPYG RWRM
Sbjct  64   LHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGQRWRM  123

Query  380  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  559
            LRKI+SVHLFSAKAL+DF HVRQEEVATLTR LA  G   V LGQL+N+C  NAL R M+
Sbjct  124  LRKISSVHLFSAKALEDFKHVRQEEVATLTRELAQVGTKAVNLGQLVNMCVVNALGREMI  183

Query  560  GRKVF  574
            GR++F
Sbjct  184  GRRLF  188



>ref|NP_001237015.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAB83261.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47846.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|AAO47847.1| flavonoid 3'-hydroxylase [Glycine max]
 dbj|BAD97828.1| flavonoid 3'- hydroxylase [Glycine max]
 gb|ABW69385.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ABW69386.1| flavonoid 3'-hydroxylase [Glycine max]
 gb|ACN81827.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
                V LGQLLNVCTTNALAR M+GR+VFNDG
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDG  193



>gb|ACR33790.1| flavonoid 3'-hydroxylase [Glycine max]
Length=513

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PH S+AA+A  +GPLMHLRLGFVDVVVAASA+VA QFLK+HDSNFS+RPPN
Sbjct  42   GNLPHMGPVPHHSLAALARIHGPLMHLRLGFVDVVVAASASVAEQFLKIHDSNFSSRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA++IAYNYQDLVFAPYGPRWR+LRK+TSVHLFS KA+++F H+RQEEVA LT +LAS+
Sbjct  102  AGAKYIAYNYQDLVFAPYGPRWRLLRKLTSVHLFSGKAMNEFRHLRQEEVARLTCNLASS  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
                V LGQLLNVCTTNALAR M+GR+VFNDG
Sbjct  162  DTKAVNLGQLLNVCTTNALARAMIGRRVFNDG  193



>dbj|BAB59005.1| flavonoid 3'-hydroxylase [Perilla frutescens var. crispa]
Length=523

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 155/193 (80%), Gaps = 1/193 (1%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQ-RYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            A ++LI CT +  + +YFL LR        PLPPGP+PWP++GNLP LG KPHQS+AA+A
Sbjct  4    AAVSLIICTSILGVLVYFLFLRRGGGSNGRPLPPGPRPWPIVGNLPQLGPKPHQSMAALA  63

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              +GPLMHL++GFV VVVAASA VA +FLKVHD+NF +RPPNSGAEHIAYNY DLVFAP+
Sbjct  64   RVHGPLMHLKMGFVHVVVAASATVAEKFLKVHDTNFLSRPPNSGAEHIAYNYNDLVFAPH  123

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI ++HLFS+KALDDF HVR+EEV  L R+LAS G+ P  +GQ++ VC TNA
Sbjct  124  GPRWRLLRKICALHLFSSKALDDFRHVREEEVGILIRNLASVGEMPASIGQMMYVCATNA  183

Query  542  LARVMLGRKVFND  580
            ++RVMLGR V  D
Sbjct  184  ISRVMLGRHVLGD  196



>gb|AJD25177.1| cytochrome P450 CYP75B79 [Salvia miltiorrhiza]
Length=511

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M++LTL+ C+ V    L + IL   +R P  LPPGP+PWP++GNLP LG KPHQS+AA+A
Sbjct  3    MSSLTLLVCSAVLGFLLLYSIL--VRRRPEKLPPGPRPWPIVGNLPQLGPKPHQSMAALA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHL++GFV VVVAASAAVA QFLK HD+NFS+RPPN+GA+++AYNYQDLVFAPY
Sbjct  61   QVYGPLMHLKMGFVHVVVAASAAVAQQFLKAHDANFSSRPPNAGAKYVAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR+LRKI ++HLFSAKALDDF HVRQEE   L  +LASAG+ PV+LGQ+LNVC TNA
Sbjct  121  GPRWRLLRKICALHLFSAKALDDFRHVRQEEAGILCGALASAGQMPVRLGQMLNVCATNA  180

Query  542  LARVML  559
            ++RVML
Sbjct  181  ISRVML  186



>gb|ACJ85671.1| unknown [Medicago truncatula]
Length=418

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 158/197 (80%), Gaps = 2/197 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTT  535
            GPRWR+LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTT
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTT  180

Query  536  NALARVMLGRKVFNDGG  586
            NALAR ++GR+VFN+G 
Sbjct  181  NALARAVIGRRVFNEGN  197



>gb|AAG49315.1|AF315465_1 flavonoid 3'-hydroxylase [Pelargonium x hortorum]
Length=511

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PHQ++AAMA  YGPL++LRLGFVDVVVA SA++A+QFLK HDSNFS+RPPN
Sbjct  44   GNLPHMGSMPHQNLAAMARTYGPLVYLRLGFVDVVVALSASMASQFLKTHDSNFSSRPPN  103

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA+HIAYNY DLVFAPYGPRWR+ RKITS+HLFS KALDD+ HVRQEEV  L  +LA A
Sbjct  104  AGAKHIAYNYHDLVFAPYGPRWRLFRKITSIHLFSGKALDDYRHVRQEEVGVLASNLARA  163

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
              T V LGQLLN+C TNAL R ++G+KVF DG
Sbjct  164  VSTIVNLGQLLNICATNALGRAVIGKKVFKDG  195



>ref|NP_196416.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
 sp|Q9SD85.1|F3PH_ARATH RecName: Full=Flavonoid 3'-monooxygenase; AltName: Full=Cytochrome 
P450 75B1; AltName: Full=Flavonoid 3'-hydroxylase; Short=AtF3'H; 
AltName: Full=Protein TRANSPARENT TESTA 7 [Arabidopsis 
thaliana]
 gb|AAF73253.1|AF155171_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16745.1|AF271650_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 gb|AAG16746.1|AF271651_1 flavonoid 3'-hydroxylase [Arabidopsis thaliana]
 emb|CAB62611.1| flavonoid 3'-hydroxylase-like protein [Arabidopsis thaliana]
 gb|AAF60189.1| flavonoid 3'hydroxylase [Arabidopsis thaliana]
 gb|AED91232.1| Flavonoid 3'-monooxygenase [Arabidopsis thaliana]
Length=513

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 157/196 (80%), Gaps = 9/196 (5%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRV-----KQRYplplppgpkpwpvlGNLPHLGKKPHQS  166
            MATL   F T++ A  L FLILR+      + +   LPPGP PWP++GNLPH+G KPH++
Sbjct  1    MATL---FLTILLATVL-FLILRIFSHRRNRSHNNRLPPGPNPWPIIGNLPHMGTKPHRT  56

Query  167  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  346
            ++AM   YGP++HLRLGFVDVVVAAS +VA QFLK+HD+NF++RPPNSGA+H+AYNYQDL
Sbjct  57   LSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDL  116

Query  347  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  526
            VFAPYG RWR+LRKI+SVHLFSAKAL+DF HVRQEEV TLTR L   G  PV LGQL+N+
Sbjct  117  VFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNM  176

Query  527  CTTNALARVMLGRKVF  574
            C  NAL R M+GR++F
Sbjct  177  CVVNALGREMIGRRLF  192



>gb|AIB06740.1| flavanone 3'-hydroxylase [Mangifera indica]
Length=515

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 4/192 (2%)
 Frame = +2

Query  20   IFCTLVFAIFLYFL--ILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYG  193
            I  +L+F + +YFL  I     R  L LPPGPKP P++GNLPH+G  PH S+AA+A  YG
Sbjct  5    ILVSLLFGVLIYFLFNIRSFFNRKSLRLPPGPKPRPIIGNLPHMGPMPHHSLAALARTYG  64

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+MHLRLGFVDV+VAASA+VAAQFLKVHD+NFS+RPPNSGA++IAYNYQDLVF PYG +W
Sbjct  65   PIMHLRLGFVDVIVAASASVAAQFLKVHDANFSSRPPNSGAKYIAYNYQDLVFRPYGAKW  124

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAG--KTPVKLGQLLNVCTTNALA  547
            R+LRKITSVHLFS KALDD+  VRQ EVA LTR+LASAG     V L QLLNVCT NAL+
Sbjct  125  RLLRKITSVHLFSGKALDDYRLVRQGEVAVLTRALASAGLKSELVNLAQLLNVCTVNALS  184

Query  548  RVMLGRKVFNDG  583
            RVMLGR+VF DG
Sbjct  185  RVMLGRRVFGDG  196



>ref|XP_004515962.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cicer arietinum]
Length=507

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GN+PHLG  PH S+AA+A+ YGPLMHL+LGFVDV+VAASA+VA QFLKVHD+NFS+RPPN
Sbjct  42   GNIPHLGPVPHHSLAALAKTYGPLMHLKLGFVDVIVAASASVAEQFLKVHDANFSSRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            +GA+++AYNYQDLVFA YGPRWR+LRK++S+HLFS K+LD+F H+RQEEV+ LTR LA +
Sbjct  102  AGAKYMAYNYQDLVFASYGPRWRLLRKLSSIHLFSNKSLDEFKHMRQEEVSRLTRYLADS  161

