BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033L13

Length=662
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610543.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    289   9e-92   Nicotiana tomentosiformis
ref|XP_009777271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    288   2e-91   Nicotiana sylvestris
ref|XP_006366999.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    288   2e-91   Solanum tuberosum [potatoes]
emb|CDP03931.1|  unnamed protein product                                280   5e-89   Coffea canephora [robusta coffee]
ref|XP_011089044.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    278   1e-87   Sesamum indicum [beniseed]
ref|XP_004247041.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    278   1e-87   Solanum lycopersicum
ref|XP_008244679.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    268   1e-83   Prunus mume [ume]
ref|XP_006386885.1|  3-glucanase family protein                         267   2e-83   Populus trichocarpa [western balsam poplar]
ref|XP_011024595.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    266   6e-83   Populus euphratica
gb|EYU39188.1|  hypothetical protein MIMGU_mgv1a006049mg                265   2e-82   Erythranthe guttata [common monkey flower]
gb|KDO46598.1|  hypothetical protein CISIN_1g038099mg                   257   3e-82   Citrus sinensis [apfelsine]
ref|XP_004290162.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    264   5e-82   Fragaria vesca subsp. vesca
ref|XP_010100789.1|  putative glucan endo-1,3-beta-glucosidase A6       262   2e-81   Morus notabilis
ref|XP_008382581.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    262   2e-81   
ref|XP_004144397.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    262   3e-81   Cucumis sativus [cucumbers]
ref|XP_008356234.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    263   6e-81   
gb|EPS58986.1|  hypothetical protein M569_15824                         260   8e-81   Genlisea aurea
ref|XP_009372203.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    259   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_007049651.1|  O-Glycosyl hydrolases family 17 protein isof...    256   2e-79   
ref|XP_008460404.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    256   3e-79   Cucumis melo [Oriental melon]
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    254   2e-78   Eucalyptus grandis [rose gum]
ref|XP_011024596.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    253   4e-78   Populus euphratica
ref|XP_003626949.1|  Beta-1 3-glucanase                                 253   5e-78   Medicago truncatula
gb|KHG25787.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    252   1e-77   Gossypium arboreum [tree cotton]
ref|XP_002303070.2|  3-glucanase family protein                         251   3e-77   
gb|KJB10878.1|  hypothetical protein B456_001G230200                    251   3e-77   Gossypium raimondii
gb|KJB10879.1|  hypothetical protein B456_001G230200                    251   4e-77   Gossypium raimondii
gb|KEH22559.1|  glucan endo-1,3-beta-glucosidase-like protein           250   8e-77   Medicago truncatula
ref|XP_004492271.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    250   1e-76   Cicer arietinum [garbanzo]
gb|KFK38190.1|  hypothetical protein AALP_AA3G081000                    247   9e-76   Arabis alpina [alpine rockcress]
dbj|BAA89481.1|  beta-1,3-glucanase                                     247   2e-75   Salix gilgiana
ref|XP_010247391.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    246   5e-75   Nelumbo nucifera [Indian lotus]
ref|XP_002884642.1|  glycosyl hydrolase family 17 protein               244   9e-75   Arabidopsis lyrata subsp. lyrata
emb|CDY28063.1|  BnaC05g44650D                                          244   1e-74   Brassica napus [oilseed rape]
ref|XP_003632052.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   1e-74   Vitis vinifera
ref|XP_006407848.1|  hypothetical protein EUTSA_v10020660mg             244   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006407849.1|  hypothetical protein EUTSA_v10020660mg             244   2e-74   
emb|CDY24629.1|  BnaA05g30280D                                          243   3e-74   Brassica napus [oilseed rape]
ref|XP_009147086.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    244   4e-74   Brassica rapa
ref|XP_006297636.1|  hypothetical protein CARUB_v10013655mg             243   5e-74   Capsella rubella
ref|XP_010486278.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   8e-74   Camelina sativa [gold-of-pleasure]
gb|AAF20214.1|AC012395_1  putative beta-1,3-glucanase precursor         241   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484802.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    242   1e-73   Citrus sinensis [apfelsine]
ref|NP_683538.1|  O-Glycosyl hydrolases family 17 protein               242   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006437250.1|  hypothetical protein CICLE_v10031440mg             242   1e-73   Citrus clementina [clementine]
gb|KJB84083.1|  hypothetical protein B456_N004800                       241   2e-73   Gossypium raimondii
gb|KHN10950.1|  Putative glucan endo-1,3-beta-glucosidase A6            239   2e-73   Glycine soja [wild soybean]
emb|CDY45466.1|  BnaC09g12840D                                          240   4e-73   Brassica napus [oilseed rape]
ref|XP_010464351.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    240   5e-73   Camelina sativa [gold-of-pleasure]
gb|AAM65039.1|  putative glucan endo-1-3-beta-glucosidase               240   7e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KHG02504.1|  putative glucan endo-1,3-beta-glucosidase A6 -lik...    240   7e-73   Gossypium arboreum [tree cotton]
ref|XP_010451138.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    239   2e-72   Camelina sativa [gold-of-pleasure]
gb|KDP45279.1|  hypothetical protein JCGZ_15144                         239   2e-72   Jatropha curcas
ref|XP_003530849.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    238   3e-72   Glycine max [soybeans]
ref|XP_010246533.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    238   4e-72   Nelumbo nucifera [Indian lotus]
emb|CDO96794.1|  unnamed protein product                                237   7e-72   Coffea canephora [robusta coffee]
ref|XP_004510238.1|  PREDICTED: putative copper-transporting ATPa...    247   2e-71   
ref|XP_010547131.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    234   8e-71   Tarenaya hassleriana [spider flower]
ref|XP_010685101.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    233   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004298215.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    230   5e-70   Fragaria vesca subsp. vesca
ref|XP_010552026.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    231   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_003541516.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    228   4e-69   Glycine max [soybeans]
ref|XP_007140788.1|  hypothetical protein PHAVU_008G142200g             229   7e-69   Phaseolus vulgaris [French bean]
ref|XP_003552101.2|  PREDICTED: probable glucan endo-1,3-beta-glu...    229   1e-68   Glycine max [soybeans]
ref|XP_007153895.1|  hypothetical protein PHAVU_003G073900g             223   2e-67   Phaseolus vulgaris [French bean]
ref|XP_004505110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    226   2e-67   
emb|CAN60692.1|  hypothetical protein VITISV_007558                     222   1e-66   Vitis vinifera
gb|ADE76604.1|  unknown                                                 224   1e-66   Picea sitchensis
ref|XP_003632055.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    222   6e-66   Vitis vinifera
ref|XP_007221306.1|  hypothetical protein PRUPE_ppa016789mg             221   7e-66   
emb|CDY08004.1|  BnaC03g35190D                                          221   2e-65   Brassica napus [oilseed rape]
ref|XP_009134961.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    220   4e-65   Brassica rapa
emb|CDX74052.1|  BnaA03g29950D                                          222   4e-65   
ref|XP_006830555.1|  hypothetical protein AMTR_s00117p00104410          219   8e-65   
ref|XP_009373620.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    219   9e-65   
ref|XP_008222761.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    219   1e-64   
ref|XP_002520622.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    218   1e-64   
gb|KEH30957.1|  glucan endo-1,3-beta-glucosidase-like protein           218   3e-64   Medicago truncatula
ref|XP_006299757.1|  hypothetical protein CARUB_v10015952mg             216   1e-63   Capsella rubella
ref|XP_008380636.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    216   2e-63   
ref|XP_010466734.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    215   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010023613.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    214   3e-63   
ref|XP_006830552.1|  hypothetical protein AMTR_s00117p00097230          214   8e-63   
ref|XP_006418839.1|  hypothetical protein EUTSA_v10002513mg             213   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_006421038.1|  hypothetical protein CICLE_v10004917mg             213   2e-62   
ref|XP_010488453.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    213   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010512882.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    212   4e-62   Camelina sativa [gold-of-pleasure]
gb|KDO47456.1|  hypothetical protein CISIN_1g012660mg                   211   6e-62   Citrus sinensis [apfelsine]
ref|XP_002883459.1|  hypothetical protein ARALYDRAFT_479892             211   8e-62   
ref|XP_010264204.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    207   1e-61   Nelumbo nucifera [Indian lotus]
gb|KFK39673.1|  a6 anther-specific protein                              211   2e-61   Arabis alpina [alpine rockcress]
emb|CDY59775.1|  BnaCnng35540D                                          209   7e-61   Brassica napus [oilseed rape]
ref|XP_009102583.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    209   9e-61   Brassica rapa
ref|XP_009625839.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    208   9e-61   Nicotiana tomentosiformis
gb|AAM64490.1|  beta-1,3-glucanase, putative                            208   1e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CDY63754.1|  BnaAnng19080D                                          208   1e-60   Brassica napus [oilseed rape]
ref|XP_009625838.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    208   1e-60   Nicotiana tomentosiformis
ref|NP_189019.1|  O-glycosyl hydrolases family 17 protein               208   2e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28569.1|  unknown                                                 208   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009135862.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    208   2e-60   Brassica rapa
ref|XP_009385472.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    206   6e-60   
ref|XP_008439043.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    206   7e-60   Cucumis melo [Oriental melon]
emb|CDY53213.1|  BnaC03g74070D                                          206   8e-60   Brassica napus [oilseed rape]
ref|XP_010532729.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    206   8e-60   Tarenaya hassleriana [spider flower]
gb|KJB28087.1|  hypothetical protein B456_005G026800                    205   1e-59   Gossypium raimondii
ref|XP_006349905.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    205   1e-59   Solanum tuberosum [potatoes]
ref|XP_006373100.1|  hypothetical protein POPTR_0017s08720g             204   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010314851.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   3e-59   
ref|XP_009106344.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   3e-59   Brassica rapa
ref|XP_008792940.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   4e-59   
emb|CDY50110.1|  BnaC01g43580D                                          204   4e-59   Brassica napus [oilseed rape]
ref|XP_008792939.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   4e-59   Phoenix dactylifera
ref|XP_009777293.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    204   5e-59   Nicotiana sylvestris
gb|KDP32593.1|  hypothetical protein JCGZ_13143                         203   9e-59   Jatropha curcas
emb|CDY18092.1|  BnaA01g23530D                                          203   1e-58   Brassica napus [oilseed rape]
ref|NP_193144.1|  putative glucan endo-1,3-beta-glucosidase A6          202   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31523.1|  hypothetical protein MIMGU_mgv1a005774mg                200   5e-58   Erythranthe guttata [common monkey flower]
ref|XP_009411847.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004147671.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   6e-58   
ref|XP_002868315.1|  hypothetical protein ARALYDRAFT_493503             201   6e-58   
ref|XP_011010072.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   6e-58   Populus euphratica
gb|KGN57233.1|  hypothetical protein Csa_3G172380                       201   6e-58   Cucumis sativus [cucumbers]
ref|XP_009411846.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    201   8e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002976500.1|  hypothetical protein SELMODRAFT_105435             200   9e-58   
gb|EYU31522.1|  hypothetical protein MIMGU_mgv1a005774mg                200   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_011101604.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    199   4e-57   
ref|XP_011045808.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    199   4e-57   Populus euphratica
ref|XP_006282877.1|  hypothetical protein CARUB_v10006945mg             198   9e-57   Capsella rubella
emb|CDP15106.1|  unnamed protein product                                197   2e-56   Coffea canephora [robusta coffee]
gb|KFK36299.1|  hypothetical protein AALP_AA4G104300                    197   2e-56   Arabis alpina [alpine rockcress]
ref|XP_010450129.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   2e-56   
ref|XP_002462618.1|  hypothetical protein SORBIDRAFT_02g029080          197   2e-56   Sorghum bicolor [broomcorn]
ref|XP_007034194.1|  O-Glycosyl hydrolases family 17 protein            198   3e-56   
ref|XP_002444717.1|  hypothetical protein SORBIDRAFT_07g026540          197   3e-56   Sorghum bicolor [broomcorn]
ref|XP_010450110.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   3e-56   Camelina sativa [gold-of-pleasure]
emb|CAB71021.1|  putative beta-1,3-glucanase                            194   5e-56   Hieracium piloselloides
gb|KHN47213.1|  Putative glucan endo-1,3-beta-glucosidase A6            192   7e-56   Glycine soja [wild soybean]
ref|XP_009383833.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    196   7e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009383834.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    196   8e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002973407.1|  hypothetical protein SELMODRAFT_413735             197   9e-56   
ref|XP_003572424.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    197   2e-55   Brachypodium distachyon [annual false brome]
ref|XP_010435194.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    194   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010527440.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    192   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_007199923.1|  hypothetical protein PRUPE_ppa006984mg             189   4e-54   
ref|XP_006414816.1|  hypothetical protein EUTSA_v10025081mg             191   6e-54   Eutrema salsugineum [saltwater cress]
ref|NP_001149815.1|  glucan endo-1,3-beta-glucosidase A6 precursor      191   7e-54   Zea mays [maize]
ref|XP_004957267.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    190   1e-53   Setaria italica
gb|EEC84834.1|  hypothetical protein OsI_31928                          187   1e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001063586.1|  Os09g0502200                                       187   1e-52   
gb|AEN82021.1|  AT3G23770-like protein                                  178   2e-52   Capsella rubella
dbj|BAK05423.1|  predicted protein                                      186   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002534357.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    184   4e-52   Ricinus communis
gb|KJB10880.1|  hypothetical protein B456_001G230200                    184   5e-52   Gossypium raimondii
gb|AEN82027.1|  AT3G23770-like protein                                  177   5e-52   Capsella rubella
ref|XP_009144683.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    185   7e-52   Brassica rapa
emb|CDY08310.1|  BnaA05g13090D                                          185   9e-52   Brassica napus [oilseed rape]
gb|AEN82023.1|  AT3G23770-like protein                                  176   2e-51   Capsella rubella
ref|XP_010673323.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    184   2e-51   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ88052.1|  predicted protein                                      184   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW48409.1|  hypothetical protein EUGRSUZ_K02112                     182   2e-51   Eucalyptus grandis [rose gum]
ref|XP_002964439.1|  hypothetical protein SELMODRAFT_230318             181   2e-51   
gb|ADG38498.1|  AT3G23770-like protein                                  175   4e-51   Capsella grandiflora
gb|ADG38497.1|  AT3G23770-like protein                                  174   4e-51   Capsella grandiflora
dbj|BAK04571.1|  predicted protein                                      184   7e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEN82025.1|  AT3G23770-like protein                                  174   8e-51   Capsella rubella
ref|XP_002971665.1|  hypothetical protein SELMODRAFT_231791             182   9e-51   
gb|ADG38499.1|  AT3G23770-like protein                                  173   1e-50   Capsella grandiflora
gb|ADG38503.1|  AT3G23770-like protein                                  173   2e-50   Neslia paniculata [ball mustard]
gb|ABR16205.1|  unknown                                                 182   2e-50   Picea sitchensis
ref|XP_010238330.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    181   2e-50   Brachypodium distachyon [annual false brome]
emb|CAA49513.1|  beta-1,3-glucanase homologue                           181   3e-50   Brassica napus [oilseed rape]
emb|CDY06469.1|  BnaC06g11750D                                          181   4e-50   
emb|CDY01191.1|  BnaA04g06280D                                          181   5e-50   
ref|XP_009139564.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    180   5e-50   Brassica rapa
gb|ADG38502.1|  AT3G23770-like protein                                  172   5e-50   Capsella grandiflora
emb|CDY12732.1|  BnaC04g29090D                                          179   1e-49   Brassica napus [oilseed rape]
gb|KEH22560.1|  glucan endo-1,3-beta-glucosidase-like protein           176   3e-49   Medicago truncatula
ref|XP_002965673.1|  hypothetical protein SELMODRAFT_85067              177   3e-49   
ref|XP_002298669.2|  glucan endo-1 family protein                       177   4e-49   
emb|CDY12371.1|  BnaC08g08340D                                          178   4e-49   Brassica napus [oilseed rape]
ref|XP_002972033.1|  hypothetical protein SELMODRAFT_96745              176   1e-48   
emb|CDY27122.1|  BnaA08g07600D                                          177   1e-48   Brassica napus [oilseed rape]
ref|XP_009108090.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    177   1e-48   Brassica rapa
gb|KEH18116.1|  O-glycosyl hydrolase family 17 protein                  174   2e-48   Medicago truncatula
ref|NP_001062294.2|  Os08g0525800                                       175   5e-48   
ref|XP_002972579.1|  hypothetical protein SELMODRAFT_97838              174   6e-48   
dbj|BAC75423.1|  putative beta-1,3-glucanase                            175   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002980798.1|  hypothetical protein SELMODRAFT_444643             173   2e-47   Selaginella moellendorffii
ref|XP_010539314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     171   1e-46   Tarenaya hassleriana [spider flower]
ref|NP_001051879.1|  Os03g0845600                                       171   1e-46   
ref|XP_002975355.1|  hypothetical protein SELMODRAFT_103308             167   1e-46   Selaginella moellendorffii
gb|KDO62116.1|  hypothetical protein CISIN_1g0115512mg                  171   2e-46   Citrus sinensis [apfelsine]
gb|KDO62115.1|  hypothetical protein CISIN_1g0115512mg                  171   2e-46   Citrus sinensis [apfelsine]
gb|KDP39185.1|  hypothetical protein JCGZ_00942                         170   2e-46   Jatropha curcas
ref|XP_002961854.1|  hypothetical protein SELMODRAFT_437767             170   2e-46   Selaginella moellendorffii
gb|KDO62114.1|  hypothetical protein CISIN_1g0115512mg                  171   3e-46   Citrus sinensis [apfelsine]
ref|XP_011044921.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    170   3e-46   Populus euphratica
ref|XP_002316783.2|  glycosyl hydrolase family 17 family protein        170   5e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006452449.1|  hypothetical protein CICLE_v10008176mg             169   6e-46   Citrus clementina [clementine]
ref|XP_008230022.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     166   6e-46   
ref|XP_006475009.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    169   7e-46   Citrus sinensis [apfelsine]
dbj|BAG16366.1|  tapetum-specific protein A6 family protein             167   7e-46   Brassica rapa var. perviridis [kabuna]
ref|XP_008364550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     169   8e-46   
gb|EAZ07710.1|  hypothetical protein OsI_29967                          173   8e-46   Oryza sativa Indica Group [Indian rice]
ref|XP_007020717.1|  O-Glycosyl hydrolases family 17 protein            169   1e-45   
ref|XP_009348307.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    168   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_009361042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45   Pyrus x bretschneideri [bai li]
ref|XP_009334153.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    167   3e-45   Pyrus x bretschneideri [bai li]
gb|EEC76519.1|  hypothetical protein OsI_14305                          167   4e-45   Oryza sativa Indica Group [Indian rice]
gb|AFU52656.1|  beta-1,3-glucanase 23                                   167   4e-45   Solanum tuberosum [potatoes]
ref|XP_006661404.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    168   4e-45   
ref|XP_004251911.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    166   1e-44   Solanum lycopersicum
ref|XP_006344865.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   2e-44   Solanum tuberosum [potatoes]
ref|XP_008643986.1|  PREDICTED: uncharacterized protein LOC100382...    165   2e-44   Zea mays [maize]
gb|EYU33669.1|  hypothetical protein MIMGU_mgv1a005896mg                165   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_003519593.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   3e-44   
ref|XP_001759996.1|  predicted protein                                  162   3e-44   
ref|XP_002971087.1|  hypothetical protein SELMODRAFT_95153              161   3e-44   
gb|ADU15553.1|  GLU                                                     165   3e-44   Gossypium hirsutum [American cotton]
ref|XP_004294409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   3e-44   Fragaria vesca subsp. vesca
ref|XP_006344866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    165   4e-44   Solanum tuberosum [potatoes]
gb|KHG04965.1|  hypothetical protein F383_30444                         164   4e-44   Gossypium arboreum [tree cotton]
ref|XP_004497650.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   4e-44   Cicer arietinum [garbanzo]
ref|XP_007215327.1|  hypothetical protein PRUPE_ppa005206mg             164   4e-44   
gb|KEH41871.1|  O-glycosyl hydrolase family 17 protein                  165   4e-44   Medicago truncatula