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
                V LG LLNVCTTNAL+RVM+G++VFNDG
Sbjct  162  DPKSVNLGPLLNVCTTNALSRVMIGKRVFNDG  193



>gb|AGY55961.1| flavonoid 3'-hydroxylase, partial [Punica granatum]
Length=332

 Score =   215 bits (547),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +2

Query  260  QFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCH  439
            QFLK+HD+NFS+RPPNSGA+HIAYNYQDLVFAPYGPRWRMLRKI+SVHLFSAKALDDF H
Sbjct  14   QFLKIHDANFSSRPPNSGAKHIAYNYQDLVFAPYGPRWRMLRKISSVHLFSAKALDDFRH  73

Query  440  VRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
            VRQEEVA LTR+LASAGKTPVKLGQLLNVCTTNALARVMLGR+VF DGG 
Sbjct  74   VRQEEVAILTRALASAGKTPVKLGQLLNVCTTNALARVMLGRRVFGDGGD  123



>gb|AJD25178.1| cytochrome P450 CYP75B80 [Salvia miltiorrhiza]
Length=514

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 145/190 (76%), Gaps = 5/190 (3%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            AT +LI CT +  +  Y    + ++  P P P         GNLP LG KPHQS+AA+A 
Sbjct  3    ATASLIICTSILGLLFYLFFQKRRRLPPGPRPWPIV-----GNLPQLGAKPHQSMAALAR  57

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             +GPL+HL++GFV VVVAASA VA QFL+VHD+NF +RPPN+GAEH+AYNYQDLVFAPYG
Sbjct  58   VHGPLLHLKMGFVHVVVAASAGVAEQFLRVHDTNFLSRPPNAGAEHVAYNYQDLVFAPYG  117

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNAL  544
            PRWR+LRKI ++HLFSAKALDDF HVR+EEV  + R+LA AG  PV++ + ++VC TNA+
Sbjct  118  PRWRLLRKICALHLFSAKALDDFRHVREEEVGIIVRTLADAGHKPVRISETVHVCATNAI  177

Query  545  ARVMLGRKVF  574
            ARVMLGR+V 
Sbjct  178  ARVMLGRRVL  187



>gb|AEE60888.1| flavonoid 3'-hydroxylase [Fragaria chiloensis]
Length=512

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTANALGRVMVGR  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>gb|AES69199.2| flavonoid hydroxylase [Medicago truncatula]
Length=516

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTT  535
            GPRWR+LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTT
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTT  180

Query  536  NALARVMLGRKVFNDG  583
            NALAR ++GR+VFN+G
Sbjct  181  NALARAVIGRRVFNEG  196



>gb|AGO03825.1| flavonoid 3`5`-hydroxylase [Cichorium intybus]
Length=514

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 160/194 (82%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ L L     + A+ ++ L L +  R+   LPPGP PWP++GNLPHLG+ PH+S+AA+A
Sbjct  1    MSLLILFIYACITAVVVHAL-LNLCTRHANRLPPGPTPWPIVGNLPHLGQSPHRSLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
             +YGPL+HLRLGF+DVVVAASA+VAAQFLK HD+NF++RPPNSGA+HIAYNY D+VF PY
Sbjct  60   TKYGPLIHLRLGFIDVVVAASASVAAQFLKAHDANFASRPPNSGAKHIAYNYNDMVFEPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRK+  VHLFS KAL+DF H+RQEEVA LTR+L  AG++ V+L +LLN+C +NA
Sbjct  120  GPRWRMLRKLCLVHLFSNKALNDFRHIRQEEVAILTRALGGAGQSIVQLDKLLNLCISNA  179

Query  542  LARVMLGRKVFNDG  583
            L+RVMLG++VF DG
Sbjct  180  LSRVMLGKRVFGDG  193



>dbj|BAL63027.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=510

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 151/191 (79%), Gaps = 0/191 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            L  +   LV  +   FL     QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++
Sbjct  3    LIAVITLLVALVLFRFLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKH  62

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GPLMHLRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPR
Sbjct  63   GPLMHLRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPR  122

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WR  RKI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL R
Sbjct  123  WRQFRKISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGR  182

Query  551  VMLGRKVFNDG  583
            VM+GR+VF DG
Sbjct  183  VMVGRRVFGDG  193



>ref|NP_001274347.1| uncharacterized protein LOC101314754 [Fragaria vesca]
 gb|AEE60884.1| flavonoid 3'-hydroxylase [Fragaria vesca]
 gb|AGT28740.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>gb|AEE60883.1| flavonoid 3'-hydroxylase [Fragaria vesca]
Length=512

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKPQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>gb|AEE60887.1| flavonoid 3'-hydroxylase [Fragaria virginiana]
Length=512

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>gb|ABB43031.1| flavonoid 3'5'-hydroxylase [Osteospermum hybrid cultivar]
Length=508

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 155/194 (80%), Gaps = 0/194 (0%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            MA +  +       + +++++L ++ R+P  LPPGP PWP++GNLPHLG  PH ++AA A
Sbjct  1    MAIIMTLLMDTCITVLVFYVLLNLRTRHPNRLPPGPTPWPIVGNLPHLGPLPHHTLAAFA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL+HLR GFVDVVVA+S  VA+QFL+ +D NF++RPPNSGA+H+AYNYQDLVFAPY
Sbjct  61   KKYGPLIHLRFGFVDVVVASSPTVASQFLRDNDLNFASRPPNSGAKHMAYNYQDLVFAPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRW MLRKI   HLFS+KALD+F HVR+EEVA LTR LASAG++ VKL QLLNVCT N 
Sbjct  121  GPRWTMLRKICKDHLFSSKALDNFRHVREEEVAILTRILASAGESTVKLSQLLNVCTANT  180

Query  542  LARVMLGRKVFNDG  583
            LAR+ML  ++F DG
Sbjct  181  LARMMLDMRLFGDG  194



>gb|AEE60886.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGR  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>gb|AGT28741.1| flavonoid 3'-hydroxylase [Fragaria x ananassa]
Length=513

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A ++GPLMH
Sbjct  8    TLLVALVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGVFPHHSLADLARKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LR G+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PYGPRWR  R
Sbjct  68   LRFGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYGPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+GR
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKAVNLAQLLNLCTVNALGRVMVGR  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>gb|AEE60885.1| flavonoid 3'-hydroxylase, partial [Fragaria x ananassa]
Length=511

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVK-QRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMH  205
            TL+ A+ L+ L+   K QR  LPLPPGPKPWPV+GNLPHLG  PH S+A +A+++GPLMH
Sbjct  8    TLLVAVVLFRLLFSGKSQRRSLPLPPGPKPWPVVGNLPHLGPFPHHSLAELAQKHGPLMH  67

Query  206  LRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLR  385
            LRLG+VDVVVAASA+VA+QFLK HD+NFS+RPPNSGA+++AYNYQDLVF PY PRWR  R
Sbjct  68   LRLGYVDVVVAASASVASQFLKTHDANFSSRPPNSGAKYMAYNYQDLVFRPYSPRWRQFR  127

Query  386  KITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGR  565
            KI+SVHLFS KALDD  HVRQEEVA L  +LA+AG   V L QLLN+CT NAL RVM+G+
Sbjct  128  KISSVHLFSGKALDDLKHVRQEEVAVLAHALANAGSKVVNLAQLLNLCTVNALGRVMVGQ  187

Query  566  KVFNDG  583
            +VF DG
Sbjct  188  RVFGDG  193



>ref|XP_003598948.1| Flavonoid 3'-hydroxylase [Medicago truncatula]
Length=597

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 158/196 (81%), Gaps = 2/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   + F + + +I +Y L+    +   LPLPPGPKPWP++GNLPHLG  PHQS+A +A
Sbjct  1    MSLWLIAFSSCILSILIYRLVKFATRTSSLPLPPGPKPWPIIGNLPHLGPAPHQSLATLA  60

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            E YGPLMHL+LG VDV+VAASA+VA QFLKVHD+NFS+RPPN+GA++I YNYQDLVF PY
Sbjct  61   ETYGPLMHLKLGSVDVIVAASASVAEQFLKVHDANFSSRPPNAGAKYIGYNYQDLVFGPY  120

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS--AGKTPVKLGQLLNVCTT  535
            GPRWR+LRKIT+VHLFS ++LD+F H+RQEEV  L  +LAS  +    V LGQLLNVCTT
Sbjct  121  GPRWRLLRKITTVHLFSNQSLDEFKHLRQEEVTRLVNNLASNHSNSKVVNLGQLLNVCTT  180

Query  536  NALARVMLGRKVFNDG  583
            NALAR ++GR+VFN+G
Sbjct  181  NALARAVIGRRVFNEG  196



>ref|XP_006287545.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
 gb|EOA20443.1| hypothetical protein CARUB_v10000754mg [Capsella rubella]
Length=509

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 150/188 (80%), Gaps = 0/188 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            +T +F T+V A  L+ L+     R    LPPGP PWP++GNLPH+G KPHQ++AAM   Y
Sbjct  1    MTPLFLTIVLATVLFCLLFLFSLRRNHRLPPGPNPWPIVGNLPHMGTKPHQTLAAMVTTY  60

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GP++HLRLGFVDVVVAAS +VA QFLK HD+NF++RPPNSGA+H+AYNYQDLVFAPYG R
Sbjct  61   GPILHLRLGFVDVVVAASKSVAEQFLKTHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR  120

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WRMLRKI+SVHLFSAKAL+DF H+RQEEV TL+  LA  G   V LGQL+N+C  N+L R
Sbjct  121  WRMLRKISSVHLFSAKALEDFKHIRQEEVGTLSGELARVGTKAVNLGQLVNMCVINSLGR  180

Query  551  VMLGRKVF  574
             M+GR++F
Sbjct  181  EMIGRRLF  188



>gb|ABB43030.1| flavonoid 3'5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 155/198 (78%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A
Sbjct  1    MSILTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLA  58

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPY
Sbjct  59   KKYGPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPY  118

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRK+ S+HLFSAKAL DF  VRQEEV  LTR LA  G++ VKL Q LNVC  N 
Sbjct  119  GPRWRMLRKMCSMHLFSAKALTDFRQVRQEEVTILTRVLARTGQSAVKLDQQLNVCFANT  178

Query  542  LARVMLGRKVFNDGGSKS  595
            L+R+ML R+VF DG  K+
Sbjct  179  LSRMMLDRRVFGDGDPKA  196



>ref|XP_010030575.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
 gb|KCW83703.1| hypothetical protein EUGRSUZ_B00578 [Eucalyptus grandis]
Length=514

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 151/194 (78%), Gaps = 1/194 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M   +LI  T+  ++ LY L L    R   PLPPGPKPWP++GNLPHLG  PHQS+AA+A
Sbjct  1    MTPSSLILATIAISVILYSL-LSYLARPARPLPPGPKPWPLVGNLPHLGPMPHQSMAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPL+HLRLG VDVVVA+SA+VA+QFLK H++NF +RPP+S A+H++YNYQDLV  PY
Sbjct  60   RAYGPLLHLRLGLVDVVVASSASVASQFLKTHEANFLSRPPHSAAKHLSYNYQDLVSLPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRKI+S+HLFS KALDD+ HVR EEV  LT +LA    TP KL QLLNVCT N 
Sbjct  120  GPRWRMLRKISSIHLFSGKALDDYRHVRHEEVVVLTHALAHVSSTPKKLAQLLNVCTANV  179

Query  542  LARVMLGRKVFNDG  583
            L RVMLG++VF DG
Sbjct  180  LGRVMLGKRVFGDG  193



>emb|CDP16533.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   211 bits (536),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 114/141 (81%), Positives = 126/141 (89%), Gaps = 1/141 (1%)
 Frame = +2

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            MA+ YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+H+AYNYQDLVFA
Sbjct  1    MAKTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHMAYNYQDLVFA  60

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRS-LASAGKTPVKLGQLLNVCT  532
            PYGPRWR+LRKI SVHLFSAKALDDF  VR+EEVA LTR+ LAS GK  V LGQLLNVCT
Sbjct  61   PYGPRWRLLRKICSVHLFSAKALDDFHLVREEEVAILTRTLLASVGKDSVNLGQLLNVCT  120

Query  533  TNALARVMLGRKVFNDGGSKS  595
            TNAL RVMLGR+VF+DG  K+
Sbjct  121  TNALGRVMLGRRVFSDGDPKA  141



>gb|AAX19888.1| flavonoid-3',5'-hydroxylase [Pericallis cruenta]
Length=504

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 154/198 (78%), Gaps = 2/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+ LTLI CT +  +  Y L+  +  R    LPPGP PWP++GNL HLGK PH S+A +A
Sbjct  1    MSILTLI-CTFITGLMFYGLV-NLLSRRASRLPPGPTPWPIIGNLMHLGKLPHHSLADLA  58

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            ++YGPL+H+RLG VDVVVA+SA+VA QFLKVHD+NF+NRPPNSGA+H+AYNY D+VFAPY
Sbjct  59   KKYGPLIHVRLGSVDVVVASSASVAGQFLKVHDANFANRPPNSGAKHMAYNYHDMVFAPY  118

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWRMLRK+ S+HLFSAKAL DF  VRQEEV  LTR LA   ++ VKL Q LNVC  N 
Sbjct  119  GPRWRMLRKMCSMHLFSAKALADFRQVRQEEVMILTRVLAGTEQSAVKLDQQLNVCFANT  178

Query  542  LARVMLGRKVFNDGGSKS  595
            L+R+ML R+VF DG  K+
Sbjct  179  LSRMMLDRRVFGDGDPKA  196



>gb|AGO03826.1| flavonoid 3`5`-hydroxylase [Billardiera heterophylla]
Length=521

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 155/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  5    ATLTLIFCTLVFAIFLYFLILRVK---QRYplplppgpkpwpvlGNLPHLGKKPHQSIAA  175
             TL  I C  + A+   + IL ++    R+P  LPPGP+PWP++GNLPHLG KPH SIAA
Sbjct  3    TTLEFILCFTITALPFLYCILNMRILLNRHPRSLPPGPRPWPIVGNLPHLGTKPHHSIAA  62

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            MA +YGPL+HLR+G V VVVAASA VAAQFLK +D+NFS+RPPNSGA+H+AYNY D+VFA
Sbjct  63   MARKYGPLLHLRMGIVHVVVAASADVAAQFLK-NDANFSSRPPNSGAKHMAYNYHDMVFA  121

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWRMLRKI ++H+FSAKALDDF  VR+EEVA L R+LA AG+ PV LGQL + C  
Sbjct  122  PYGPRWRMLRKICALHIFSAKALDDFHRVREEEVAILARTLAHAGQKPVNLGQLFSTCNA  181

Query  536  NALARVMLGRKVFN  577
            NAL+ +MLGR++F+
Sbjct  182  NALSVLMLGRRLFS  195



>gb|AGT50310.1| flavonoid 3'-hydroxylase, partial [Meconopsis simplicifolia]
Length=468

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHL S KALD+F HVR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLLSGKALDEFRHVREEEVAVLTKALAQS  122

Query  488  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             K    +PV L  LLNVCTTNALARV+LG +V  DG
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDG  158



>gb|AGT50309.1| flavonoid 3'-hydroxylase, partial [Meconopsis delavayi]
Length=476

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  488  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             K    +PV L  LLNVCTTNALARV+LG +V  DG
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDG  158



>gb|AGT50311.1| flavonoid 3'-hydroxylase, partial [Meconopsis horridula]
Length=484

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  488  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             K    +PV L  LLNVCTTNALARV+LG +V  DG
Sbjct  131  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDG  166



>gb|AAG49299.1|AF313489_1 flavonoid 3',5'-hydroxylase [Callistephus chinensis]
Length=510

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 1/157 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH ++AA+A +YGPL++LRLGFV VVVA+S +VAAQFLKVHD  F++RPPN
Sbjct  43   GNLPHLGAIPHHTLAALATKYGPLVYLRLGFVHVVVASSPSVAAQFLKVHDLKFASRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQD+VFAPYGP+W M RKI   HLFS+KALDDF HVRQEEVA L R LA A
Sbjct  103  SGAKHIAYNYQDMVFAPYGPQWTMFRKICKDHLFSSKALDDFRHVRQEEVAILARGLAGA  162

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVF-NDGGSKS  595
            G++ V LGQ LN+CT N LAR+ML ++VF N+ G   
Sbjct  163  GRSKVNLGQQLNMCTANTLARMMLDKRVFGNESGGDD  199



>ref|XP_010522799.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X6 [Tarenaya 
hassleriana]
Length=391

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  322
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  323  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  502
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  503  KLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             L QL+NVC  NAL RVM+GR++F  G  
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLFGVGAD  149



>gb|AGT50313.1| flavonoid 3'-hydroxylase, partial [Meconopsis lancifolia]
Length=476

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  3    GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  62

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYN+QDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA +
Sbjct  63   SGAKHIAYNHQDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQS  122

Query  488  GK----TPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             K    +PV L  LLNVCTTNALARV+LG +V  DG
Sbjct  123  NKNSKGSPVNLADLLNVCTTNALARVLLGTRVCGDG  158



>ref|XP_010522791.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X5 [Tarenaya 
hassleriana]
Length=469

 Score =   206 bits (524),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  322
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  323  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  502
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  503  KLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             L QL+NVC  NAL RVM+GR++F  G  
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLFGVGAD  149



>gb|AGT50318.1| flavonoid 3'-hydroxylase, partial [Meconopsis punicea]
Length=485

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 129/157 (82%), Gaps = 5/157 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG   HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPN
Sbjct  11   GNLPQLGMAVHQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPN  70

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+HIAYNYQDLVFAPYG RWRM RKI ++HLFS KALD+F +VR+EEVA LT++LA +
Sbjct  71   SGAKHIAYNYQDLVFAPYGRRWRMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQS  130