dbj|BAG16359.1|  tapetum-specific protein A6 family protein             163   4e-44   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_002961999.1|  hypothetical protein SELMODRAFT_76182              161   5e-44   
ref|XP_010433433.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    164   6e-44   Camelina sativa [gold-of-pleasure]
gb|KJB62900.1|  hypothetical protein B456_009G442700                    164   6e-44   Gossypium raimondii
ref|XP_010545233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     163   9e-44   Tarenaya hassleriana [spider flower]
gb|KDP30806.1|  hypothetical protein JCGZ_13749                         163   1e-43   Jatropha curcas
ref|XP_002529472.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    163   1e-43   Ricinus communis
dbj|BAC53928.1|  beta-1,3-glucanase-like protein                        160   1e-43   Nicotiana tabacum [American tobacco]
ref|XP_003544773.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   2e-43   Glycine max [soybeans]
gb|KHN23902.1|  Glucan endo-1,3-beta-glucosidase 12                     162   2e-43   Glycine soja [wild soybean]
ref|XP_002463526.1|  hypothetical protein SORBIDRAFT_01g001430          163   2e-43   Sorghum bicolor [broomcorn]
ref|XP_010448205.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   2e-43   
ref|XP_008226995.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   2e-43   Prunus mume [ume]
emb|CBI39414.3|  unnamed protein product                                160   2e-43   Vitis vinifera
ref|XP_009771279.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    162   3e-43   Nicotiana sylvestris
ref|XP_002274828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     161   5e-43   Vitis vinifera
ref|XP_006283767.1|  hypothetical protein CARUB_v10004853mg             160   9e-43   
gb|KJB37880.1|  hypothetical protein B456_006G224700                    160   1e-42   Gossypium raimondii
ref|XP_009794437.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   1e-42   Nicotiana sylvestris
ref|XP_009628415.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     160   2e-42   Nicotiana tomentosiformis
ref|XP_003581305.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    160   2e-42   Brachypodium distachyon [annual false brome]
dbj|BAB17320.1|  elicitor inducible beta-1,3-glucanase NtEIG-E76        160   2e-42   Nicotiana tabacum [American tobacco]
ref|XP_009595038.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    160   2e-42   Nicotiana tomentosiformis
ref|XP_007204831.1|  hypothetical protein PRUPE_ppa1027206mg            160   3e-42   Prunus persica
ref|XP_007049174.1|  O-Glycosyl hydrolases family 17 protein isof...    161   3e-42   
ref|XP_007049173.1|  O-Glycosyl hydrolases family 17 protein isof...    160   3e-42   
ref|XP_004243515.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     159   3e-42   Solanum lycopersicum
ref|XP_008385844.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   3e-42   
ref|XP_006357966.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   3e-42   Solanum tuberosum [potatoes]
gb|KFK29190.1|  hypothetical protein AALP_AA7G101400                    159   4e-42   Arabis alpina [alpine rockcress]
emb|CDY06601.1|  BnaC02g13250D                                          159   4e-42   
ref|XP_009127019.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   5e-42   
emb|CDY20780.1|  BnaA02g09200D                                          158   5e-42   Brassica napus [oilseed rape]
ref|XP_002278044.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     159   5e-42   Vitis vinifera
ref|XP_009365112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   5e-42   
emb|CDX92794.1|  BnaC07g40520D                                          158   5e-42   
dbj|BAE80092.1|  glycosyl hydrolase family 17                           158   6e-42   Silene latifolia
ref|XP_006413135.1|  hypothetical protein EUTSA_v10026799mg             158   6e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009127020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   7e-42   Brassica rapa
ref|XP_006357965.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    159   7e-42   
ref|NP_001275111.1|  glucan endo-1,3-beta-glucosidase 12-like pre...    158   7e-42   Solanum tuberosum [potatoes]
ref|XP_009365111.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_009347789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_008449141.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     158   9e-42   Cucumis melo [Oriental melon]
ref|XP_010438690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   9e-42   Camelina sativa [gold-of-pleasure]
emb|CDP05678.1|  unnamed protein product                                158   9e-42   Coffea canephora [robusta coffee]
ref|XP_010110627.1|  Glucan endo-1,3-beta-glucosidase 13                158   1e-41   
ref|XP_007142328.1|  hypothetical protein PHAVU_008G271000g             158   1e-41   Phaseolus vulgaris [French bean]
ref|XP_004140121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   1e-41   Cucumis sativus [cucumbers]
gb|AAZ40342.1|  beta-1,3-glucanase 2                                    158   1e-41   Ziziphus jujuba [Chinese jujube]
ref|XP_004140120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    158   1e-41   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                     156   1e-41   Glycine soja [wild soybean]
ref|XP_001781801.1|  predicted protein                                  157   1e-41   
ref|XP_002462967.1|  hypothetical protein SORBIDRAFT_02g035480          158   1e-41   Sorghum bicolor [broomcorn]
ref|XP_009347788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   1e-41   
tpg|DAA63007.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    159   2e-41   
ref|XP_002867539.1|  hydrolase, hydrolyzing O-glycosyl compounds        157   2e-41   
dbj|BAJ92436.1|  predicted protein                                      155   2e-41   
ref|XP_006386788.1|  hypothetical protein POPTR_0002s21700g             157   2e-41   
ref|XP_008242469.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   3e-41   
ref|XP_008242470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   3e-41   
ref|XP_002302861.2|  glycosyl hydrolase family 17 family protein        157   3e-41   
gb|EMT12040.1|  Glucan endo-1,3-beta-glucosidase 13                     157   3e-41   
ref|XP_008379673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   3e-41   
ref|XP_010063042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   3e-41   
ref|XP_006401482.1|  hypothetical protein EUTSA_v10013478mg             156   4e-41   
ref|XP_007212383.1|  hypothetical protein PRUPE_ppa005210mg             156   4e-41   
gb|EPS59841.1|  hypothetical protein M569_14964                         156   4e-41   
gb|KJB10702.1|  hypothetical protein B456_001G216900                    156   5e-41   
emb|CDY46679.1|  BnaA03g48290D                                          155   6e-41   
gb|EEC82195.1|  hypothetical protein OsI_26335                          157   6e-41   
ref|XP_006595830.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    156   6e-41   
gb|KHG05496.1|  hypothetical protein F383_30989                         155   6e-41   
gb|KJB10701.1|  hypothetical protein B456_001G216900                    155   7e-41   
ref|XP_011009684.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   7e-41   
ref|XP_008653189.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    157   7e-41   
tpg|DAA63006.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    157   8e-41   
ref|XP_011097840.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     155   9e-41   
emb|CDY17308.1|  BnaA10g09420D                                          155   9e-41   
gb|EPS73917.1|  hypothetical protein M569_00835                         155   1e-40   
ref|XP_008449478.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     155   1e-40   
ref|XP_006575581.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    155   1e-40   
ref|XP_006280442.1|  hypothetical protein CARUB_v10026374mg             155   1e-40   
ref|XP_004304086.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     155   1e-40   
dbj|BAJ93567.1|  predicted protein                                      155   2e-40   
ref|XP_009137621.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     154   2e-40   
ref|NP_001059878.1|  Os07g0538000                                       155   2e-40   
ref|XP_006492526.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    153   2e-40   
ref|XP_002320484.1|  glycosyl hydrolase family 17 family protein        154   2e-40   
emb|CAB36529.1|  putative beta-1, 3-glucanase                           154   2e-40   
ref|XP_001779924.1|  predicted protein                                  152   3e-40   
emb|CDY19908.1|  BnaC09g31740D                                          154   3e-40   
ref|XP_001777261.1|  predicted protein                                  154   3e-40   
ref|NP_194413.2|  O-Glycosyl hydrolases family 17 protein               154   3e-40   
emb|CDP13790.1|  unnamed protein product                                154   4e-40   
ref|XP_010252551.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    154   4e-40   
ref|XP_002864380.1|  glycosyl hydrolase family 17 protein               153   4e-40   
ref|XP_004491103.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   5e-40   
gb|KFK27118.1|  hypothetical protein AALP_AA8G337200                    153   5e-40   
ref|XP_004491104.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   6e-40   
gb|AAD10386.1|  beta-1,3-glucanase precursor                            151   6e-40   
ref|XP_006647977.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    153   6e-40   
ref|NP_568822.1|  O-Glycosyl hydrolases family 17 protein               153   7e-40   
gb|EPS68573.1|  hypothetical protein M569_06194                         152   7e-40   
ref|XP_010482941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   7e-40   
ref|XP_001780045.1|  predicted protein                                  152   8e-40   
ref|NP_001154780.1|  O-Glycosyl hydrolases family 17 protein            152   8e-40   
ref|XP_010689521.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     153   8e-40   
dbj|BAB08587.1|  beta-1,3-glucanase-like protein                        152   8e-40   
emb|CDP14397.1|  unnamed protein product                                153   9e-40   
ref|XP_010557676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     152   1e-39   
dbj|BAF01341.1|  putative beta-1,3-glucanase                            149   1e-39   
ref|XP_004973968.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    151   1e-39   
ref|XP_001762206.1|  predicted protein                                  150   1e-39   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   1e-39   
gb|ADT64455.1|  beta-1,3-glucosidase                                    149   1e-39   
ref|XP_010541008.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     153   1e-39   
ref|XP_010538536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   1e-39   
ref|XP_010538537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   1e-39   
ref|XP_009120040.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   2e-39   
tpg|DAA62996.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    153   2e-39   
ref|XP_003616906.1|  Glucan endo-1,3-beta-glucosidase                   152   2e-39   
ref|XP_001757144.1|  predicted protein                                  149   2e-39   
gb|AAL77689.1|  AT5g55180/MCO15_13                                      151   2e-39   
ref|XP_007141644.1|  hypothetical protein PHAVU_008G213400g             152   2e-39   
gb|AGV54422.1|  glucan endo-1,3-beta-glucosidase 13-like protein        152   2e-39   
gb|AAC04713.1|  beta-1,3-glucanase 7                                    147   2e-39   
ref|XP_007160277.1|  hypothetical protein PHAVU_002G307800g             152   2e-39   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    152   2e-39   
ref|NP_001151472.1|  hydrolase, hydrolyzing O-glycosyl compounds ...    152   2e-39   
ref|XP_002967643.1|  hypothetical protein SELMODRAFT_88150              149   2e-39   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   3e-39   
gb|KHM99816.1|  Glucan endo-1,3-beta-glucosidase 13                     151   3e-39   
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   3e-39   
ref|XP_006853717.1|  hypothetical protein AMTR_s00056p00158530          152   3e-39   
ref|NP_001048260.1|  Os02g0771700                                       151   3e-39   
ref|XP_008357534.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   3e-39   
gb|AAM66024.1|  beta-1,3-glucanase-like protein                         151   3e-39   
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    149   3e-39   
ref|XP_002964390.1|  hypothetical protein SELMODRAFT_82448              149   3e-39   
ref|XP_001752959.1|  predicted protein                                  149   3e-39   
ref|XP_004149346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   3e-39   
ref|XP_002525335.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    151   3e-39   
gb|KEH30836.1|  glycoside hydrolase family 17 protein                   150   3e-39   
gb|KEH30835.1|  glycoside hydrolase family 17 protein                   150   3e-39   
ref|XP_008357533.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-39   
ref|XP_011085458.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 3      151   4e-39   
gb|ADG38397.1|  AT3G07320-like protein                                  145   4e-39   
dbj|BAJ90025.1|  predicted protein                                      154   4e-39   
gb|ADG38393.1|  AT3G07320-like protein                                  145   4e-39   
ref|XP_001784285.1|  predicted protein                                  150   4e-39   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    151   4e-39   
gb|KEH30834.1|  glycoside hydrolase family 17 protein                   150   4e-39   
ref|XP_008391122.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     149   4e-39   
ref|XP_002454630.1|  hypothetical protein SORBIDRAFT_04g034530          151   4e-39   
ref|XP_008357532.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   4e-39   
ref|XP_008792941.1|  PREDICTED: probable glucan endo-1,3-beta-glu...    149   4e-39   
ref|XP_006580483.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     151   5e-39   
gb|ADG38398.1|  AT3G07320-like protein                                  144   5e-39   
tpg|DAA41054.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    145   6e-39   
ref|XP_006297583.1|  hypothetical protein CARUB_v10013604mg             150   6e-39   
gb|EPS69142.1|  hypothetical protein M569_05624                         148   7e-39   
ref|XP_008357531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    149   7e-39   
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   7e-39   
ref|XP_009132399.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   7e-39   
ref|XP_009132400.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   7e-39   
gb|KHN16652.1|  Glucan endo-1,3-beta-glucosidase 13                     150   8e-39   
ref|XP_006584807.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   8e-39   
gb|KDO36784.1|  hypothetical protein CISIN_1g009301mg                   150   1e-38   
gb|ACF88240.1|  unknown                                                 150   1e-38   
ref|XP_010026682.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    147   1e-38   
ref|XP_006447645.1|  hypothetical protein CICLE_v10015086mg             150   1e-38   
ref|XP_011047200.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     149   1e-38   
gb|ACF79018.1|  unknown                                                 150   1e-38   
ref|XP_009352572.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     150   1e-38   
ref|XP_002462970.1|  hypothetical protein SORBIDRAFT_02g035520          151   1e-38   
ref|NP_001136613.1|  uncharacterized protein LOC100216736 precursor     149   1e-38   
ref|XP_010270042.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     149   1e-38   
ref|XP_001775379.1|  predicted protein                                  147   1e-38   
ref|XP_010249473.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   2e-38   
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   2e-38   
ref|XP_002275642.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     148   2e-38   
ref|XP_004161885.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    149   2e-38   
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   2e-38   
ref|XP_007147908.1|  hypothetical protein PHAVU_006G165100g             148   2e-38   
ref|XP_006469612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    150   2e-38   
ref|XP_001764817.1|  predicted protein                                  146   2e-38   
gb|ACR35980.1|  unknown                                                 149   2e-38   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg             149   2e-38   
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   2e-38   
emb|CDY36734.1|  BnaA03g11520D                                          149   2e-38   
ref|XP_007025069.1|  Glycosyl hydrolase superfamily protein             148   2e-38   
ref|XP_008337610.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     149   2e-38   
ref|XP_001775863.1|  predicted protein                                  147   2e-38   
ref|XP_010449211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   3e-38   
gb|KJB57237.1|  hypothetical protein B456_009G154800                    147   3e-38   
gb|AGA95870.1|  beta-1,3-glucanase                                      146   3e-38   
ref|XP_010443128.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    148   3e-38   
gb|EMS65653.1|  Glucan endo-1,3-beta-glucosidase 13                     148   4e-38   
gb|AIR93911.1|  glucanase                                               146   4e-38   
ref|XP_010236896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   4e-38   
gb|EMT25818.1|  Glucan endo-1,3-beta-glucosidase 12                     149   4e-38   
gb|ADG38399.1|  AT3G07320-like protein                                  142   4e-38   
gb|KJB57236.1|  hypothetical protein B456_009G154800                    147   5e-38   
emb|CAN80621.1|  hypothetical protein VITISV_043431                     147   5e-38   
gb|ADG38396.1|  AT3G07320-like protein                                  142   5e-38   
emb|CDY12009.1|  BnaC03g14350D                                          147   6e-38   
ref|XP_006855038.1|  hypothetical protein AMTR_s00031p00059420          146   6e-38   
ref|XP_004954064.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    148   6e-38   
ref|XP_004505291.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   7e-38   
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   7e-38   
ref|XP_004954063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   7e-38   
ref|XP_002987317.1|  hypothetical protein SELMODRAFT_125909             145   8e-38   
gb|AIR93910.1|  glucanase                                               147   8e-38   
dbj|BAJ87688.1|  predicted protein                                      147   8e-38   
gb|EPS68882.1|  hypothetical protein M569_05882                         146   8e-38   
ref|XP_004954062.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   8e-38   
ref|XP_004505292.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   8e-38   
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    147   8e-38   
gb|AAD26909.1|  putative beta-1,3-glucanase                             147   8e-38   
gb|EYU27371.1|  hypothetical protein MIMGU_mgv1a005776mg                147   9e-38   
gb|EYU43261.1|  hypothetical protein MIMGU_mgv1a008785mg                145   9e-38   
ref|XP_002864470.1|  glycosyl hydrolase family 17 protein               147   1e-37   
ref|NP_178637.2|  O-glycosyl hydrolases family 17 protein               147   1e-37   
ref|XP_010559242.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   1e-37   
gb|KHG21190.1|  hypothetical protein F383_01641                         147   1e-37   
gb|KHG21189.1|  hypothetical protein F383_01641                         147   1e-37   
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   1e-37   
ref|XP_002883709.1|  hypothetical protein ARALYDRAFT_480193             147   1e-37   
gb|AEN81798.1|  AT3G07320-like protein                                  141   1e-37   
ref|XP_010267108.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     147   1e-37   
ref|XP_006855691.1|  hypothetical protein AMTR_s00044p00136160          142   2e-37   
gb|KHN47326.1|  Glucan endo-1,3-beta-glucosidase 14                     145   2e-37   
gb|AEN81800.1|  AT3G07320-like protein                                  140   2e-37   
gb|EMT31770.1|  Glucan endo-1,3-beta-glucosidase 13                     147   2e-37   
ref|XP_004287489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     146   2e-37   
gb|KJB13749.1|  hypothetical protein B456_002G092600                    146   2e-37   
ref|XP_008783886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   2e-37   
ref|XP_003547203.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   2e-37   
ref|XP_001766544.1|  predicted protein                                  145   2e-37   
ref|XP_002976327.1|  hypothetical protein SELMODRAFT_105037             143   3e-37   
ref|XP_008783885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   3e-37   
gb|EYU43154.1|  hypothetical protein MIMGU_mgv1a005917mg                145   3e-37   
ref|NP_001241907.1|  uncharacterized protein LOC100790277               145   3e-37   
gb|EMS51674.1|  Glucan endo-1,3-beta-glucosidase 13                     146   3e-37   
ref|XP_004506182.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   3e-37   
ref|XP_004291598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 14     144   4e-37   
ref|XP_003562973.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    146   4e-37   
ref|NP_200470.1|  O-Glycosyl hydrolases family 17 protein               145   4e-37   
emb|CDY64970.1|  BnaAnng19910D                                          145   4e-37   
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    145   4e-37   
gb|KHG26459.1|  hypothetical protein F383_04538                         145   4e-37   
ref|NP_001275363.1|  glucan endo-1,3-beta-glucosidase 13-like pre...    145   5e-37   
ref|XP_004968994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   6e-37   
ref|XP_008781529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    144   6e-37   
emb|CDY56498.1|  BnaAnng14330D                                          144   6e-37   
ref|XP_009120169.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 13     145   6e-37   
ref|XP_004968993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   6e-37   
ref|XP_004149679.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    143   6e-37   
emb|CDY18049.1|  BnaC07g04210D                                          144   7e-37   
gb|EMS66645.1|  Glucan endo-1,3-beta-glucosidase 3                      145   7e-37   
ref|XP_002514201.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    145   7e-37   
gb|KDP37980.1|  hypothetical protein JCGZ_04623                         143   8e-37   
gb|AES71661.2|  glycoside hydrolase family 17 protein                   143   8e-37   
ref|XP_009102359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12     144   8e-37   
ref|XP_008788767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    145   8e-37   
emb|CDP18512.1|  unnamed protein product                                144   8e-37   
gb|EPS64814.1|  hypothetical protein M569_09966                         142   9e-37   
emb|CBI30910.3|  unnamed protein product                                143   9e-37   
ref|XP_007012989.1|  O-Glycosyl hydrolases family 17 protein isof...    144   9e-37   
gb|ABR16583.1|  unknown                                                 143   9e-37   
ref|XP_007012991.1|  O-Glycosyl hydrolases family 17 protein isof...    144   1e-36   
ref|XP_010252096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11     143   1e-36   
ref|XP_006837841.1|  hypothetical protein AMTR_s00100p00040750          144   1e-36   
ref|XP_001761806.1|  predicted protein                                  144   1e-36   