Query  488  GK-----TPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
             K     +PV L  LLNVCTTNALARV+LG +V  DG
Sbjct  131  NKNSKAGSPVNLADLLNVCTTNALARVLLGTRVCGDG  167



>ref|XP_010522758.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010522767.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X3 [Tarenaya 
hassleriana]
Length=489

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  322
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  323  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  502
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  503  KLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             L QL+NVC  NAL RVM+GR++F  G  
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLFGVGAD  149



>ref|XP_010522775.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010522783.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X4 [Tarenaya 
hassleriana]
Length=488

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  322
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  323  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  502
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  503  KLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             L QL+NVC  NAL RVM+GR++F  G  
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLFGVGAD  149



>dbj|BAB87839.1| flavonoid 3'-hydroxalase [Torenia hybrid cultivar]
Length=457

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 117/139 (84%), Gaps = 1/139 (1%)
 Frame = +2

Query  176  MAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFA  355
            MA+ YGPLMHL+ G  D VVA+SA+VA QFLK HD NFSNRPPNSGA+HIAYNYQDLVFA
Sbjct  1    MAKTYGPLMHLKFGLKDAVVASSASVAEQFLKKHDVNFSNRPPNSGAKHIAYNYQDLVFA  60

Query  356  PYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTT  535
            PYGPRWR+LRKI SVHLFS+KALDDF HVR EE+  L R++AS G  PV LG+LL VCTT
Sbjct  61   PYGPRWRLLRKICSVHLFSSKALDDFQHVRHEEICILIRAIASGGHAPVNLGKLLGVCTT  120

Query  536  NALARVMLGRKVFN-DGGS  589
            NALARVMLGR+VF  DGG 
Sbjct  121  NALARVMLGRRVFEGDGGE  139



>ref|XP_010105825.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|AHB19304.1| flavonoid 3'-hydroxylase, partial [Morus alba]
 gb|EXC06424.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=517

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 145/201 (72%), Gaps = 3/201 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwp---vlGNLPHLGKKPHQSIA  172
            M ++  I  +++ A+ L+ L  +++ R  +P    P       ++GNLP LG  PHQ+IA
Sbjct  1    MPSIFTILGSILLAVLLFCLFNQLRSRRSVPGRRLPPGPRPWPIIGNLPQLGPAPHQTIA  60

Query  173  AMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVF  352
            A+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+H+ YNY DLV 
Sbjct  61   ALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAKHVGYNYHDLVL  120

Query  353  APYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCT  532
            APYGPRWR++RKI SVHL S KAL+DF +VRQEE A L R LA+AG T + L QLL++CT
Sbjct  121  APYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTAINLAQLLHLCT  180

Query  533  TNALARVMLGRKVFNDGGSKS  595
            TN L R MLG +VF DG  KS
Sbjct  181  TNTLGRAMLGYRVFGDGSGKS  201



>ref|XP_010522750.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X2 [Tarenaya 
hassleriana]
Length=565

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  322
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  323  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  502
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  503  KLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             L QL+NVC  NAL RVM+GR++F  G  
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLFGVGAD  149



>ref|XP_010522740.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Tarenaya 
hassleriana]
Length=589

 Score =   205 bits (522),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +2

Query  143  LGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEH  322
            +G KPH+++  M   YGPL+HLRLGFVDVVVA+S AVA QFL+VHDSNF++RPPNSGA+H
Sbjct  1    MGPKPHRNLTTMVATYGPLLHLRLGFVDVVVASSKAVAEQFLRVHDSNFASRPPNSGAKH  60

Query  323  IAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPV  502
            IAYNYQDLVFAPYG RWRMLRKI+SVHLFSAKAL+D  HVRQEEV   TR LA A   PV
Sbjct  61   IAYNYQDLVFAPYGQRWRMLRKISSVHLFSAKALEDSRHVRQEEVGAFTRELARAKTNPV  120

Query  503  KLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             L QL+NVC  NAL RVM+GR++F  G  
Sbjct  121  NLSQLVNVCVVNALGRVMIGRRLFGVGAD  149



>ref|XP_002514665.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47771.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=461

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +2

Query  167  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  346
            +AA+A+ YGPLMHLR+GFVDV+VAASA+VAAQFLK HD NFS+RP N+GA+++AYN+QDL
Sbjct  1    MAALAQVYGPLMHLRMGFVDVIVAASASVAAQFLKTHDVNFSSRPTNAGAKYVAYNHQDL  60

Query  347  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  526
            VFAPYGPRWR+LRKI+SVHLFSAKALDDF HVR++EV  LT +LA A +TP+ LG+LLN 
Sbjct  61   VFAPYGPRWRLLRKISSVHLFSAKALDDFRHVREQEVGILTHALADACETPINLGRLLNT  120

Query  527  CTTNALARVMLGRKVFNDG  583
            CTTNAL RVM+GR+VF DG
Sbjct  121  CTTNALGRVMIGRRVFGDG  139



>ref|XP_003525447.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=513

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 154/197 (78%), Gaps = 1/197 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            M+T  + F T++ A+ +Y ++  + +    LPLPPGP+PWP++GNLPH+G  PHQ +A +
Sbjct  1    MSTWVIGFATIIAAVLIYRVLKPISRPSSSLPLPPGPRPWPIVGNLPHMGPAPHQGLANL  60

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            A+ +GPLMHLRLGFVDVVVAASA+VA QFLK+HD+NF +RP N    ++AYN QDLVFAP
Sbjct  61   AQTHGPLMHLRLGFVDVVVAASASVAEQFLKIHDANFCSRPLNFRTTYLAYNKQDLVFAP  120

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTN  538
            YGP+WR LRK+T+VH+FSAKA+DDF  +RQEEVA LT  LA +    V L QLLNVCTTN
Sbjct  121  YGPKWRFLRKLTTVHMFSAKAMDDFSQLRQEEVARLTCKLARSSSKAVNLRQLLNVCTTN  180

Query  539  ALARVMLGRKVFNDGGS  589
            AL R+M+GR++FND  S
Sbjct  181  ALTRIMIGRRIFNDDSS  197



>gb|KHN18348.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=519

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 152/193 (79%), Gaps = 0/193 (0%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERY  190
            L +   T+V AI  Y L+  + +R  L LPPGP+PWPV+GNLPH+G   H+++A +A  Y
Sbjct  5    LIIGLATIVAAILSYRLLKLIIRRPSLHLPPGPRPWPVVGNLPHIGPLLHRALAVLARTY  64

Query  191  GPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPR  370
            GPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP NS   ++ YN +DL FAPYGPR
Sbjct  65   GPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLNSMTTYMTYNQKDLAFAPYGPR  124

Query  371  WRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALAR  550
            WR LRKI+SVH+FS KALDDF  +RQEEV  LT +LAS+G T V LGQL+NVCTTN LAR
Sbjct  125  WRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASSGSTAVNLGQLVNVCTTNTLAR  184

Query  551  VMLGRKVFNDGGS  589
            VM+GR++FND  S
Sbjct  185  VMIGRRLFNDSRS  197



>dbj|BAE72874.1| flavonoid 3'-hydroxylase [Verbena x hybrida]
Length=465

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  167  IAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDL  346
            +AA++  YGPLMHL++GFV VVVAASA  A QFLKV+D+NFSNRPPN+GA+++AYNYQDL
Sbjct  1    MAALSRVYGPLMHLKMGFVHVVVAASAGAAEQFLKVNDANFSNRPPNAGAKYVAYNYQDL  60

Query  347  VFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNV  526
            VFAPYGPRWR+LRKI ++HLFSAKAL+DF  VRQEEV  LTR+LASAG+TP  LGQ+LNV
Sbjct  61   VFAPYGPRWRLLRKICALHLFSAKALEDFRTVRQEEVGILTRALASAGQTPASLGQMLNV  120

Query  527  CTTNALARVMLGRKV  571
            C TNA+ARVMLGR+V
Sbjct  121  CATNAIARVMLGRRV  135



>gb|AHL83556.1| flavonoid-3'-hydroxylase [Iris x hollandica]
Length=514

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPHQ++AAM++ YGPL  LR G VDVVVAAS+ VAAQFL+ +D+NFSNRPPN
Sbjct  46   GNLPQLGTKPHQTLAAMSKLYGPLFRLRFGSVDVVVAASSTVAAQFLRTYDANFSNRPPN  105

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSL---  478
            SGAEH+AYNYQDLVFAPYGPRWRMLRK+ ++HLFS KALDD   VRQ EVA L  +L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRMLRKLCALHLFSLKALDDLRLVRQGEVAALAANLHRH  165

Query  479  ASAGKTPVKLGQLLNVCTTNALARVMLGRKVFND  580
            A+ G  PV LG+ LNVC TNALAR MLGRKVF +
Sbjct  166  AANGHPPVNLGRALNVCATNALARAMLGRKVFTE  199



>ref|XP_003550701.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=526

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 127/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G   H+++A +A  YGPLM+LRLGFVDVVVAASA+VA QFLKVHD+NFS+RP N
Sbjct  51   GNLPHIGPLLHRALAVLARTYGPLMYLRLGFVDVVVAASASVAEQFLKVHDANFSSRPLN  110

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            S   ++ YN +DL FAPYGPRWR LRKI+SVH+FS KALDDF  +RQEEV  LT +LAS+
Sbjct  111  SMTTYMTYNQKDLAFAPYGPRWRFLRKISSVHMFSVKALDDFRQLRQEEVERLTSNLASS  170

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
            G T V LGQL+NVCTTN LARVM+GR++FND  S
Sbjct  171  GSTAVNLGQLVNVCTTNTLARVMIGRRLFNDSRS  204



>dbj|BAB87838.1| flavonoid 3'-hydroxylase [Torenia hybrid cultivar]
Length=512

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG KPH S+A +A  YGPLMHL++GFV VVVA+SA+ A Q L+VHD+NF +RPPN
Sbjct  45   GNLPHLGPKPHASMAELARAYGPLMHLKMGFVHVVVASSASAAEQCLRVHDANFLSRPPN  104

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGA+H+AYNY+DLVF PYGP+WR+LRKI + H+FS KA+DDF  VR+EEVA L+R+L  A
Sbjct  105  SGAKHVAYNYEDLVFRPYGPKWRLLRKICAQHIFSVKAMDDFRRVREEEVAILSRAL--A  162

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKV  571
            GK  V +GQ+LNVC TNAL+RVM+GR+V
Sbjct  163  GKRAVPIGQMLNVCATNALSRVMMGRRV  190



>ref|XP_003525448.1| PREDICTED: flavonoid 3'-monooxygenase-like isoform X1 [Glycine 
max]
Length=512

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 152/196 (78%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   QTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR LRK+++VH+FSAKA+DDF  +RQEEV  LT +LA +    V L QLLNVCTTN 
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARSSSKVVNLRQLLNVCTTNI  179

Query  542  LARVMLGRKVFNDGGS  589
            LAR+M+GR++F+D  S
Sbjct  180  LARIMIGRRIFSDNSS  195



>gb|KHN48735.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=512

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 152/196 (78%), Gaps = 1/196 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   + F T+V A  +Y L  ++     LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSAWVIAFATVVAATLIYRL-FKLITVPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + +GPLMHLRLGFVDVVVA+SA+VA QFLK+HD+NF +RP NS   ++ YN QDLVFAPY
Sbjct  60   KTHGPLMHLRLGFVDVVVASSASVAEQFLKIHDANFCSRPCNSRTTYLTYNQQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR LRK+++VH+FSAKA+DDF  +RQEEV  LT +LA +    V L QLLNVCTTN 
Sbjct  120  GPRWRFLRKLSTVHMFSAKAMDDFRELRQEEVERLTCNLARSSSKVVNLRQLLNVCTTNI  179

Query  542  LARVMLGRKVFNDGGS  589
            LAR+M+GR++F+D  S
Sbjct  180  LARIMIGRRIFSDNSS  195



>ref|XP_010030579.1| PREDICTED: flavonoid 3'-monooxygenase-like [Eucalyptus grandis]
Length=514

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 144/198 (73%), Gaps = 1/198 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M  L+ I   +  +IFL  L L    R    LPPGPKPWP++GNLPHLG  PH+S+AA+A
Sbjct  1    MMPLSFILAAIAISIFLRSL-LGYLTRPTRALPPGPKPWPLVGNLPHLGPMPHRSMAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
              YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN+Q +   PY
Sbjct  60   RSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYNHQGIGAVPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            G RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L QLLNVCT NA
Sbjct  120  GSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQLLNVCTANA  179

Query  542  LARVMLGRKVFNDGGSKS  595
            L RVMLG++V  +G  + 
Sbjct  180  LGRVMLGKRVLGEGKGRD  197



>gb|AFK73718.1| cytochrome P450 [Papaver somniferum]
Length=475

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 123/146 (84%), Gaps = 4/146 (3%)
 Frame = +2

Query  158  HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNY  337
            HQS+AAM + YGP+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNY
Sbjct  4    HQSLAAMVKTYGPIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNY  63

Query  338  QDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVK  505
            QDLVFAPYG RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV 
Sbjct  64   QDLVFAPYGRRWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAKSNKNGQGSPVN  123

Query  506  LGQLLNVCTTNALARVMLGRKVFNDG  583
            L  LLNVCTTNALARV+LG +V  DG
Sbjct  124  LADLLNVCTTNALARVLLGTRVCGDG  149



>dbj|BAM28972.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             + PV LG+ LNVC TNAL+R  +G +VF   G 
Sbjct  163  SR-PVNLGETLNVCATNALSRATIGWRVFVGKGE  195



>dbj|BAM28971.1| flavonoid 3'-hydroxylase [Lilium hybrid division I]
Length=514

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG KPHQ++ A+++ +GPL  LRLG  +V+VAASA +A++FL+ HD+NFSNRPPN
Sbjct  43   GNLPHLGPKPHQTMHALSKLHGPLFRLRLGSAEVIVAASAPIASEFLRTHDTNFSNRPPN  102

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA +
Sbjct  103  SGAEHIAYNYNDLVFAPYGPRWRTLRKLCALHLFSQKALEDLCYVREQEVAILARDLAGS  162

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDGGS  589
             + PV LG+ LNVC TNAL+R  +G +VF   G 
Sbjct  163  CR-PVNLGETLNVCATNALSRATIGWRVFVGKGE  195



>ref|XP_006665050.1| PREDICTED: flavonoid 3'-monooxygenase-like [Oryza brachyantha]
Length=522

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 123/159 (77%), Gaps = 3/159 (2%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPHQ++ A+A  YGPL  LR G  +VVVAASA VAAQFL+VHD+NFSNRPPN
Sbjct  46   GNLPQLGDKPHQTMCALAREYGPLFRLRFGCAEVVVAASADVAAQFLRVHDANFSNRPPN  105

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  481
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKAL+D   VR+ EVA + R+LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALEDLRAVREGEVALMVRNLARQ  165

Query  482  SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
            +A   PV LGQ  NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  AAATAPVVLGQEANVCATNTLARATIGRRVFAVDGGEGA  204



>ref|XP_009394321.1| PREDICTED: flavonoid 3'-monooxygenase [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 145/192 (76%), Gaps = 2/192 (1%)
 Frame = +2

Query  20   IFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPL  199
            +F   + ++ L+FL L  KQ    PLPPGP+ WP+LGNLP LG KPH+++ A+A+ +GPL
Sbjct  8    LFTLGLSSLILFFLHL--KQSRRKPLPPGPRGWPILGNLPQLGPKPHRTLHALAKVHGPL  65

Query  200  MHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRM  379
              LR G VDVVVAASAAVA+Q L+ HD+ F +RPPNSGAEH+AYNYQDLVFAPYGPRWRM
Sbjct  66   FRLRFGSVDVVVAASAAVASQLLRAHDAIFCDRPPNSGAEHVAYNYQDLVFAPYGPRWRM  125

Query  380  LRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVML  559
            LRK+ SVHLFSAKALDD   VRQ EV  L  +L + G  PV LG  +NVC TNALAR  +
Sbjct  126  LRKLCSVHLFSAKALDDLRWVRQGEVGLLVHALRACGDAPVNLGYAVNVCATNALARATM  185

Query  560  GRKVFNDGGSKS  595
            GR+VF + GS+ 
Sbjct  186  GRRVFEEDGSRE  197



>gb|AAS48419.1| flavonoid 3'-hydroxylase [Allium cepa]
Length=510

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPHQS+  ++  YGPL  LR G+VDVVVAASA VA QFL+VHD NFSNRPPN
Sbjct  42   GNLPQLGAKPHQSLCELSRTYGPLFGLRFGYVDVVVAASADVAEQFLRVHDVNFSNRPPN  101

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSL---  478
            SGAEHIAYNYQDLVFAPYGPRWRMLRK+ ++HLFS KAL+D   VR  EVATL  +L   
Sbjct  102  SGAEHIAYNYQDLVFAPYGPRWRMLRKLCALHLFSPKALEDLSPVRSLEVATLANTLYLR  161

Query  479  ASAGKTPVKLGQLLNVCTTNALARVMLGRKVF  574
            A + +  V L Q+L  CTTNAL++ M+GR+VF
Sbjct  162  AQSDQPTVNLAQMLTTCTTNALSKAMMGRRVF  193



>emb|CDP16353.1| unnamed protein product [Coffea canephora]
Length=151

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+TLTLIF + + A FL + IL+        LPPGPKPWP++GNLPHLG KPH S+AAMA
Sbjct  1    MSTLTLIFISSLLA-FLLYSILKKAGNPSKSLPPGPKPWPIVGNLPHLGTKPHHSLAAMA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + YGPLMHLRLGFV VVVAASA+VAAQFLK HD+NFS+RPPNSGA+HIAYNYQDLVFAPY
Sbjct  60   KTYGPLMHLRLGFVHVVVAASASVAAQFLKTHDANFSSRPPNSGAKHIAYNYQDLVFAPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEV  457
            GPRWR+LRKI S+HLFSAKALDDF  VRQ ++
Sbjct  120  GPRWRLLRKICSIHLFSAKALDDFHLVRQVKI  151