>ref|XP_009610543.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
tomentosiformis]
Length=465

 Score =   289 bits (739),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 164/186 (88%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA+IS+ VGICYGQLGNNLP P++S +LI+GLKA RVKIYDANP+IL+A   + +Q+SVM
Sbjct  21   GAEISSKVGICYGQLGNNLPIPTKSVDLINGLKANRVKIYDANPEILKAFKGTKLQLSVM  80

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NIS++Q LAD+WV+TNVVPFY +T IRY+LVGNEILS+PPNTTWF LVPA+RK
Sbjct  81   VPNELINNISTNQDLADQWVKTNVVPFYPDTMIRYVLVGNEILSSPPNTTWFNLVPAIRK  140

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            IR +VKKFGL KIKVGTPLA+DMLE+S+PPS+G FRSD++  V KPLL FL+RT SFFF 
Sbjct  141  IRYAVKKFGLGKIKVGTPLAIDMLESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFI  200

Query  645  DVYPYF  662
            DVYPYF
Sbjct  201  DVYPYF  206



>ref|XP_009777271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=466

 Score =   288 bits (737),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            +IS+ VGICYGQLGNNLP P++S +LI+GLKA RVKIYDANP+IL+A   + +QVSVMVP
Sbjct  24   EISSKVGICYGQLGNNLPLPTKSVDLINGLKANRVKIYDANPEILKAFKGTKIQVSVMVP  83

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            NE+I NIS++Q LAD+WV+TNVVPFY +T IRYLLVGNEILSNPPNTTWF LVPA+RKIR
Sbjct  84   NELINNISTNQDLADQWVKTNVVPFYPDTMIRYLLVGNEILSNPPNTTWFNLVPAIRKIR  143

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             SVKKFGL KIKVGTPLA+DMLE+S+PPS+G FRSD++  V  PLL FL+RT SFFF DV
Sbjct  144  YSVKKFGLGKIKVGTPLAIDMLESSFPPSNGTFRSDISEKVMIPLLHFLNRTKSFFFIDV  203

Query  651  YPYF  662
            YPYF
Sbjct  204  YPYF  207



>ref|XP_006366999.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=464

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ VGICYGQLGNNLP P  S +LI GLKAKRVKIYD NP+IL AL  +++QVSVMV
Sbjct  21   AEISSQVGICYGQLGNNLPIPKNSVDLIKGLKAKRVKIYDTNPQILEALKGTNLQVSVMV  80

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NIS++Q LAD+WV+ NVVPFY  T IRYLLVGNEILS+PPNTTWF LVPA+RKI
Sbjct  81   PNELINNISTNQTLADQWVKNNVVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPAIRKI  140

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            R SVKKFGL KIK+GTPLA+DMLE+S+PPS+G FRSD++  V KPLL FL+RT SFFF D
Sbjct  141  RFSVKKFGLGKIKIGTPLAIDMLESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFID  200

Query  648  VYPYF  662
            VYPYF
Sbjct  201  VYPYF  205



>emb|CDP03931.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   280 bits (716),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA++SA VGICYGQLGNNLPTPS+S ELI GLKAK VKIYDANPKIL ALG + +QVSVM
Sbjct  22   GAEMSAKVGICYGQLGNNLPTPSKSVELIQGLKAKGVKIYDANPKILAALGGTPLQVSVM  81

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNEII NISS+Q LAD+WV+TNVVPFY +T+IRYLLVGNEILS P  TTWF LVPAMR+
Sbjct  82   VPNEIITNISSNQTLADQWVKTNVVPFYRKTRIRYLLVGNEILSGPDKTTWFNLVPAMRR  141

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            IR SVK FGL K+KVGTPLAMD+L +S+PPSSG+FRSD++  V KPLLQFLDRT SFFF 
Sbjct  142  IRYSVKTFGLNKVKVGTPLAMDVLGSSFPPSSGSFRSDVSDKVLKPLLQFLDRTKSFFFI  201

Query  645  DVYPYF  662
            DVYPYF
Sbjct  202  DVYPYF  207



>ref|XP_011089044.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=461

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             ++   +G+CYG+LGNNLPTPS S +LI  L  KR+KIY  NPKIL+++  +D+Q+S+MV
Sbjct  22   GEMQPKIGVCYGELGNNLPTPSASIQLIQKLNGKRIKIYGTNPKILKSIQGTDLQISIMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PN +IP+IS++Q LAD+WV+TNVVPFY E+KIRYLLVGNEILSNPPNTTWF+LVPAMRKI
Sbjct  82   PNNLIPDISTNQTLADQWVQTNVVPFYPESKIRYLLVGNEILSNPPNTTWFKLVPAMRKI  141

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            R SVKK+GL KIKVGTPLAMD LE+S+PPS+G FRSD+   V +P+L FL+RT SFFF D
Sbjct  142  RSSVKKYGLHKIKVGTPLAMDALESSFPPSNGTFRSDVREKVIRPMLHFLNRTKSFFFVD  201

Query  648  VYPYF  662
            VY YF
Sbjct  202  VYTYF  206



>ref|XP_004247041.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=464

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GICYGQLGNNLP P  S +LI GLKAKRVKIYD NP+IL AL  +++QVSVMVPNE+I 
Sbjct  27   LGICYGQLGNNLPIPKNSVDLIKGLKAKRVKIYDTNPQILDALKGTNLQVSVMVPNELIN  86

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
            NIS++Q LAD+WV+ N+VPFY  T IRYLLVGNEILS+PPNTTWF LVP +RKIR SVKK
Sbjct  87   NISTNQTLADQWVKNNIVPFYPHTMIRYLLVGNEILSSPPNTTWFNLVPTIRKIRFSVKK  146