>gb|AHY35314.1| flavonoid 3'-hydroxylase 2 [Morus notabilis]
Length=490

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +2

Query  140  HLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAE  319
             LG  PHQ+IAA+A ++GPLMHLR G VDVV AASA+VAAQFLK HD+NF +RPP+S A+
Sbjct  23   QLGPAPHQTIAALARKHGPLMHLRFGLVDVVAAASASVAAQFLKAHDTNFLSRPPSSAAK  82

Query  320  HIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTP  499
            H+ Y+Y DLV APYGPRWR++RKI SVHL S KAL+DF +VRQEE A L R LA+AG T 
Sbjct  83   HVGYDYHDLVLAPYGPRWRLMRKIASVHLLSGKALEDFRYVRQEEAAVLIRGLANAGPTA  142

Query  500  VKLGQLLNVCTTNALARVMLGRKVFNDGGSKS  595
            + L QLL++CTTN L R MLG +VF  G  KS
Sbjct  143  INLAQLLHLCTTNTLGRAMLGYRVFGGGSGKS  174



>gb|AFW72123.1| red aleurone1 [Zea mays]
Length=515

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP +G KPH ++ AMA  YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGAKPHHTMCAMAREYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  105

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  481
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARQ  165

Query  482  -SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
               G+  V LGQ+ NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  GERGRAAVALGQVANVCATNTLARATVGRRVFAVDGGEGA  205



>gb|AFP95893.1| F3'H [Narcissus tazetta]
Length=528

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFL-YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA L +   TL F+ FL Y    R       P PPGPK WP+LGNL  LG KPHQ++ A+
Sbjct  20   MAPLLVFLSTLFFSSFLCYISFKRSINGRSPPRPPGPKGWPILGNLLQLGAKPHQTLCAL  79

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            +  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPNSGAEH+ YNYQDLVFAP
Sbjct  80   SRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPNSGAEHVVYNYQDLVFAP  139

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKT--PVKLGQLLNVCT  532
            YGPRWRMLRK+ ++HLFSAKALDDF  VR  EVA L  +L S  ++     LG+LL +CT
Sbjct  140  YGPRWRMLRKLCALHLFSAKALDDFRPVRAGEVAILANTLYSHAQSRREANLGELLTICT  199

Query  533  TNALARVMLGRKVFNDGGS  589
            TNAL++ +LG +VF + G+
Sbjct  200  TNALSKAVLGLRVFGEAGN  218



>ref|XP_008453263.1| PREDICTED: flavonoid 3'-monooxygenase [Cucumis melo]
Length=521

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 126/153 (82%), Gaps = 1/153 (1%)
 Frame = +2

Query  128  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  304
            GN+P +G  P H  +AAMA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGGAPLHSLLAAMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  305  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  484
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +RQ+E++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISAVHLFSSKALDDHRRIRQDEISVLVQALAR  162

Query  485  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            +G+ P  LG LL VC  N+L R M+GR+VF DG
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDG  195



>gb|AIC73642.1| flavonoid 3'-hydroxylase [Anthurium andraeanum]
Length=511

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPH ++AA++  YGPL+HLRLG V  VVA+SA+VAA FLK HD+NFS+RPPN
Sbjct  46   GNLPQLGAKPHHTLAALSRAYGPLLHLRLGRVHAVVASSASVAAAFLKTHDANFSSRPPN  105

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEH+AYNYQDLVFAPYGPRWR LRK+ SVHLF  +AL+ F HVR+EE   L R+L   
Sbjct  106  SGAEHVAYNYQDLVFAPYGPRWRTLRKLCSVHLFCTRALEGFRHVREEEAGVLARALLGR  165

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
              +   +G+ +NVC  NALAR ++GR+VF  G
Sbjct  166  RGSAADVGEEVNVCAANALARAVMGRRVFGGG  197



>ref|XP_004983036.1| PREDICTED: flavonoid 3'-monooxygenase-like [Setaria italica]
Length=515

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPH ++AAMA  +GPL  LR G  +VVVAASAAVAAQFL+ HD+NFSNRPPN
Sbjct  46   GNLPQLGAKPHHTMAAMAREHGPLFRLRFGSAEVVVAASAAVAAQFLRAHDANFSNRPPN  105

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSA+ALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSARALDDLRAVREGEVALMVRELARQ  165

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                V LGQ  NVC TN LAR  +GR+VF  DGG  +
Sbjct  166  RGPAVALGQAANVCATNTLARATVGRRVFAVDGGEGA  202



>gb|AGG40645.1| flavanone 3'-hydroxylase [Narcissus tazetta]
Length=529

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 140/199 (70%), Gaps = 3/199 (2%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFL-YFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAM  178
            MA L +   TL F+ FL Y    R       P PPGPK WP+LG+L  LG KPHQ++ A+
Sbjct  20   MAPLLVFLSTLFFSSFLCYISFKRSINGRSPPRPPGPKGWPILGSLLQLGAKPHQTLCAL  79

Query  179  AERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAP  358
            +  YGPL  LR G V+V+   SA VAAQFL+ HD+NFSNRPPNSGAEH+AYNYQDLVFAP
Sbjct  80   SRVYGPLFSLRFGSVNVIAVTSADVAAQFLRTHDANFSNRPPNSGAEHVAYNYQDLVFAP  139

Query  359  YGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKT--PVKLGQLLNVCT  532
            YGPRWRMLRK+ ++HLFS KALDD   VR  EVA L  +L +  +T     LG+LL +CT
Sbjct  140  YGPRWRMLRKLCALHLFSPKALDDLRPVRAGEVAILANTLYNHAQTHGEANLGELLTICT  199

Query  533  TNALARVMLGRKVFNDGGS  589
            TNAL++ MLG +VF + G+
Sbjct  200  TNALSKAMLGLRVFGEAGN  218



>ref|NP_001064338.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|AAM00948.1|AC021892_12 Putative flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
 gb|AAN04937.1| Putative chalcone flavonoid 3' - hydroxylase [Oryza sativa Japonica 
Group]
 gb|AAP52914.1| Flavonoid 3'-monooxygenase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26252.1| Os10g0320100 [Oryza sativa Japonica Group]
 gb|EAY78007.1| hypothetical protein OsI_33047 [Oryza sativa Indica Group]
 gb|EAZ15637.1| hypothetical protein OsJ_31048 [Oryza sativa Japonica Group]
 dbj|BAG89180.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AEK31169.1| flavonoid 3'-hydroxylase [Oryza sativa Japonica Group]
Length=526

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPH ++ A+A +YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  52   GNLPQLGDKPHHTMCALARQYGPLFRLRFGCAEVVVAASAPVAAQFLRGHDANFSNRPPN  111

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R+LA  
Sbjct  112  SGAEHVAYNYQDLVFAPYGARWRALRKLCALHLFSAKALDDLRAVREGEVALMVRNLARQ  171

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                V LGQ  NVC TN LAR  +G +VF  DGG  +
Sbjct  172  QAASVALGQEANVCATNTLARATIGHRVFAVDGGEGA  208



>ref|XP_004138192.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
 ref|XP_004154949.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=522

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +2

Query  128  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  304
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  305  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  484
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  485  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            +G+ P  LG LL VC  N+L R M+GR+VF DG
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDG  195



>gb|KGN63720.1| Flavonoid 3' hydroxylase [Cucumis sativus]
Length=488

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 125/153 (82%), Gaps = 1/153 (1%)
 Frame = +2

Query  128  GNLPHLGKKP-HQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPP  304
            GN+P +G+   H  +A MA +YGPLM+LRLG VD+VVAASAAVA Q LK+HD+NF +RPP
Sbjct  43   GNMPQIGEAHLHSLLATMAGKYGPLMYLRLGSVDMVVAASAAVAEQVLKIHDTNFLSRPP  102

Query  305  NSGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS  484
            N+GA++IAYNYQD+VFAPYGPRWR+LRKI++VHLFS+KALDD   +R+EE++ L ++LA 
Sbjct  103  NAGAKYIAYNYQDMVFAPYGPRWRLLRKISTVHLFSSKALDDHRRIREEEISVLVQALAR  162

Query  485  AGKTPVKLGQLLNVCTTNALARVMLGRKVFNDG  583
            +G+ P  LG LL VC  N+L R M+GR+VF DG
Sbjct  163  SGEAPANLGSLLTVCIANSLGRTMIGRRVFGDG  195



>gb|AGJ50589.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98427.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
 gb|AGL98428.1| flavonoid 3'-hydroxylase [Tulipa fosteriana]
Length=510

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG KPHQ++ A+++ +GPL  L+LG  +VVVAAS+ VAA+FL+ HD+NFSNRPPN
Sbjct  45   GNLPQLGTKPHQTMHALSKVHGPLFRLKLGSAEVVVAASSTVAAEFLRSHDANFSNRPPN  104

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SGAEHIAYNY DLVFAPYGPRWR LRK+ ++HLFS KAL+D  +VR++EV  L   LAS 
Sbjct  105  SGAEHIAYNYNDLVFAPYGPRWRALRKLCALHLFSQKALEDLRYVREQEVGILAGDLAST  164

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVF  574
             + PV LG+ LNVC TNAL+R  +G +VF
Sbjct  165  SR-PVNLGEALNVCATNALSRATVGWRVF  192



>dbj|BAH22519.1| flavonoid 3' hydroxylase [Tricyrtis hirta]
Length=505

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 134/189 (71%), Gaps = 6/189 (3%)
 Frame = +2

Query  29   TLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHL  208
            TLVFA  LY L+     R P      P      GNLP LG KPHQ++ A+++ +GPL  L
Sbjct  11   TLVFASLLYHLLSGPAHRLPPGPRGWPIL----GNLPQLGPKPHQTLHALSKAHGPLFLL  66

Query  209  RLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRK  388
            RLG VDVVVAASAAVAA FL+ HD+ FSNRPPNSGAEHIAYNYQDLVFAPYGPRWR LRK
Sbjct  67   RLGSVDVVVAASAAVAAAFLRQHDAIFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRHLRK  126

Query  389  ITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNALARVMLGRK  568
            + S+HLFS+KALDD   +R++E+  LTRSL      PV LG+ +NVC TNALAR  +G +
Sbjct  127  LCSLHLFSSKALDDLRPIREQEIQRLTRSLLVG--RPVNLGEAVNVCATNALARATVGWR  184

Query  569  VFNDGGSKS  595
            VF   G  +
Sbjct  185  VFVGEGEDT  193



>gb|KCW83706.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=465

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  155  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  334
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  335  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  514
            +Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  515  LLNVCTTNALARVMLGRKVFNDGGSKS  595
            LLNVCT NAL RVMLG++V  +G  + 
Sbjct  122  LLNVCTANALGRVMLGKRVLGEGKGRD  148



>gb|KCW83705.1| hypothetical protein EUGRSUZ_B00580 [Eucalyptus grandis]
Length=478

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  155  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  334
            PH+S+AA+A  YGPL+HLRLG VDVVVAAS ++A QFLK HD+NF +RPP S  +H+ YN
Sbjct  2    PHRSMAALARSYGPLLHLRLGLVDVVVAASGSMATQFLKTHDANFLSRPPRSAGKHLGYN  61

Query  335  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  514
            +Q +   PYG RWRMLRKI++VHLFS+KALDDF HVRQEEVA LT +LA  G   V L Q
Sbjct  62   HQGIGAVPYGSRWRMLRKISTVHLFSSKALDDFRHVRQEEVAILTCALAHVGSASVNLAQ  121

Query  515  LLNVCTTNALARVMLGRKVFNDGGSKS  595
            LLNVCT NAL RVMLG++V  +G  + 
Sbjct  122  LLNVCTANALGRVMLGKRVLGEGKGRD  148



>gb|AGT50323.1| flavonoid 3'-hydroxylase, partial [Meconopsis pseudohorridula]
Length=452

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA   K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQTNKNSKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LGR+V  DG
Sbjct  121  LARVLLGRRVCGDG  134



>gb|ABG54319.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP +G  PH ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  485  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>ref|XP_002439914.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
 gb|EES18344.1| hypothetical protein SORBIDRAFT_09g022480 [Sorghum bicolor]
Length=535

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG K HQ++  + + YGPL+ LR G  DVVVA SAAVA QFL+VHD+NFS RPPN
Sbjct  58   GNLPQLGGKTHQTLHELTKVYGPLLRLRFGSSDVVVAGSAAVAEQFLRVHDANFSCRPPN  117

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
            SG E +AYNYQD+VFAPYGPRWR +RK+ +V+LFSA+ALDD C VR+ E A + RSLA  
Sbjct  118  SGGELMAYNYQDVVFAPYGPRWRAMRKVCAVNLFSARALDDICDVREREAALMVRSLAEQ  177

Query  488  G----KTPVKLGQLLNVCTTNALARVMLGRKVF  574
                  TPV LG+ +NVCTTNAL+R  +GR+VF
Sbjct  178  AARDRNTPVALGKAVNVCTTNALSRAAVGRRVF  210



>ref|XP_008678758.1| PREDICTED: flavonoid 3'-monooxygenase-like [Zea mays]
 gb|AFW62811.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 145/204 (71%), Gaps = 9/204 (4%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA-----SAGK-TPVKLGQLLNV  526
             RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA       G+   V LGQ+ NV
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQVANV  184

Query  527  CTTNALARVMLGRKVFN-DGGSKS  595
            C TN LAR  +GR+VF  DGG  +
Sbjct  185  CATNTLARATVGRRVFAVDGGEGA  208



>ref|XP_002452380.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
 gb|EES05356.1| hypothetical protein SORBIDRAFT_04g024710 [Sorghum bicolor]
Length=517

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  485  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>gb|ABG54320.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   182 bits (463),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  485  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>dbj|BAM28973.1| flavonoid 3'-hydroxylase, partial [Lilium hybrid division I]
Length=453

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  155  PHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYN  334
            PHQ++ A+++ +GPL  LRLG  +V+VAASA++A++FL+ HD+NFSNRPPNSGAEHIAYN
Sbjct  1    PHQTMHALSKLHGPLFRLRLGSAEVIVAASASIASEFLRTHDTNFSNRPPNSGAEHIAYN  60

Query  335  YQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQ  514
            Y DLVFAPYGPRWR LRK+ ++HLFS KAL+D C+VR++EVA L R LA + + PV LG+
Sbjct  61   YNDLVFAPYGPRWRALRKLCALHLFSQKALEDLCYVREQEVALLARDLAGSSR-PVNLGE  119

Query  515  LLNVCTTNALARVMLGRKVFNDGGSK  592
             LNVC TNAL+R  +G +VF   G  
Sbjct  120  TLNVCATNALSRATIGWRVFVGKGED  145



>gb|AII26680.1| flavonoid 3'-hydroxylase [Indosasa hispida]
Length=521

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = +2

Query  35   VFAIFLYFLILRV-KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAERYGPLMHLR  211
            V AI  Y L  R  K R   PLPPGP+ WPVLGNLP LG K HQ++  M + YGPL+ LR
Sbjct  14   VSAIVCYVLFFRAGKARRRAPLPPGPRGWPVLGNLPQLGGKTHQTLHVMTKVYGPLLRLR  73

Query  212  LGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRWRMLRKI  391
             G  DVVVA SAAVA QFL++HD+ FSNRPPNSG EH+AYNYQD+VF PYGPRWR +RK+
Sbjct  74   FGSSDVVVAGSAAVAEQFLRIHDAKFSNRPPNSGGEHMAYNYQDVVFGPYGPRWRAMRKV  133

Query  392  TSVHLFSAKALDDFCHVRQEEVATLTRSLASA----GKTPVKLGQLLNVCTTNALARVML  559
             +V+LFSA+ALDD   VR+ E A + RSL  A    G   V LG+ +NVCTTNAL+R  +
Sbjct  134  CAVNLFSARALDDLRAVREREAALMVRSLVEASAPRGAPAVPLGKAVNVCTTNALSRAAV  193

Query  560  GRKVFNDG  583
            GR+VF  G
Sbjct  194  GRRVFAAG  201



>gb|AEF33624.1| flavonoid 3' hydroxylase [Zea mays]
Length=517

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRH  167

Query  485  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR   GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATAGRRVFAVDGGEEA  206



>gb|AGT50315.1| flavonoid 3'-hydroxylase, partial [Meconopsis betonicifolia]
Length=452

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>ref|XP_002454110.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
 gb|EES07086.1| hypothetical protein SORBIDRAFT_04g024750 [Sorghum bicolor]
Length=517

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 121/162 (75%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP +G  P+ ++ A+A+ YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPYHTMCALAKEYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            SGAEH+AYNYQDLVFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHVAYNYQDLVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARH  167

Query  485  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>gb|AGT50314.1| flavonoid 3'-hydroxylase, partial [Meconopsis henrici]
Length=445

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>gb|AGT50312.1| flavonoid 3'-hydroxylase, partial [Meconopsis racemosa]
Length=445

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>gb|ABG54321.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=515

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  46   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  105

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  481
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  106  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  165

Query  482  ---SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  166  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  204



>ref|XP_002452385.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
 gb|EES05361.1| hypothetical protein SORBIDRAFT_04g024730 [Sorghum bicolor]
Length=517

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP +G  PH ++ A+A+ YGPL  LR G  DVVVAASA VA QFL+ HD+NFSNRPPN
Sbjct  48   GNLPQVGSHPHHTMYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA--  481
            SGAEH+AYNYQD+VFAPYG RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA  
Sbjct  108  SGAEHMAYNYQDMVFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALH  167