Query  486  FGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            FGL KIKVGTPLA+DMLE+S+PPS+G FRSD++  V KPLL FL+RT SFFF DVYPYF
Sbjct  147  FGLGKIKVGTPLAIDMLESSFPPSNGTFRSDISEKVMKPLLHFLNRTKSFFFIDVYPYF  205



>ref|XP_008244679.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=462

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+++A VG+ +GQLGNNLP+PS S +LI  LKAKRVKIYDANPKIL AL N+D+QVS+MV
Sbjct  20   AELAAKVGVNFGQLGNNLPSPSESVKLIQSLKAKRVKIYDANPKILEALRNTDLQVSMMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LAD+WV  NVVPFY ET IRYLLVGNEILS P  T WF LVPAMRKI
Sbjct  80   PNELINNISSNQTLADQWVHANVVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAMRKI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++K  G+ K+KVGTPLAMD+LE+S+PPS+G FRSD + SV KPLLQF+++T SFFF D
Sbjct  140  KAALKTHGIAKVKVGTPLAMDVLESSFPPSNGTFRSDFSASVIKPLLQFVNKTKSFFFVD  199

Query  648  VYPYF  662
            VY  F
Sbjct  200  VYTSF  204



>ref|XP_006386885.1| 3-glucanase family protein [Populus trichocarpa]
 gb|ERP64682.1| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS  VGI YGQLGNNLP+PS S EL+  LKAKRVKIYDANP IL++L ++D+QVS+M+
Sbjct  21   AEISNKVGINYGQLGNNLPSPSESVELLKSLKAKRVKIYDANPDILKSLKDTDIQVSIMI  80

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NIS  Q+L+D WV+TNVVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I
Sbjct  81   PNELIQNISKSQSLSDHWVKTNVVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRI  140

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+K   + KIKVGTP A+++LE+S+PPS+G FRSD++G + KP+L+FLDRT SFFF D
Sbjct  141  KASLKTHKITKIKVGTPSALNVLESSFPPSNGTFRSDISGPIIKPMLRFLDRTKSFFFID  200

Query  648  VYPYF  662
            VYPYF
Sbjct  201  VYPYF  205



>ref|XP_011024595.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS  VGI YGQLGNNLP+PS S ELI  LKAKRVKIYDANP IL++L ++D+QVS+M+
Sbjct  21   AEISNKVGINYGQLGNNLPSPSESVELIKSLKAKRVKIYDANPDILKSLKDTDIQVSIMI  80

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NIS  Q+L+D WV+TNVVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+I
Sbjct  81   PNELIQNISKSQSLSDHWVKTNVVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRRI  140

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+K   ++KIKVGT  A+++LE+S+PPS+G FRSD++G + KP+L+FLDRT SFFF D
Sbjct  141  KASLKSHKIKKIKVGTTSAINVLESSFPPSNGTFRSDISGPIIKPMLRFLDRTKSFFFID  200

Query  648  VYPYF  662
            VYPYF
Sbjct  201  VYPYF  205



>gb|EYU39188.1| hypothetical protein MIMGU_mgv1a006049mg [Erythranthe guttata]
Length=459

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             ++   +G+CYG+LGNNLP+P +S +LI  L AKR+KIY ANPKIL+++  +D+Q+S+MV
Sbjct  22   GEMQPKMGVCYGELGNNLPSPEKSIQLIQKLNAKRIKIYGANPKILKSIQGTDLQISIMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PN++I  I ++Q LAD WV+TNVVPFY ++KIRYLLVGNEILS+ PN+TWFQLVPA+R+I
Sbjct  82   PNQLISAIYNNQTLADDWVKTNVVPFYPQSKIRYLLVGNEILSSQPNSTWFQLVPAIRRI  141

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            R +VKK+GL+K+KVGTPLAMD+LE+SYPPS+G FRSD++ +V +PLL FL+RT SFFF D
Sbjct  142  RNAVKKYGLKKVKVGTPLAMDVLESSYPPSNGTFRSDVSETVVEPLLHFLNRTKSFFFVD  201

Query  648  VYPYF  662
            VY YF
Sbjct  202  VYTYF  206



>gb|KDO46598.1| hypothetical protein CISIN_1g038099mg, partial [Citrus sinensis]
Length=250

 Score =   257 bits (657),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 151/188 (80%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAEL-IHGLKAKRVKIYDANPKILRALGNSDVQVSV  281
             A++S+ VG+CYGQLGNNLP+P  S EL I  LKA RVKIYDANPKIL+AL N D+QVS+
Sbjct  20   SAEMSSKVGVCYGQLGNNLPSPQESVELMIKSLKATRVKIYDANPKILKALKNIDIQVSI  79

Query  282  MVPNEIIPNIS-SDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAM  458
            MVPNEII NIS S Q L+D+WV TNV+P+   TKIRYLLVGNEILS P  + W  LVPAM
Sbjct  80   MVPNEIINNISLSSQTLSDQWVRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAM  139

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            RKIR+S+K  G RKIKVGTP AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFF
Sbjct  140  RKIRKSLKTLGARKIKVGTPSAMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFF  199

Query  639  FFDVYPYF  662
            F D Y +F
Sbjct  200  FVDAYTFF  207



>ref|XP_004290162.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=463

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+ SA VG+ YGQLGNNLP+PS S +LI  LKAKRVKIYDANPKIL AL N+D+QVS+MV
Sbjct  20   AEFSAKVGVNYGQLGNNLPSPSESVKLIQNLKAKRVKIYDANPKILEALRNTDLQVSMMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LA++WV  NVVPFY  T IRYLLVGNEILS P  + WF LVPAMRKI
Sbjct  80   PNELINNISSNQTLANQWVHANVVPFYPHTLIRYLLVGNEILSAPDKSIWFNLVPAMRKI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            ++++K  G+ K+KVGTP AMD+LE+S+PPS+G FRSD++ SV KP+L+FL +T SFFF D
Sbjct  140  KKALKIHGITKVKVGTPSAMDVLESSFPPSNGTFRSDISSSVIKPMLKFLFKTKSFFFVD  199

Query  648  VYPYF  662
            VYP+F
Sbjct  200  VYPFF  204



>ref|XP_010100789.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXB84487.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=470

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA+IS  VG+ YG LGNNLP+P RS ELI  LKAKRVKIY+A+P+IL AL N+++QVS+M
Sbjct  23   GAEISGKVGVNYGGLGNNLPSPKRSVELIKTLKAKRVKIYNADPEILTALRNTNIQVSIM  82

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNEI+ NIS++Q LAD WV TN+VPFY +T IRYLLVGNEI+S+     W+ LVPAMRK
Sbjct  83   VPNEILINISTNQTLADEWVHTNLVPFYHDTMIRYLLVGNEIISSTAKPVWYALVPAMRK  142

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+ +++  G+RK+KVGTP AMD+L++S+PPS+G+FRSD++G + KP+LQFL+RT SFFF 
Sbjct  143  IKSALRTHGIRKVKVGTPSAMDVLQSSFPPSNGSFRSDISGPIIKPMLQFLNRTKSFFFV  202

Query  645  DVYPYF  662
            DVYPYF
Sbjct  203  DVYPYF  208



>ref|XP_008382581.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=463

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+++  VG+ YGQLGNNLP PS+S +LI  LKAKRVK+YDANPKIL AL N+D+QVS+MV
Sbjct  20   AELAPKVGVNYGQLGNNLPPPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LAD WV TNVVPFY ET IRYLLVGNEILS P    W+ LVPAMRKI
Sbjct  80   PNELINNISSNQTLADHWVHTNVVPFYPETLIRYLLVGNEILSQPDKQIWYNLVPAMRKI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++K   + K+KVGTPLAMD+LE+S+PPS+G FRSD++G V KPLL+F+++T SFFF D
Sbjct  140  KAALKTHRITKVKVGTPLAMDVLESSFPPSNGTFRSDVSGLVLKPLLKFINKTKSFFFVD  199

Query  648  VYPYF  662
            VY YF
Sbjct  200  VYTYF  204



>ref|XP_004144397.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 ref|XP_004167264.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
 gb|KGN58384.1| hypothetical protein Csa_3G634360 [Cucumis sativus]
Length=466

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS  VGI YGQLGNNLP PS S  LI  L A+ VKIYDANP+IL+AL N+D++VSVMV
Sbjct  20   AEISTLVGINYGQLGNNLPPPSHSVNLIKSLNAQIVKIYDANPQILKALKNTDLRVSVMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS Q LAD+WV TN++PFY +TKIRYLLVGNEI+S+  N TWF LVPAMR+I
Sbjct  80   PNELIINISSSQNLADQWVRTNILPFYPQTKIRYLLVGNEIISSTGNQTWFSLVPAMRRI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+K +G+ K+KVGTP AMD+L++S+PPS+G FR+D+   V +P+LQFL+RT SFFF D
Sbjct  140  KHSLKTYGIHKVKVGTPSAMDVLQSSFPPSNGTFRADIADRVMRPMLQFLNRTKSFFFLD  199

Query  648  VYPYF  662
            VYPYF
Sbjct  200  VYPYF  204



>ref|XP_008356234.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=524

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A++ A VG+ YGQLGNNLP PS+S +LI  L AKRVK+YDANPKIL AL N+D+QVS+MV
Sbjct  72   AELVAKVGVNYGQLGNNLPPPSQSVKLIQSLNAKRVKLYDANPKILAALRNTDLQVSIMV  131

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LAD+WV TNVVPFY +T IRYLLVGNEILS P    WF LVPAMRKI
Sbjct  132  PNELISNISSNQTLADQWVRTNVVPFYPDTLIRYLLVGNEILSQPNKQIWFNLVPAMRKI  191

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++K   + K+KVGTPLAMD+LE+S+PPS+G FRSD++GSV KP+L+F+++T SFFF D
Sbjct  192  KAALKTHRITKVKVGTPLAMDVLESSFPPSNGTFRSDISGSVIKPMLKFINKTKSFFFVD  251

Query  648  VYPYF  662
            +Y YF
Sbjct  252  LYTYF  256



>gb|EPS58986.1| hypothetical protein M569_15824, partial [Genlisea aurea]
Length=453

 Score =   260 bits (665),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 150/183 (82%), Gaps = 1/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +  +GICYG+LGNNLP PS S  LI  LKA RVKIYDANP+IL+AL   ++ VSVM+PN+
Sbjct  15   ATKLGICYGELGNNLPPPSESVRLIEKLKAGRVKIYDANPEILKALKGKNLLVSVMLPNQ  74

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            +IP +++DQ  +D WV  NV PFY  TKIRY+LVGNEILSNPPNTTWF+LVPAM++IR S
Sbjct  75   LIPAVAADQKFSDEWVRKNVAPFYPATKIRYILVGNEILSNPPNTTWFELVPAMKRIRIS  134

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSD-LTGSVFKPLLQFLDRTNSFFFFDVY  653
            V K G++KIK+GTPLAMD+LE+SYPPS+GAFRS  +   V KPLL+FL+RT SFFF DVY
Sbjct  135  VVKLGMKKIKIGTPLAMDVLESSYPPSAGAFRSGVIADDVIKPLLRFLNRTKSFFFVDVY  194

Query  654  PYF  662
            PYF
Sbjct  195  PYF  197



>ref|XP_009372203.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=463

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+++  VG+ YGQLGNNLP PS+S +LI  LKAKRVK+YDANPKIL AL N+D+QVS+MV
Sbjct  20   AELAPKVGVNYGQLGNNLPPPSQSVKLIQSLKAKRVKLYDANPKILTALRNTDLQVSIMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LAD WV TN+VPFY ET IRYLLVGNEILS P    W+ LVPAMRKI
Sbjct  80   PNELINNISSNQTLADHWVYTNLVPFYPETLIRYLLVGNEILSQPDKQVWYNLVPAMRKI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++K   + K+KVGTPLAMD+LE+S+PPS+G FRSD++G V KP+L+F+++T SFFF D
Sbjct  140  KAALKTHRITKVKVGTPLAMDVLESSFPPSNGTFRSDVSGLVLKPMLKFINKTKSFFFVD  199

Query  648  VYPYF  662
            VY YF
Sbjct  200  VYTYF  204



>ref|XP_007049651.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOX93808.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=461

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             +IS+ VGI YGQLG+NLP+P +S +LI  L AKRVKIYDANP IL AL ++++QVS+MV
Sbjct  18   GEISSQVGINYGQLGDNLPSPKQSVKLIQSLGAKRVKIYDANPDILNALKDTNLQVSIMV  77

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PN+++ NIS++Q LAD WVE+NVVPFY +TKIRYLLVGNE++S+ P  TW+ +VPAMRK+
Sbjct  78   PNQLLTNISTNQKLADSWVESNVVPFYPKTKIRYLLVGNEVISSSPKETWYSIVPAMRKL  137

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+K   L KIKVGT +AMD+LE+S+PPS+G FRSD+ G + KP+LQFL RT SF+F D
Sbjct  138  KNSLKIHSLNKIKVGTSMAMDVLESSFPPSNGTFRSDIAGPIVKPMLQFLSRTKSFYFLD  197

Query  648  VYPYF  662
            VYPYF
Sbjct  198  VYPYF  202



>ref|XP_008460404.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=465

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ VGI YGQLGNNLP+PS S  LI  L A+ VKIYDANP+IL AL N+D++VSVMV
Sbjct  20   AEISSLVGINYGQLGNNLPSPSHSVNLIKSLNAQIVKIYDANPQILNALKNTDLRVSVMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+I NISS+Q LAD+WV TN++PFY + KIRYLLVGNEI+S+  N TWF LVPAMR+I
Sbjct  80   PNELIINISSNQNLADQWVRTNILPFYPQIKIRYLLVGNEIISSTGNQTWFSLVPAMRRI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+K +G+ K+KVGT  AMD+L++S+PPS+G FR D+   V +P+LQFL+RT SF+F D
Sbjct  140  KHSLKTYGIHKVKVGTSSAMDVLQSSFPPSNGTFREDIADRVMRPMLQFLNRTKSFYFLD  199

Query  648  VYPYF  662
            VYPYF
Sbjct  200  VYPYF  204



>ref|XP_010036769.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW48410.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
 gb|KCW48411.1| hypothetical protein EUGRSUZ_K02113 [Eucalyptus grandis]
Length=466

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/187 (66%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELI-HGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            A+I + +G+ YGQLGNNLP+P+RS  LI H LKA+RVKIYDANP ILRAL ++ +QVSVM
Sbjct  21   AEILSKIGVNYGQLGNNLPSPTRSVWLIKHQLKAQRVKIYDANPSILRALEHTGIQVSVM  80

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I  I+ +Q LAD WV +NVVPF+  TKIRYLLVGNEILS+  NTTWF LVPAMRK
Sbjct  81   VPNELINAIAVNQTLADSWVGSNVVPFHPATKIRYLLVGNEILSSADNTTWFNLVPAMRK  140

Query  465  IRRSVKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            +++++K+  +  K+KVGTPLAMD+L  SYPPSSG+FR D++  V KP+LQFL+RT SFFF
Sbjct  141  VKKALKRHKVHHKVKVGTPLAMDVLATSYPPSSGSFRPDVSDRVMKPMLQFLNRTKSFFF  200

Query  642  FDVYPYF  662
             DVYPYF
Sbjct  201  IDVYPYF  207



>ref|XP_011024596.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=465

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 149/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA IS+ VGI YGQLGNNLP+PSRS ELI  LKAKRVKIYDANP IL++L N+D+QVS+M
Sbjct  20   GAVISSEVGINYGQLGNNLPSPSRSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIM  79

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPN +IPNIS  Q  +D+WV+TNVVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+
Sbjct  80   VPNALIPNISKSQYFSDQWVKTNVVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRR  139

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  632
            I+ S+ +  +RKIKVGTP A+++LE+S+PPS+G FRSD++G+V KP+LQFL+RT S
Sbjct  140  IKISLTRHNIRKIKVGTPSAINVLESSFPPSNGTFRSDISGTVIKPMLQFLNRTKS  195



>ref|XP_003626949.1| Beta-1 3-glucanase [Medicago truncatula]
 gb|AET01425.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=463

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS   G+ YGQLGNNLPTP+ S  LI  LKAKRVKIYDANP+IL+AL N+ +QVS+M+
Sbjct  23   AEISGQPGVNYGQLGNNLPTPTTSVSLIKNLKAKRVKIYDANPQILKALENTGIQVSIML  82

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE++ N+SS+Q LA++WV+TN+VPFY +T IRYLLVGNE++S+  N TW  +VPAM ++
Sbjct  83   PNELVTNVSSNQTLANQWVQTNLVPFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMYRM  142

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+  FGL K+KVGTPLAMD+L+ S+PPS+G FR+D+  SV KP+L+FL  TNSFFF D
Sbjct  143  KHSLTIFGLHKVKVGTPLAMDVLQTSFPPSNGTFRNDIALSVMKPMLEFLHVTNSFFFLD  202

Query  648  VYPYF  662
            VYP+F
Sbjct  203  VYPFF  207



>gb|KHG25787.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=461

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             + S+ VG+ YGQLGNNLP+P +S +LI  L+AKRVKIYDAN  IL AL  +++QV +MV
Sbjct  18   GEFSSQVGVNYGQLGNNLPSPKQSVKLIQSLRAKRVKIYDANHDILNALKGTNLQVCIMV  77

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI
Sbjct  78   PNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKI  137

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            ++S+K  GL KIKV T +AMD+LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F D
Sbjct  138  KKSLKAHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLD  197

Query  648  VYPYF  662
            VYPYF
Sbjct  198  VYPYF  202



>ref|XP_002303070.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE82343.2| 3-glucanase family protein [Populus trichocarpa]
Length=465

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA IS+ VGI YGQLGNNLP+PSRS ELI  LKAKRVKIYDANP IL++L N+D+QVS+M
Sbjct  20   GAVISSEVGINYGQLGNNLPSPSRSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIM  79

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPN +IPNIS  Q  +D+WV+TNVVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+
Sbjct  80   VPNALIPNISKSQYFSDQWVKTNVVPYYSDVKIRYLLVGNEILTNPDTGTWFNLVPAMRR  139

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  632
            I+ S+ +  +RKIKVGTP A+++LE+S+PPS+G FR D++G+V KP+LQFL+RT S
Sbjct  140  IKISLTRHNIRKIKVGTPSAINVLESSFPPSNGTFRPDISGTVIKPMLQFLNRTKS  195



>gb|KJB10878.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=461

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             + S+ VG+ YGQLGNNLP+P +S +LI  L AKRVKIYDAN  IL AL  +++QV +MV
Sbjct  18   GEFSSQVGVNYGQLGNNLPSPKQSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMV  77

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI
Sbjct  78   PNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKI  137

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            ++S+K  GL KIKV T +AMD+LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F D
Sbjct  138  KKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLD  197

Query  648  VYPYF  662
            VYPYF
Sbjct  198  VYPYF  202



>gb|KJB10879.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=460

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             + S+ VG+ YGQLGNNLP+P +S +LI  L AKRVKIYDAN  IL AL  +++QV +MV
Sbjct  18   GEFSSQVGVNYGQLGNNLPSPKQSVKLIQSLGAKRVKIYDANHDILNALKGTNLQVCIMV  77

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMRKI
Sbjct  78   PNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMRKI  137

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            ++S+K  GL KIKV T +AMD+LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F D
Sbjct  138  KKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYFLD  197

Query  648  VYPYF  662
            VYPYF
Sbjct  198  VYPYF  202



>gb|KEH22559.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=463

 Score =   250 bits (639),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  129  GICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPN  308
            GICYGQLGNNLP PS+S  LI  L AKR+KIYD NP+IL  L N+++QVS+M+PNE+I N
Sbjct  27   GICYGQLGNNLPKPSKSLSLIKSLNAKRIKIYDTNPQILTTLKNTNIQVSIMLPNELITN  86

Query  309  ISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKF  488
            ISS+Q L+D+W+++N++P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR+I+ S+KKF
Sbjct  87   ISSNQTLSDQWIKSNILPYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMRRIKHSLKKF  146

Query  489  GLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
             +++IKVGT  AMD+LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF DVYP+F
Sbjct  147  RVKRIKVGTSSAMDVLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFFLDVYPFF  204



>ref|XP_004492271.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=463

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +S+  GICYGQLGNNLP P  S  LI  L +KR+KIYD NP+IL +L N+++QVS+M+PN
Sbjct  22   LSSQPGICYGQLGNNLPKPQNSISLIKSLNSKRIKIYDTNPQILTSLKNTNIQVSIMLPN  81

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
            E+I NIS++Q L+D+W+++NVVPFY +T IRYLL+GNEI+S+ PN+TW  LVPAMR+I+ 
Sbjct  82   ELITNISTNQTLSDQWIKSNVVPFYPQTLIRYLLIGNEIISSTPNSTWPHLVPAMRRIKH  141

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            S+KKF ++KIKVGT  AMD+LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF DVY
Sbjct  142  SLKKFRIKKIKVGTSSAMDVLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFFLDVY  201

Query  654  PYF  662
            P+F
Sbjct  202  PFF  204



>gb|KFK38190.1| hypothetical protein AALP_AA3G081000 [Arabis alpina]
Length=462

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            G+  S   GI YGQLGNNLPTPS S +LI  L AKRVK+YDANPKIL AL ++D+ VSVM
Sbjct  19   GSKFSGRPGINYGQLGNNLPTPSDSIKLIQSLNAKRVKLYDANPKILTALNSTDISVSVM  78

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NIS    L+D WV++ ++PFY  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  79   VPNELIINISKSNTLSDEWVKSKILPFYPTTKIRYLLVGNEILSSQNSQLKSSLVPAMRK  138

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++KIKVGT LA+D+L+ S+PPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  139  IQRSLKTLGVKKIKVGTTLAVDVLQTSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  198

Query  645  DVYPYF  662
            DVYPYF
Sbjct  199  DVYPYF  204



>dbj|BAA89481.1| beta-1,3-glucanase [Salix gilgiana]
Length=478

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA+IS+ VGI YG+LGN+LP+PS+S ELI  LKAKRVKIYDANP IL++L N+D+QVS+M
Sbjct  33   GAEISSEVGINYGRLGNDLPSPSKSVELIKSLKAKRVKIYDANPDILKSLKNTDIQVSIM  92

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPN +IPN+S+ Q  +D+WVETNVVP+Y + KIRYLLVGNEIL+NP   TWF LVPAMR+
Sbjct  93   VPNALIPNMSTSQHFSDQWVETNVVPYYPDVKIRYLLVGNEILTNPDTGTWFNLVPAMRR  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNS  632
            I+ S+ +   RKIKVGTP A+++LE+S PPS+G FRSD++G V KP+LQFL+RT S
Sbjct  153  IKISLTRRNFRKIKVGTPSAINVLESSSPPSNGTFRSDVSGPVIKPMLQFLNRTKS  208



>ref|XP_010247391.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   246 bits (627),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 150/188 (80%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YG+LGNNLP+PSRS E I  L+A R+K+YDANP+IL AL  +++QVS+MV
Sbjct  19   AEISSKMGINYGRLGNNLPSPSRSIEFIKTLEAGRIKLYDANPEILNALAWTNIQVSIMV  78

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN++I NISS QA+AD WV TNV+PFY +T IR+LLVGNEI    S+    TW+ LV AM
Sbjct  79   PNQLISNISSSQAVADEWVRTNVIPFYSKTLIRHLLVGNEIFNFYSDEDRQTWYNLVLAM  138

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+I+ S+  + +R IKVGTP+AMD+LE ++PPS+GAFRSD+   V KPLLQFL+RT SFF
Sbjct  139  RRIKHSLSTYNIRNIKVGTPVAMDILETAFPPSNGAFRSDIAVPVMKPLLQFLNRTRSFF  198

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  199  FLDVYPYF  206



>ref|XP_002884642.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60901.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+P+ S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPADSVNLIKSLNAKRVKLYDANPKILTALNGTDITVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NIS  ++L+D W+ +N++PFY  TKIRYLLVGNEILS P +     LVPAMRK
Sbjct  77   VPNELIVNISKSESLSDDWIRSNILPFYPTTKIRYLLVGNEILSFPDSELKSSLVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L++S+PPSSG FRSD++G V KP+LQFL+RT SF F 
Sbjct  137  IQRSLKSLGVKKVKVGTTLAVDVLQSSFPPSSGEFRSDISGLVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>emb|CDY28063.1| BnaC05g44650D [Brassica napus]
Length=460

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AK VK+YDANP IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPSDSVSLIKSLNAKSVKLYDANPSILAALKATDIVVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NI+  + L+D WV++NV+PFY  TKIRYLLVGNEILS+P +     LVPAMRK
Sbjct  77   VPNELIVNITKSKTLSDDWVKSNVLPFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L +SYPPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  137  IQRSLKTLGVKKVKVGTTLAVDVLNSSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_003632052.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Vitis 
vinifera]
 emb|CBI39470.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 149/186 (80%), Gaps = 1/186 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS  VG+ YG LGNNLP  SRS +LI GLKA RVK+YD NP+IL AL  +++QVS+MV
Sbjct  23   AEISPKVGVNYGLLGNNLPAASRSVQLIKGLKAGRVKLYDPNPEILEALSGTELQVSIMV  82

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRK  464
            PN+ I NIS  Q L+D+WV+TNVVP+Y ET IRY+LVGNE+LS       W  LVPAMR+
Sbjct  83   PNQQISNISRSQKLSDQWVKTNVVPYYPETMIRYVLVGNEVLSLYDQKQGWPDLVPAMRR  142

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+ S++KF + K+KVGTPLAMD+LE+S+PPS+G FRSD++ SV KPLLQFL+RT SFFF 
Sbjct  143  IKGSLRKFHIHKVKVGTPLAMDVLESSFPPSNGTFRSDISVSVVKPLLQFLNRTKSFFFL  202

Query  645  DVYPYF  662
            DVYPYF
Sbjct  203  DVYPYF  208



>ref|XP_006407848.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49301.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=469

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   GI YGQLGNNLP+PS S +LI  L AKRVK+YDANP IL AL  +D+ VSVM
Sbjct  26   GAKFSGRPGINYGQLGNNLPSPSDSVKLIKSLNAKRVKLYDANPTILAALNATDIAVSVM  85

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPN++I NIS   +L+D W+ +N++PFY +TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  86   VPNQLIVNISKSDSLSDDWIRSNILPFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRK  145

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L++S+PPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  146  IQRSLKTLGVKKVKVGTSLAVDVLQSSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  205

Query  645  DVYPYF  662
            DVYPYF
Sbjct  206  DVYPYF  211



>ref|XP_006407849.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
 gb|ESQ49302.1| hypothetical protein EUTSA_v10020660mg [Eutrema salsugineum]
Length=470

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   GI YGQLGNNLP+PS S +LI  L AKRVK+YDANP IL AL  +D+ VSVM
Sbjct  26   GAKFSGRPGINYGQLGNNLPSPSDSVKLIKSLNAKRVKLYDANPTILAALNATDIAVSVM  85

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPN++I NIS   +L+D W+ +N++PFY +TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  86   VPNQLIVNISKSDSLSDDWIRSNILPFYPDTKIRYLLVGNEILSSTDSELKSALVPAMRK  145

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L++S+PPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  146  IQRSLKTLGVKKVKVGTSLAVDVLQSSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  205

Query  645  DVYPYF  662
            DVYPYF
Sbjct  206  DVYPYF  211



>emb|CDY24629.1| BnaA05g30280D [Brassica napus]
Length=460

 Score =   243 bits (621),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AK VK+YDANP IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPSDSVTLIKSLNAKSVKLYDANPSILAALNATDIVVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NI+  + L+D W+++NV+PFY  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  77   VPNELIVNITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LAMD+L +SYPPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  137  IQRSLKTLGVKKVKVGTTLAMDVLNSSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_009147086.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=501

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AK VK+YDANP IL AL  +D+ VSVM
Sbjct  58   GAKFSGRPGVNYGQLGNNLPSPSDSVTLIKSLNAKSVKLYDANPSILAALNATDIVVSVM  117

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NI+  + L+D W+++NV+PFY  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  118  VPNELIVNITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSQDSELKSALVPAMRK  177

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LAMD+L +SYPPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  178  IQRSLKTLGVKKVKVGTTLAMDVLNSSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  237

Query  645  DVYPYF  662
            DVYPYF
Sbjct  238  DVYPYF  243



>ref|XP_006297636.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
 gb|EOA30534.1| hypothetical protein CARUB_v10013655mg [Capsella rubella]
Length=460

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNATDITVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS  ++L+D W+ +N++PFY  TKIRYLLVGNEILS+P +     LVPAMRK
Sbjct  77   VPNELLVNISKSESLSDDWIRSNILPFYPTTKIRYLLVGNEILSSPDSELKASLVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L+ S+PPS G FR D++G V KP+LQFL+RT SF F 
Sbjct  137  IQRSLKSLGVKKVKVGTSLAVDVLQTSFPPSKGEFREDISGLVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_010486278.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  18   GAKFSGRPGVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILSALNATDITVSVM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS  + L+D W+ +N++PFY  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  78   VPNELLVNISKSETLSDDWIRSNILPFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRK  137

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L+ S+PPSSG F+ D++GSV KP+LQFL+RT SF F 
Sbjct  138  IQRSLKSLGVKKVKVGTSLAVDVLKTSFPPSSGEFKEDISGSVMKPMLQFLNRTKSFLFI  197

Query  645  DVYPYF  662
            DVYPYF
Sbjct  198  DVYPYF  203



>gb|AAF20214.1|AC012395_1 putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
Length=440

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   GI YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  18   GAKFSGRPGINYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNGTDITVSVM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS   +L+D W+ +N++PFY  TKIRYLLVGNEILS P +     LVPAMRK
Sbjct  78   VPNELLVNISKSASLSDDWIRSNILPFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRK  137

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA D+L++S+PPSSG FR D++G + KP+LQFL+RT SF F 
Sbjct  138  IQRSLKSLGVKKVKVGTTLATDVLQSSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFV  197

Query  645  DVYPYF  662
            DVYPYF
Sbjct  198  DVYPYF  203



>ref|XP_006484802.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Citrus sinensis]
Length=466