Query  482  ---SAGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V LGQ+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLGQVANVCATNTLARATVGRRVFAVDGGEEA  206



>gb|AGT50317.1| flavonoid 3'-hydroxylase, partial [Meconopsis zangnanensis]
Length=442

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 113/136 (83%), Gaps = 4/136 (3%)
 Frame = +2

Query  188  YGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGP  367
            YGP+++LR G V+VVVA SA++A+QFLK  DSNFSNRPPNSGA+HIAYNYQDLVFAPYG 
Sbjct  4    YGPIIYLRFGSVNVVVACSASIASQFLKTRDSNFSNRPPNSGAKHIAYNYQDLVFAPYGR  63

Query  368  RWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTT  535
            RWRM RKI +VHLFS KALD+F +VR+EEVA LT++LA + +    +PV L  LLNVCTT
Sbjct  64   RWRMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNENSKGSPVNLADLLNVCTT  123

Query  536  NALARVMLGRKVFNDG  583
            NALARV+LG +V  DG
Sbjct  124  NALARVLLGTRVCGDG  139



>ref|XP_003525450.1| PREDICTED: flavonoid 3'-monooxygenase-like [Glycine max]
Length=511

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/193 (57%), Positives = 141/193 (73%), Gaps = 1/193 (1%)
 Frame = +2

Query  2    MATLTLIFCTLVFAIFLYFLILRVKQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMA  181
            M+   +   T+V AI +Y  +L+      LPLPPGP+PWP++GNLPH+G  PHQ +AA+A
Sbjct  1    MSPWVIAVATIVAAILIY-RVLKHIAGPSLPLPPGPRPWPIVGNLPHMGPAPHQGLAALA  59

Query  182  ERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPY  361
            + +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N    ++ YN +D+ F PY
Sbjct  60   KTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYNFRTTYMTYNKKDIAFYPY  119

Query  362  GPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGKTPVKLGQLLNVCTTNA  541
            GPRWR LRKI +VH+FS KA+D+F  +RQEEV  L  +L  +    V L QLLNVC TN 
Sbjct  120  GPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRSNSKAVNLRQLLNVCITNI  179

Query  542  LARVMLGRKVFND  580
            +AR+ +GR++FND
Sbjct  180  MARITIGRRIFND  192



>gb|AGT50324.1| flavonoid 3'-hydroxylase, partial [Papaver nudicaule]
Length=449

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFWYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>gb|KHN48734.1| Flavonoid 3'-monooxygenase [Glycine soja]
Length=506

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPH+G  PHQ +AA+A+ +GPLMHLRLGFV VVVAASAAVA QFLKVHD+NF NRP N
Sbjct  37   GNLPHMGPAPHQGLAALAKTHGPLMHLRLGFVHVVVAASAAVAEQFLKVHDANFCNRPYN  96

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASA  487
                ++ YN +D+ F PYGPRWR LRKI +VH+FS KA+D+F  +RQEEV  L  +L  +
Sbjct  97   FRTTYMTYNKKDIAFYPYGPRWRFLRKICTVHMFSGKAMDNFSQLRQEEVERLACNLTRS  156

Query  488  GKTPVKLGQLLNVCTTNALARVMLGRKVFND  580
                V L QLLNVC TN +AR+ +GR++FND
Sbjct  157  NSKAVNLRQLLNVCITNIMARITIGRRIFND  187



>gb|AGT50325.1| flavonoid 3'-hydroxylase, partial [Papaver radicatum]
Length=449

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HD+NFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDANFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F ++R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYIREEEVAVLTKALAQSSKNNKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>gb|AGT50316.1| flavonoid 3'-hydroxylase, partial [Meconopsis integrifolia]
Length=445

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 113/134 (84%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPP+SGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPDSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F +VR+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKGSPVNLSDLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>gb|AGT50321.1| flavonoid 3'-hydroxylase, partial [Meconopsis wilsonii]
Length=445

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 111/134 (83%), Gaps = 4/134 (3%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGARHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK----TPVKLGQLLNVCTTNA  541
            RM RKI +VHLFS KALD+F + R+EEVA LT++LA + K    +PV L  LLNVCTTNA
Sbjct  61   RMFRKICAVHLFSGKALDEFRYAREEEVAVLTKALAQSNKNSKGSPVNLADLLNVCTTNA  120

Query  542  LARVMLGRKVFNDG  583
            LARV+LG +V  DG
Sbjct  121  LARVLLGTRVCGDG  134



>gb|ADX95997.1| flavonoid 3'-hydroxylase [Chrysanthemum x morifolium]
Length=132

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLPHLG  PH ++AA+A++YGPLMHLRLG+VDVVVAA+A+VAAQFLKVHD+NF++RPPN
Sbjct  26   GNLPHLGPIPHHALAALAQKYGPLMHLRLGYVDVVVAATASVAAQFLKVHDANFASRPPN  85

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQ  448
            SGA+H+AYNYQDLVFAPYGPRWR+LRKI SVHLFSAKALDDF HVRQ
Sbjct  86   SGAKHVAYNYQDLVFAPYGPRWRLLRKICSVHLFSAKALDDFRHVRQ  132



>gb|AGT50319.1| flavonoid 3'-hydroxylase, partial [Meconopsis quintuplinervia]
Length=454

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 113/135 (84%), Gaps = 5/135 (4%)
 Frame = +2

Query  194  PLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYGPRW  373
            P+++LRLG V+VVVA SA++A+QFLK HDSNFSNRPPNSGA+HIAYNYQDLVFAPYG RW
Sbjct  1    PIIYLRLGSVNVVVACSASIASQFLKTHDSNFSNRPPNSGAKHIAYNYQDLVFAPYGRRW  60

Query  374  RMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLASAGK-----TPVKLGQLLNVCTTN  538
            RM RKI ++HLFS KALD+F +VR+EEVA LT++LA + K     +PV L  LLNVCTTN
Sbjct  61   RMFRKICALHLFSGKALDEFRYVREEEVAVLTKALAQSNKNSKAGSPVNLADLLNVCTTN  120

Query  539  ALARVMLGRKVFNDG  583
            ALARV+LG +V  DG
Sbjct  121  ALARVLLGTRVCGDG  135



>gb|AFW62812.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=944

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 144/202 (71%), Gaps = 9/202 (4%)
 Frame = +2

Query  11   LTLIFCTLVFAIFLYFLILRV--KQRYplplppgpkpwpvlGNLPHLGKKPHQSIAAMAE  184
            L L+  +L  ++ ++ L+LR     +   PLPPGP+ WPVLGNLP +G KPH ++ A+A 
Sbjct  5    LPLLLGSLAVSVMVWCLVLRRGGDGKGKRPLPPGPRGWPVLGNLPQVGAKPHHTMCALAR  64

Query  185  RYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPNSGAEHIAYNYQDLVFAPYG  364
             YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPNSGAEH+AYNY+DLVFAPYG
Sbjct  65   EYGPLFRLRFGSAEVVVAASARVAAQFLRAHDANFSNRPPNSGAEHVAYNYRDLVFAPYG  124

Query  365  PRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLA-----SAGK-TPVKLGQLLNV  526
             RWR LRK+ ++HLFSAKALDD   VR+ EVA + R LA       G+   V LGQ+ NV
Sbjct  125  SRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRELARPRRGEGGRAAAVALGQVANV  184

Query  527  CTTNALARVMLGRKVFN-DGGS  589
            C TN LAR  +GR+VF  DGG 
Sbjct  185  CATNTLARATVGRRVFAVDGGE  206



>gb|AAV74194.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
 gb|AAV74195.1| flavonoid 3'-hydroxylase [Sorghum bicolor]
Length=517

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +2

Query  128  GNLPHLGKKPHQSIAAMAERYGPLMHLRLGFvdvvvaasaavaaQFLKVHDSNFSNRPPN  307
            GNLP LG  PH ++ A+A++YGPL  LR G  +VVVAASA VAAQFL+ HD+NFSNRPPN
Sbjct  48   GNLPQLGSHPHHTMCALAKKYGPLFRLRFGSAEVVVAASARVAAQFLRTHDANFSNRPPN  107

Query  308  SGAEHIAYNYQDLVFAPYGPRWRMLRKITSVHLFSAKALDDFCHVRQEEVATLTRSLAS-  484
            SGAEH+AYNYQD+ FAPYG RWR LRK+ ++HLFSAKALDD   +R+ EVA L R L+  
Sbjct  108  SGAEHVAYNYQDMAFAPYGSRWRALRKLCALHLFSAKALDDLRSIREGEVALLVRELSRF  167

Query  485  ----AGKTPVKLGQLLNVCTTNALARVMLGRKVFN-DGGSKS  595
                AG   V L Q+ NVC TN LAR  +GR+VF  DGG ++
Sbjct  168  QHQHAG---VPLFQVANVCATNTLARATVGRRVFAVDGGEEA  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510