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 146/187 (78%), Gaps = 2/187 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAEL-IHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            A++S+ VG+CYGQLGNNLP+P  S EL I  LKA RVKIYDANPKIL+AL N+D+QVS+M
Sbjct  21   AEMSSKVGVCYGQLGNNLPSPQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIM  80

Query  285  VPNEIIPNISSDQALADR-WVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            VPNEII NIS         WV TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMR
Sbjct  81   VPNEIINNISLSSQSLSDQWVRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMR  140

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            KIR+S+K  G RKIKVGTP AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF
Sbjct  141  KIRKSLKTLGARKIKVGTPSAMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFF  200

Query  642  FDVYPYF  662
             D Y +F
Sbjct  201  VDAYTFF  207



>ref|NP_683538.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AAF02143.1|AC009853_3 putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
 dbj|BAC42699.1| putative beta-1,3-glucanase precursor [Arabidopsis thaliana]
 gb|AAO64098.1| putative glycosyl hydrolase [Arabidopsis thaliana]
 gb|AEE74528.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=460

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   GI YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  18   GAKFSGRPGINYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNGTDITVSVM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS   +L+D W+ +N++PFY  TKIRYLLVGNEILS P +     LVPAMRK
Sbjct  78   VPNELLVNISKSASLSDDWIRSNILPFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRK  137

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA D+L++S+PPSSG FR D++G + KP+LQFL+RT SF F 
Sbjct  138  IQRSLKSLGVKKVKVGTTLATDVLQSSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFV  197

Query  645  DVYPYF  662
            DVYPYF
Sbjct  198  DVYPYF  203



>ref|XP_006437250.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
 gb|ESR50490.1| hypothetical protein CICLE_v10031440mg [Citrus clementina]
Length=466

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 146/187 (78%), Gaps = 2/187 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAEL-IHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            A++S+ VG+CYGQLGNNLP+P  S EL I  LKA RVKIYDANPKIL+AL N+D+QVS+M
Sbjct  21   AEMSSKVGVCYGQLGNNLPSPQESVELMIKSLKATRVKIYDANPKILKALKNTDIQVSIM  80

Query  285  VPNEIIPNISSDQALADR-WVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            VPNEII NIS         WV TNV+P+   TKIRYLLVGNEILS P  + W  LVPAMR
Sbjct  81   VPNEIINNISLSSQSLSDQWVRTNVLPYLPGTKIRYLLVGNEILSLPDKSIWPNLVPAMR  140

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            KIR+S+K  G RKIKVGTP AMD+L++S+PPS+G FRSD++ SV +P+L FL+RT SFFF
Sbjct  141  KIRKSLKTLGARKIKVGTPSAMDVLQSSFPPSNGTFRSDISESVMRPMLHFLNRTKSFFF  200

Query  642  FDVYPYF  662
             D Y +F
Sbjct  201  VDAYTFF  207



>gb|KJB84083.1| hypothetical protein B456_N004800 [Gossypium raimondii]
Length=464

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             +IS+ VGI YGQLG+NLP+P +S +LI  + A RVKIYDANP IL AL  +D+QVS+MV
Sbjct  21   GEISSQVGINYGQLGDNLPSPEKSVKLIQSIGANRVKIYDANPDILNALRGTDLQVSIMV  80

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PN+ + NIS++Q LAD W+++NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI
Sbjct  81   PNQHLTNISTNQKLADSWIQSNVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKI  140

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++    L KIKVGT +AMD+LE+S+PPS+G FRSD+   + KP+LQFL RT SF+F D
Sbjct  141  KNALNTHRLNKIKVGTSMAMDVLESSFPPSNGTFRSDIADPIVKPMLQFLSRTKSFYFLD  200

Query  648  VYPYF  662
            VYPYF
Sbjct  201  VYPYF  205



>gb|KHN10950.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=397

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 144/179 (80%), Gaps = 1/179 (1%)
 Frame = +3

Query  129  GICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPN  308
            GICYGQLG+NLP P +S  LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN++I N
Sbjct  30   GICYGQLGDNLPPPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPNDLIVN  89

Query  309  ISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSVKK  485
            IS +Q+L+D+WV  NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+ S+K 
Sbjct  90   ISRNQSLSDKWVSDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIKHSLKS  149

Query  486  FGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
             G+RK+KVGT  A+D+LEAS+PPS+GAFR DL+  V KP+L+FL+RT SFFF DVYP+F
Sbjct  150  LGIRKVKVGTSSAIDVLEASFPPSNGAFRKDLSAPVMKPMLKFLNRTKSFFFLDVYPFF  208



>emb|CDY45466.1| BnaC09g12840D [Brassica napus]
Length=460

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AK VK+YDANP IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPSDSVSLIKSLNAKSVKLYDANPSILAALNATDIVVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NI+  + L+D W+++NV+PFY  TKIRYLLVGNEILS+P +     LVPAMRK
Sbjct  77   VPNELIVNITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSPDSELKSALVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L +SYPPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  137  IQRSLKTLGVKKVKVGTTLAVDVLNSSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPY  659
            DVYP+
Sbjct  197  DVYPF  201



>ref|XP_010464351.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL ++D+ VSVM
Sbjct  18   GAKFSGRPGVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILTALNSTDITVSVM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS  + L+D W+ +N++PFY  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  78   VPNELLVNISKSETLSDDWIRSNILPFYPTTKIRYLLVGNEILSSTDSELKASLVPAMRK  137

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L+ S+PPSSG F+ D++G V KP+LQFL+RT SF F 
Sbjct  138  IQRSLKSLGVKKVKVGTSLAVDVLKTSFPPSSGEFKEDISGLVMKPMLQFLNRTKSFLFV  197

Query  645  DVYPYF  662
            DVYPYF
Sbjct  198  DVYPYF  203



>gb|AAM65039.1| putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
Length=460

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   GI YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  18   GAKFSGRPGINYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNGTDITVSVM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS   +L+D W+ +N++PFY  TKIRYLLVGNEILS P +     LVPAMRK
Sbjct  78   VPNELLVNISKSASLSDDWIRSNILPFYPTTKIRYLLVGNEILSLPDSELKSSLVPAMRK  137

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+ S+K  G++K+KVGT LA D+L++S+PPSSG FR D++G + KP+LQFL+RT SF F 
Sbjct  138  IQHSLKSLGVKKVKVGTTLATDVLQSSFPPSSGEFREDISGLIMKPMLQFLNRTKSFLFV  197

Query  645  DVYPYF  662
            DVYPYF
Sbjct  198  DVYPYF  203



>gb|KHG02504.1| putative glucan endo-1,3-beta-glucosidase A6 -like protein [Gossypium 
arboreum]
Length=464

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 146/185 (79%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
             +IS+ VGI YGQLG+NLP+P +S +LI  + AKRVKIYDANP IL AL  +D+QVS+MV
Sbjct  21   GEISSQVGINYGQLGDNLPSPEKSVKLIQSIGAKRVKIYDANPDILNALRGTDLQVSIMV  80

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PN+ + NIS++Q LAD W+++NV+PFY + KIRYLLVGNE++S+ P   W+ +VPAMRKI
Sbjct  81   PNQHLTNISTNQKLADSWIQSNVLPFYPKVKIRYLLVGNEVISSSPKEIWYSIVPAMRKI  140

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++    L KIKVGT +AM +LE+S+PPS+G FRSD+   + KP+LQFL RT SF+F D
Sbjct  141  KNALNTHRLNKIKVGTSMAMGVLESSFPPSNGTFRSDIAYPIVKPMLQFLSRTKSFYFLD  200

Query  648  VYPYF  662
            VYPYF
Sbjct  201  VYPYF  205



>ref|XP_010451138.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=461

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 143/186 (77%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+PS S  LI  L AKRVK+YDANPKIL AL  +D+ VSVM
Sbjct  18   GAKFSGRPGVNYGQLGNNLPSPSDSVNLIKSLNAKRVKLYDANPKILAALNATDITVSVM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE++ NIS  + L+D W+ +N++PFY  TKIRYLLVGNEILS   +     LVPAMRK
Sbjct  78   VPNELLVNISKSETLSDDWIRSNILPFYPTTKIRYLLVGNEILSFTDSELKASLVPAMRK  137

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+K  G++K+KVGT LA+D+L+ S+PPSSG FR D++G V KP+LQFL+RT SF F 
Sbjct  138  IQRSLKSLGVKKVKVGTSLAVDVLKTSFPPSSGEFREDISGLVMKPMLQFLNRTKSFLFV  197

Query  645  DVYPYF  662
            DVYPYF
Sbjct  198  DVYPYF  203



>gb|KDP45279.1| hypothetical protein JCGZ_15144 [Jatropha curcas]
Length=464

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            ++IS  +GI +G LGNNLP P  + ELI  LKAKRVKIY A+ +IL AL N+D+QVS+M+
Sbjct  20   SEISNKIGINWGTLGNNLPPPPHTVELIKSLKAKRVKIYSADQEILTALKNTDIQVSIML  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE+IPN+S  Q  +D WV+ NVV F  + KIRYLLVGNEIL+NP   TWF LVPAMR+I
Sbjct  80   PNELIPNVSKSQHFSDHWVKNNVVRFLPDVKIRYLLVGNEILTNPDVGTWFNLVPAMRRI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S++ + + K+KVGTP A+++LE+S+PPS+G FRSD+   + +P+LQFL+RT SFFF D
Sbjct  140  KCSLRAYKIHKVKVGTPSALNVLESSFPPSNGTFRSDIADPIMRPMLQFLNRTKSFFFLD  199

Query  648  VYPYF  662
            VYPYF
Sbjct  200  VYPYF  204



>ref|XP_003530849.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 145/184 (79%), Gaps = 1/184 (1%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
             S   GICYGQLG+NLP P +S  LI  L AKRVK+YDANP IL AL ++ +QVS+MVPN
Sbjct  25   FSTHPGICYGQLGDNLPPPQKSVSLITSLHAKRVKLYDANPAILHALRDTSLQVSIMVPN  84

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIR  470
            ++I NIS +Q+L+D+WV  NVVP++  T IRYLLVGNE+ S+  PN TW  LVPAMR+I+
Sbjct  85   DLIVNISRNQSLSDKWVSDNVVPYHPRTLIRYLLVGNEVTSSTAPNGTWPYLVPAMRRIK  144

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S+K  G+RK+KVGT  A+D+LEAS+PPS+GAFR DL+  V KP+L+FL+RT SFFF DV
Sbjct  145  HSLKSLGIRKVKVGTSSAIDVLEASFPPSNGAFRKDLSAPVMKPMLKFLNRTKSFFFLDV  204

Query  651  YPYF  662
            YP+F
Sbjct  205  YPFF  208



>ref|XP_010246533.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=466

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 147/188 (78%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS  +G+ YGQLGNNLP+PSRS ELI  LKA RVK+YDANP IL+AL  +++ VS+MV
Sbjct  19   AEISKKMGVNYGQLGNNLPSPSRSIELIKSLKAGRVKLYDANPDILKALEGTNIHVSIMV  78

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN++I NISS Q+LA+ WV TNVVPFY +T IRYLLVGNEI    S+    TW+ LV AM
Sbjct  79   PNQLISNISSSQSLANEWVRTNVVPFYPKTLIRYLLVGNEIFSFYSDQDRQTWYDLVQAM  138

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+++ S+K   +R IK+GT  AMD+L++S+PPS+G FRSD++  V KPLLQFL+RT S+F
Sbjct  139  RRLKYSLKIHSIRNIKIGTTAAMDVLQSSFPPSNGTFRSDISIPVMKPLLQFLNRTKSYF  198

Query  639  FFDVYPYF  662
            F D YPYF
Sbjct  199  FLDAYPYF  206



>emb|CDO96794.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            VG+CYGQLGNNLP PS+S +L+  L A +VK+YDANPKIL AL  S + ++VMVPNE+I 
Sbjct  28   VGVCYGQLGNNLPAPSQSVQLLQKLNATQVKLYDANPKILNALIGSKLYITVMVPNELII  87

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
            NISS+Q LA++WV+ NV+P+Y    IRY+LVGNE+LS      WF LVPA+++I +SVK 
Sbjct  88   NISSNQTLANQWVQNNVIPYYPRAMIRYILVGNEVLSYYFKPLWFYLVPAVKRIHQSVKT  147

Query  486  FGLRKIKVGTPLAMDMLEAS-YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            FGL  +KVGTPLA+DMLE+S   PS+G FRSD+ G V KPLLQFL++TNSFFF D+YPYF
Sbjct  148  FGLSNVKVGTPLAIDMLESSVLLPSNGTFRSDIAGKVVKPLLQFLNQTNSFFFVDLYPYF  207



>ref|XP_004510238.1| PREDICTED: putative copper-transporting ATPase HMA5-like [Cicer 
arietinum]
Length=1239

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            I+  VG+ YGQLGNNLPTP  S  LI  LKAKRVKIYDANP+IL+AL N+ +QVS+M+PN
Sbjct  801  IANEVGVNYGQLGNNLPTPKTSISLIKNLKAKRVKIYDANPQILKALENTGLQVSIMIPN  860

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
            ++I +IS +Q L+++WV++N+VPFY +T IRYLLVGNE++S+  N TW  +VPAM +I+ 
Sbjct  861  QLITDISLNQTLSNQWVQSNLVPFYPKTLIRYLLVGNELISSTTNQTWPHIVPAMHRIKN  920

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            S+  FGL K+KVGTPLAMD+L+ S+PPS+G FR+D+  +V KP+L+FL+ TNSFFF DVY
Sbjct  921  SLTNFGLHKVKVGTPLAMDILQTSFPPSNGIFRNDIAFTVIKPMLEFLNITNSFFFLDVY  980

Query  654  PYF  662
            P+F
Sbjct  981  PFF  983



>ref|XP_010547131.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 138/186 (74%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLGNNLP+P+ S +LI  L A RVKIYDAN  IL+AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGNNLPSPTESVKLIKSLNATRVKIYDANHSILKALNGTDIAVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNEII N+S  QA +D WV   ++PFY  TKIRYLLVGNE+LSNP       LV AM K
Sbjct  77   VPNEIIVNVSKSQAQSDDWVRNKILPFYPTTKIRYLLVGNEVLSNPDPALRSGLVSAMCK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+ S+K+FG+ K+KVGT LAMD+L+ SYPPSSG FR D+ G V KP+LQFL++T SF F 
Sbjct  137  IKHSLKRFGVHKVKVGTTLAMDVLQTSYPPSSGEFRPDIAGRVMKPMLQFLNKTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_010685101.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=467

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
             A  S  VG+ YG LGNNLP PS+S ELI  LKA RVK+Y+ +P+IL+AL  +++QVS+M
Sbjct  18   AAAFSPKVGVNYGTLGNNLPKPSKSVELIKSLKAGRVKLYNPDPEILKALNGTNIQVSIM  77

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPA  455
            VPNEII NIS++Q +A+ WV  N+V +Y  T IRYLLVGNEILS        TW  LVPA
Sbjct  78   VPNEIISNISTNQTMANEWVHKNLVAYYPHTLIRYLLVGNEILSLMGEADKKTWHDLVPA  137

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            MRK++ ++K  G+RK+KVGT +AMD+LE+S+PPS+G FRSD+  SV +PLLQFL+ T SF
Sbjct  138  MRKLQYALKIHGIRKVKVGTTMAMDVLESSFPPSNGTFRSDIAVSVMRPLLQFLNNTKSF  197

Query  636  FFFDVYPYF  662
            FF D YPYF
Sbjct  198  FFIDCYPYF  206



>ref|XP_004298215.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Fragaria 
vesca subsp. vesca]
Length=380

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 144/189 (76%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
             A+IS+ +GI YGQ+GNNLP+P+RS ELI  +K  RVK+YDANP+ILR L  +++ VS+M
Sbjct  17   AAEISSKIGINYGQIGNNLPSPNRSVELIKSMKIGRVKLYDANPEILRLLSGTNISVSIM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPA  455
            VPN  I  I+SDQ+ AD W+  NV+P+Y ET IRYLLVGNEIL   S+     W  +VPA
Sbjct  77   VPNNEITGIASDQSKADEWIRNNVLPYYPETMIRYLLVGNEILSYFSDQDRRLWHDVVPA  136

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            M KI+ S++   +  IK+GTPLAMD+L+ S+PPSSGAFRSD++ +V  PLL+FL+RT SF
Sbjct  137  MTKIKHSLRAKNITNIKIGTPLAMDVLQTSFPPSSGAFRSDVSETVIVPLLRFLNRTKSF  196

Query  636  FFFDVYPYF  662
            FF DVYP+F
Sbjct  197  FFIDVYPFF  205



>ref|XP_010552026.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=460

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 141/186 (76%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLG++LP+P+ S +LI  L A RVKIYDA+  IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGDSLPSPTESVKLIRSLNATRVKIYDADHSILEALNGTDIAVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NIS  +  +D WV TNV+PFY  TKI YLLVGNE+LSNP       LVPAMRK
Sbjct  77   VPNEMIVNISKSRTQSDNWVLTNVLPFYPTTKILYLLVGNEVLSNPHPELRSGLVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I++S+K+ G+ K+KVGT LAMD+L+ SYPPSSG FRSD++G V KP+LQFL++T SF F 
Sbjct  137  IKQSLKRLGVHKVKVGTTLAMDVLQTSYPPSSGEFRSDISGLVMKPMLQFLNKTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_003541516.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=391

 Score =   228 bits (581),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 142/185 (77%), Gaps = 3/185 (2%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S+ +G+ YGQLGNNLP+P RS EL+  +KA RVKIYDANP+ILR L N+ ++VS+M+PN 
Sbjct  20   SSNIGVNYGQLGNNLPSPHRSIELLTTMKAGRVKIYDANPEILRLLSNTKLKVSIMIPNN  79

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKI  467
             I  I+++Q++AD WV  NV+P+Y  T IRYLL+GNE+L   S   +  W  LVPAMR I
Sbjct  80   EISGIAANQSIADEWVRNNVLPYYPNTMIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
             RS++   +R IK+GTPLAMD+L++++PPSS AFRSD+  SV  P+L+FLD+T SFFF D
Sbjct  140  ERSLRAQNIRDIKIGTPLAMDVLQSTFPPSSSAFRSDIRDSVMVPMLKFLDQTKSFFFID  199

Query  648  VYPYF  662
            VYPYF
Sbjct  200  VYPYF  204



>ref|XP_007140788.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
 gb|ESW12782.1| hypothetical protein PHAVU_008G142200g [Phaseolus vulgaris]
Length=465

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A  S   GICYGQLG+NLP   +S   +  L AKRVK+YDANP IL AL ++ +QVSVMV
Sbjct  22   ATFSPQPGICYGQLGDNLPPARQSVSHLTSLHAKRVKLYDANPAILHALQHTRLQVSVMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PN++I NISS+Q LAD+WV +NV  F   T+IRY+LVGNEI+S+  N TW  +VPAMR+I
Sbjct  82   PNDLIMNISSNQTLADKWVSSNVAAFLPNTRIRYILVGNEIISSTTNATWRHVVPAMRRI  141

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + ++K  G+RK+KVGT  AMD+L+ S+PPS+ AFR D+   V KP+L+FL+RT SFFF D
Sbjct  142  KHALKSLGIRKVKVGTSSAMDVLQTSFPPSNAAFREDIAVPVMKPMLKFLNRTKSFFFLD  201

Query  648  VYPYF  662
            VYP+F
Sbjct  202  VYPFF  206



>ref|XP_003552101.2| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Glycine max]
Length=467

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = +3

Query  129  GICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPN  308
            GICYGQLG+NLP P  S  LI  + AKRVK+YDANP IL AL ++ +QVS+MVPN++I N
Sbjct  30   GICYGQLGDNLPPPRESVSLITSVHAKRVKLYDANPSILHALQDTRLQVSIMVPNDLILN  89

Query  309  ISSDQALADRWVETNVVPFYGETKIRYLLVGNEI-LSNPPNTTWFQLVPAMRKIRRSVKK  485
            IS++Q L+D+WV  NVVP++  T IRYLLVGNE+  +     TW  LVPAMR+I+RS+K 
Sbjct  90   ISTNQTLSDQWVSDNVVPYHPRTLIRYLLVGNEVTSTTAATATWPHLVPAMRRIKRSLKS  149

Query  486  FGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
             G+RKIKVGT  AMD+L+ S+PPS+GAFR DLT  V KP+L+FL+RT SFFF DVYP+F
Sbjct  150  HGIRKIKVGTSSAMDVLQTSFPPSNGAFRKDLTAPVMKPMLKFLNRTKSFFFLDVYPFF  208



>ref|XP_007153895.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
 gb|ESW25889.1| hypothetical protein PHAVU_003G073900g [Phaseolus vulgaris]
Length=368

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +S+ +G+ YGQLGNNLP+P RS EL+  +KA  VK+YDANP+ILR L  + ++VS+M+PN
Sbjct  19   VSSNIGVNYGQLGNNLPSPQRSIELLTSMKAGLVKLYDANPEILRLLSTTKLKVSIMIPN  78

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I  I+++Q++AD WV  NV+P+Y +T IRYLLVGNE+L   S   +  W  LVPAMR 
Sbjct  79   NEIAGIATNQSMADEWVRNNVLPYYPKTLIRYLLVGNEVLSYNSEQGHQMWNDLVPAMRN  138

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I RS+K   +R IK+GTPLAMD+L++++PPSSG FR D+  SV  P+L+FL+RT SFFF 
Sbjct  139  IERSLKGQNIRDIKIGTPLAMDVLQSTFPPSSGTFRPDVRDSVMAPMLKFLNRTKSFFFI  198

Query  645  DVYPYF  662
            D+YPYF
Sbjct  199  DIYPYF  204



>ref|XP_004505110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cicer arietinum]
Length=462

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 140/189 (74%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA   + +G+ YG LGNNLP+P RS EL+  +KA RVK+YDANP ILR L  + ++VS+M
Sbjct  16   GAKAYSNIGVNYGVLGNNLPSPYRSIELLTIMKAARVKLYDANPDILRLLSTTKLKVSIM  75

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPA  455
            +PN  I  I+++Q++AD WV  NVVPFY +T IR+LLVGNE+L   S   +  W  LVPA
Sbjct  76   IPNHEISGIAANQSIADEWVRNNVVPFYPKTMIRFLLVGNEVLSYNSEQGHKMWHDLVPA  135

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            MR I+RS+K   +R IK+GTPLAMD+L++++PPS G FRSD+  SV  P+L+FLDRT SF
Sbjct  136  MRSIKRSLKSLNIRDIKIGTPLAMDVLQSTFPPSRGTFRSDIRDSVIVPMLKFLDRTKSF  195

Query  636  FFFDVYPYF  662
            FF D YPYF
Sbjct  196  FFIDAYPYF  204



>emb|CAN60692.1| hypothetical protein VITISV_007558 [Vitis vinifera]
Length=404

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 144/188 (77%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+I + +G+ YGQLG+NLP+PS+S ELI  +KA RVK+YDANP+IL  L  + +QVS+MV
Sbjct  17   AEIPSKIGVNYGQLGDNLPSPSQSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMV  76

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN+ I NISS+Q LAD+WV  NV+ +Y +T IR+++VGNE+L   S+    TW  LVPAM
Sbjct  77   PNQEISNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAM  136

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+I++S++   +  IKVGT +AMD++E+S+PPSSG FRSD+  +V  PLL+FL  TNSFF
Sbjct  137  RRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDILDTVMVPLLEFLSGTNSFF  196

Query  639  FFDVYPYF  662
            F DVYPY 
Sbjct  197  FLDVYPYL  204



>gb|ADE76604.1| unknown [Picea sitchensis]
Length=462

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = +3

Query  123  TVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEII  302
            T+G+ YGQLG+NLP+   +  LI  +KA RVKIYD NP+IL+AL ++ ++VSVMV NE I
Sbjct  28   TIGVDYGQLGDNLPSTQEAIHLIQRMKAGRVKIYDTNPEILKALSHTGIKVSVMVKNEDI  87

Query  303  PNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRSV  479
             N+SS+Q+ A++WV+ NVV FY  T+I  +LVGNEILS+   N TW+QLVPAM +IRR++
Sbjct  88   ANVSSNQSFANKWVKNNVVYFYPATRINIILVGNEILSDYSNNQTWYQLVPAMLRIRRAL  147

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
             ++ L  IKVGTPLAMD+L  S+PPSSG FR D+  +V KP+L+FL RT S+FF DVYPY
Sbjct  148  LRYKLHHIKVGTPLAMDVLNTSFPPSSGIFRDDVAETVMKPMLEFLSRTRSYFFIDVYPY  207

Query  660  F  662
            F
Sbjct  208  F  208



>ref|XP_003632055.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6 [Vitis vinifera]
Length=474

 Score =   222 bits (566),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 144/188 (77%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+I + +G+ YGQLG+NLP+PS+S ELI  +KA RVK+YDANP+IL  L  + +QVS+MV
Sbjct  29   AEIPSKIGVNYGQLGDNLPSPSQSIELIKSMKAGRVKLYDANPEILNLLSGTKIQVSIMV  88

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN+ I NISS+Q LAD+WV  NV+ +Y +T IR+++VGNE+L   S+    TW  LVPAM
Sbjct  89   PNQEISNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLSYYSDRDRETWSNLVPAM  148

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+I++S++   +  IKVGT +AMD++E+S+PPSSG FRSD+  +V  PLL+FL  TNSFF
Sbjct  149  RRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDILDTVMVPLLEFLSGTNSFF  208

Query  639  FFDVYPYF  662
            F DVYPY 
Sbjct  209  FLDVYPYL  216



>ref|XP_007221306.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
 gb|EMJ22505.1| hypothetical protein PRUPE_ppa016789mg, partial [Prunus persica]
Length=452

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 139/189 (74%), Gaps = 4/189 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YGQLGNNLP+P+ S E I  + A RVK+YDANP+IL  L  +++QVS+MV
Sbjct  1    AEISSKIGINYGQLGNNLPSPNSSVEFIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMV  60

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPA  455
            PN  I  I+S+QA AD WV  NV+P+Y +T IRYLLVGNE+L    S+     W  LVPA
Sbjct  61   PNNEISTIASNQAKADEWVRNNVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPA  120

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            M K + S+K   +  IKVGTPLAMD+LE+++PPS+  FR D++ SV  P+L+FL+RTNSF
Sbjct  121  MTKFKSSLKAQNITNIKVGTPLAMDVLESTFPPSNSMFRPDISNSVMAPMLRFLNRTNSF  180

Query  636  FFFDVYPYF  662
             F DVYP+F
Sbjct  181  MFIDVYPFF  189



>emb|CDY08004.1| BnaC03g35190D [Brassica napus]
Length=460

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 147/186 (79%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLG+NLP+PS S +LI  L AKRVK+YDANP IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGDNLPSPSDSVKLIQSLNAKRVKLYDANPAILAALNATDITVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NIS   +L+D W+ +N++PF+  TKIRYLLVGNEIL++  +     LVPAMRK
Sbjct  77   VPNELIVNISKSSSLSDEWIRSNILPFHPSTKIRYLLVGNEILTSADSELKSALVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+KK G++K+KVGT LA+D+L+ S+PPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  137  IQRSLKKLGVKKVKVGTTLAVDVLKTSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_009134961.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=460

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 146/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLG+NLP+PS S +LI  L AKRVK+YDANP IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGDNLPSPSDSVKLIQSLNAKRVKLYDANPAILAALNATDITVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
             PNE++ NIS   +L+D W+ +N++PF+  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  77   DPNELLVNISKSSSLSDEWITSNILPFHPTTKIRYLLVGNEILSSTDSELKSALVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+KK G++K+KVGT LA+D+LE S+PPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  137  IQRSLKKLGVKKVKVGTTLAVDVLETSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>emb|CDX74052.1| BnaA03g29950D [Brassica napus]
Length=567

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 145/186 (78%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA  S   G+ YGQLG+NLP+PS S +LI  L AKRVK+YDANP IL AL  +D+ VSVM
Sbjct  17   GAKFSGRPGVNYGQLGDNLPSPSDSVKLIQSLNAKRVKLYDANPAILAALNATDITVSVM  76

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            VPNE+I NIS    L+D W+ +N++PF+  TKIRYLLVGNEILS+  +     LVPAMRK
Sbjct  77   VPNELIVNISKSSTLSDEWIRSNILPFHPTTKIRYLLVGNEILSSADSELKSALVPAMRK  136

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+KK  ++K+KVGT LA+D+L+ S+PPSSG FRSD++GSV KP+LQFL+RT SF F 
Sbjct  137  IQRSLKKLSVKKVKVGTTLAVDVLKTSFPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFV  196

Query  645  DVYPYF  662
            DVYPYF
Sbjct  197  DVYPYF  202



>ref|XP_006830555.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
 gb|ERM97971.1| hypothetical protein AMTR_s00117p00104410 [Amborella trichopoda]
Length=482

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGL-KAKRVKIYDANPKILRALGNSDVQVSVMVPNEII  302
            +GI YGQLG+NL +P +S  LI  L K  R+KIYD NP+IL AL N+ +QVSVM+PN+ I
Sbjct  33   IGINYGQLGSNLSSPLQSINLIQTLIKVSRIKIYDTNPQILHALTNTKIQVSVMLPNQAI  92

Query  303  PNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSV  479
             NIS+ Q  +D WV+TN++PFY  T+IR +LVGNE+LS+     TW  LVPAM+ I+RS+
Sbjct  93   QNISATQEASDSWVKTNILPFYPLTRIRTILVGNEVLSDSSIEPTWTMLVPAMQNIKRSL  152

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
            +  G+  IKVGTPLAMD+L+AS+PPSSGAFR D+  +V +PLLQFL +T SFFF D YPY
Sbjct  153  RALGIHNIKVGTPLAMDVLKASFPPSSGAFRDDIAETVMRPLLQFLKKTKSFFFLDAYPY  212

Query  660  F  662
             
Sbjct  213  L  213



>ref|XP_009373620.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Pyrus 
x bretschneideri]
Length=469

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 141/189 (75%), Gaps = 4/189 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YG+LGNNLP+ +RS EL+  + A RVK+YDA+P+IL+ L  +++QVS+MV
Sbjct  17   AEISSKIGINYGRLGNNLPSANRSIELLMAMNAGRVKLYDADPEILKLLSGTNLQVSIMV  76

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPA  455
            PN  I  I+SDQ  AD WV  NV+P+Y ET IRYLL+GNE+L    S+     W+ LVPA
Sbjct  77   PNNEISTIASDQIKADEWVRNNVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPA  136

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            M KI+ S+K   +  IKVGTPLAMD L++++PPS   FR+D++ +V  P+L+FL+RT SF
Sbjct  137  MSKIKSSLKSQNITNIKVGTPLAMDALQSTFPPSKATFRADISDTVMAPMLRFLNRTKSF  196

Query  636  FFFDVYPYF  662
            FF DVYP+F
Sbjct  197  FFIDVYPFF  205



>ref|XP_008222761.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Prunus 
mume]
Length=477

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 139/187 (74%), Gaps = 4/187 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            IS+ +GI YGQLGNNLP+P+ S ELI  + A RVK+YDANP+IL  L  +++QVS+MVPN
Sbjct  28   ISSKIGINYGQLGNNLPSPNSSIELIKSMNAGRVKLYDANPEILNLLSGTNLQVSIMVPN  87

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPAMR  461
              I  I+S+QA AD WV  NV+P+Y +T IRYLLVGNE+L    S+     W  LVPAM 
Sbjct  88   SEISIIASNQAKADEWVRNNVLPYYPQTMIRYLLVGNEVLSYNSSDQDRQMWLDLVPAMT  147

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            KI+ S+K   +  IKVGTPLA+D+L++++PPS+  FR D++ SV  P+L+FL+RTNSF F
Sbjct  148  KIKSSLKAQNITNIKVGTPLAIDVLQSTFPPSNSMFRPDISNSVMAPMLRFLNRTNSFMF  207

Query  642  FDVYPYF  662
             DVYPYF
Sbjct  208  IDVYPYF  214



>ref|XP_002520622.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF41758.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=463

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+ S  +GI YGQLG+NLP+P RS +++  +   RVK+YDANP+ILR L  + +QVSVMV
Sbjct  22   AETSNKIGINYGQLGDNLPSPYRSIQILQSMNTGRVKLYDANPEILRLLAGTKIQVSVMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I NI+S+Q +A  WV  NV+ +Y  T IR++LVGNEIL   S+     W  LVPAM
Sbjct  82   PNNEINNIASNQTIAHNWVRENVLQYYPNTMIRFILVGNEILSYSSDQDKKIWSNLVPAM  141

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            RKI+ S++   ++ IKVGTPLAMD+L+ + PPS+G FRSD++G+V  PLL+FL+ T SFF
Sbjct  142  RKIKNSLRSHNIQNIKVGTPLAMDVLQTTSPPSNGTFRSDISGTVILPLLKFLNGTKSFF  201

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  202  FIDVYPYF  209



>gb|KEH30957.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=462

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 138/188 (73%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A  ++ +G+ YG LGNNLP+  RS EL+  +KA RVK+YDANP ILR L  + ++VS+M+
Sbjct  17   AKANSNIGVNYGVLGNNLPSLYRSIELLTTMKAGRVKLYDANPDILRLLSTTKLKVSIMI  76

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I  I+++Q++AD WV  N++P+Y  T  RYLLVGNE+L   S   +  W  LVPAM
Sbjct  77   PNHEISGIAANQSIADEWVRNNILPYYPNTLFRYLLVGNEVLSYNSEQGHKMWHDLVPAM  136

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R I+R++    +R IK+GTPLAMD+LE+++PPSSG FRSD+  SV  P+L+FL+RTNSFF
Sbjct  137  RSIKRALNSQNIRGIKIGTPLAMDVLESTFPPSSGTFRSDIRDSVMAPMLKFLNRTNSFF  196

Query  639  FFDVYPYF  662
            F D YPYF
Sbjct  197  FIDAYPYF  204



>ref|XP_006299757.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
 gb|EOA32655.1| hypothetical protein CARUB_v10015952mg [Capsella rubella]
Length=476

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 140/186 (75%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPSPYQSINLIKTIKAGHVKLYDADPETLKLLSKTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
            + I ++ SDQA AD+WV TNV+PFY +T+IR++LVGNE+L   S+     W  LVPAMRK
Sbjct  93   DQIISVGSDQAAADKWVATNVLPFYPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSGAFR DL   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFREDLAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_008380636.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Malus 
domestica]
Length=469

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/189 (54%), Positives = 139/189 (74%), Gaps = 4/189 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YG+LGNNLP+ +RS EL+  + A RVK+YDA+ +IL+ L  +++QVS+MV
Sbjct  17   AEISSKIGINYGRLGNNLPSANRSIELLKAMNAGRVKLYDADLEILKLLSGTNLQVSIMV  76

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL----SNPPNTTWFQLVPA  455
            PN  I  I SDQ  AD WV  NV+P+Y ET IRYLL+GNE+L    S+     W+ LVPA
Sbjct  77   PNNEISTIXSDQTKADEWVRNNVLPYYPETMIRYLLIGNEVLSYNSSDQDRQMWYDLVPA  136

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            M KI+ S+K   +  IKVGTPLAMD L++++PPS   FR+D++ +V  P+L+FL+RT SF
Sbjct  137  MSKIKSSLKSQNITNIKVGTPLAMDALQSTFPPSKATFRADISDTVMAPMLRFLNRTRSF  196

Query  636  FFFDVYPYF  662
            FF DVYP+F
Sbjct  197  FFIDVYPFF  205



>ref|XP_010466734.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=474

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 139/186 (75%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPSPYQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
            + I +I +DQA AD WV TNV+PFY +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  93   DQIISIGADQATADNWVATNVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRVRGIHNIKVGTPLAMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_010023613.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Eucalyptus 
grandis]
 gb|KCW59922.1| hypothetical protein EUGRSUZ_H02646 [Eucalyptus grandis]
Length=440

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 143/185 (77%), Gaps = 8/185 (4%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG++GNNLP+PS+S E I  ++A+RVK+YDA+P+IL+ L  + VQVS+MV N+ IP
Sbjct  1    MGINYGRVGNNLPSPSQSVERIQLMRARRVKLYDADPEILKLLSRTQVQVSIMVQNQEIP  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT------WFQLVPAMRKI  467
             ++S QALAD+WV  NV+P+Y  T IR++LVGNE+LS   N+T      W  LVPAMR+I
Sbjct  61   GVASSQALADKWVRNNVLPYYPRTMIRFILVGNEVLSY--NSTDRDRQLWGDLVPAMRRI  118

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S++   +R IKVGTP+AMD++E+++PPSSG FRSD+  SV  PL++FL+ T S+FF D
Sbjct  119  KSSLRSNRIRNIKVGTPMAMDVVESTFPPSSGRFRSDVAESVIMPLVRFLNSTRSYFFLD  178

Query  648  VYPYF  662
            VYPYF
Sbjct  179  VYPYF  183



>ref|XP_006830552.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
 gb|ERM97968.1| hypothetical protein AMTR_s00117p00097230 [Amborella trichopoda]
Length=464

 Score =   214 bits (544),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 141/188 (75%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGL-KAKRVKIYDANPKILRALGNSDVQVSV  281
            GA I   +GI YG LG+NLP+ S+S  L+  L K  RVK+Y+  P IL+AL N+++QV++
Sbjct  19   GASIHNPIGINYGLLGDNLPSTSQSIYLVQSLLKVPRVKLYEPRPDILQALSNTNIQVTI  78

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAM  458
            MVPN+ IPNIS  Q ++D WV+ N++PFY +T+I+ LLVGNE+LS+P   TTW  LVPAM
Sbjct  79   MVPNQAIPNISLSQNVSDSWVKINLLPFYPKTRIQTLLVGNEVLSDPSIKTTWSMLVPAM  138

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R ++ S++   +  IKVGT LAMD LE+S+PPS+G FRSD+   V KPLLQFL++T SF+
Sbjct  139  RNLKYSLRALDVGSIKVGTTLAMDTLESSFPPSNGTFRSDIAVPVIKPLLQFLNKTKSFY  198

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  199  FVDVYPYF  206



>ref|XP_006418839.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
 gb|ESQ37275.1| hypothetical protein EUTSA_v10002513mg [Eutrema salsugineum]
Length=474

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 139/186 (75%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  31   LASRIGINYGRLGNNLPSPYQSINLIKSLKAGHVKLYDADPETLKLLSQTNLYVTIMVPN  90

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I ++ SD+A AD WV TNV+P++ +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  91   NQIISVGSDKAAADNWVNTNVLPYHPQTRIRFVLVGNEILSYSSDQDKQIWSNLVPAMRK  150

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I  S++  G+  IKVGTPLAMD+L +S+PPSSG FR ++T  V  PLL+FL+ TNSFFF 
Sbjct  151  IVNSLRARGIHNIKVGTPLAMDVLRSSFPPSSGTFREEITAPVISPLLKFLNGTNSFFFL  210

Query  645  DVYPYF  662
            DVYPYF
Sbjct  211  DVYPYF  216



>ref|XP_006421038.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
 gb|ESR34278.1| hypothetical protein CICLE_v10004917mg [Citrus clementina]
Length=466

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+ S  +GI YG+LG+NLP+  +S E I  LKA  VKIYDANP+IL+ L  +D++VS+MV
Sbjct  22   AETSDKIGINYGKLGSNLPSSYQSIESIKFLKAGSVKIYDANPEILKLLSGTDLKVSIMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPN---TTWFQLVPAM  458
             N  I +I+S Q +AD+WV  NV+ FY ET IR++LVGNEILS         W  LVPAM
Sbjct  82   QNHEIIDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAM  141

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
             +I++ +    +  IKVGTPLAMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT SFF
Sbjct  142  HRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKSFF  201

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  202  FLDVYPYF  209



>ref|XP_010488453.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+L NNLP+P +S  LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLDNNLPSPYQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
            + I +I +DQA AD W+ TNV+PFY +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  93   DQIISIGADQATADNWIATNVLPFYPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_010512882.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=476

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 138/186 (74%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPSPYQSINLIKSLKAGHVKLYDADPETLKLLSKTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
            + I +I +DQA AD W+ TNV+PF  +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  93   DQIISIGADQATADNWIATNVLPFSPQTRIRFVLVGNEILSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSGAFR D+   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFREDIAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>gb|KDO47456.1| hypothetical protein CISIN_1g012660mg [Citrus sinensis]
Length=459

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+ S  +GI YG+LG+NLP+  +S E I  L+A  VKIYDANP+IL+ L  +D++VS+MV
Sbjct  22   AETSDKIGINYGKLGSNLPSSYQSIESIKFLQAGSVKIYDANPEILKLLSGTDLKVSIMV  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPN---TTWFQLVPAM  458
             N  I +I+S Q +AD+WV  NV+ FY ET IR++LVGNEILS         W  LVPAM
Sbjct  82   QNHEIIDIASKQKVADQWVHDNVLSFYPETMIRFILVGNEILSQSSEEYKQIWKNLVPAM  141

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
             +I++ +    +  IKVGTPLAMD+ + ++PPS+G FRSD++ SV +PLLQFL+RT SFF
Sbjct  142  HRIKKCLNAHNIHNIKVGTPLAMDIFQTTFPPSNGTFRSDISASVMEPLLQFLNRTKSFF  201

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  202  FLDVYPYF  209



>ref|XP_002883459.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59718.1| hypothetical protein ARALYDRAFT_479892 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  LKA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPSPYQSINLIKTLKAGHVKLYDADPETLKLLSKTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+P+Y +T+IR++LVGNEILS   +     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVATNVLPYYPQTRIRFVLVGNEILSYNTDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_010264204.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nelumbo 
nucifera]
Length=339

 Score =   207 bits (527),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 136/188 (72%), Gaps = 5/188 (3%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS  +G+  GQLGNNLP+PSRS  LI  LKA  VK   ANP IL AL  +++QVS+MV
Sbjct  12   AEISRKMGVNCGQLGNNLPSPSRSIVLIKSLKAGHVK--HANPDILNALEGTNIQVSIMV  69

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAM  458
            PN++I NISS Q+LA+ WV TN VPFY +T   YLLVGNEI S   N    TW+ LV AM
Sbjct  70   PNQLISNISSSQSLANEWVRTNNVPFYPKTLTHYLLVGNEIFSFSSNQDRQTWYGLVQAM  129

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
             +++ S+K   +R IK+GT +AMD+L++S+PPS+G FRSD++  V KPLLQFL+RT S+ 
Sbjct  130  SRLKYSLKIHNIRNIKIGTTIAMDVLQSSFPPSNGMFRSDISIPVMKPLLQFLNRTKSYS  189

Query  639  FFDVYPYF  662
            F D YP F
Sbjct  190  FLDAYPNF  197



>gb|KFK39673.1| a6 anther-specific protein [Arabis alpina]
Length=474

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  +KA  VK+YDA+P+ L  L  +++ V++MVPN
Sbjct  31   LASRIGINYGKLGNNLPSPYQSINLIKSIKAGHVKLYDADPETLMLLAQTNLYVTIMVPN  90

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
            + I +I SDQ+ AD WV T+V+P+Y  T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  91   DHIISIGSDQSAADNWVATSVIPYYPATRIRFVLVGNEILSYSSDQDKQIWTNLVPAMRK  150

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I  S++  G+  IKVGTPLAMD+L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF 
Sbjct  151  IVNSLRARGIHNIKVGTPLAMDVLRSSFPPSSGTFREDVAAPVMLPLLKFLNGTNSFFFL  210

Query  645  DVYPYF  662
            DVYPYF
Sbjct  211  DVYPYF  216



>emb|CDY59775.1| BnaCnng35540D [Brassica napus]
Length=474

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            + +++ +GI YG+ GNNLP+P +S  LI  LKA  VK+YDA+ + L  L  +++ V++MV
Sbjct  29   SSLASRIGISYGRSGNNLPSPYQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMV  88

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I  I +DQ  AD WV TNV+P Y +T+IR++LVGNEIL   S+    TW  LVPAM
Sbjct  89   PNNQIITIGADQTAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAM  148

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            RKI  S++  G+  IKVGTPLAMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFF
Sbjct  149  RKIVNSLRARGIHNIKVGTPLAMDVLRSSYPPSSGAFREEVAAPVMLPLLKFLNGTNSFF  208

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  209  FLDVYPYF  216



>ref|XP_009102583.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=478

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            + +++ +GI YG+ GNNLP+P +S  LI  LKA  VK+YDA+ + L  L  +++ V++MV
Sbjct  33   SSLASRIGISYGRSGNNLPSPYQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMV  92

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I  I +DQ  AD WV TNV+P Y +T+IR++LVGNEIL   S+    TW  LVPAM
Sbjct  93   PNNQIITIGADQTAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAM  152

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            RKI  S++  G+  IKVGTPLAMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFF
Sbjct  153  RKIVNSLRARGIHNIKVGTPLAMDVLRSSYPPSSGAFREEVAAPVMLPLLKFLNGTNSFF  212

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  213  FLDVYPYF  220



>ref|XP_009625839.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Nicotiana tomentosiformis]
Length=440

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG+LGNNLP+P  S ELI  +KA +VK+YDANP+ILR L  +++ VS+MVPN+ I 
Sbjct  2    IGVNYGRLGNNLPSPYESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPNDQIS  61

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVK  482
             ++++Q++A++WV  NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I++S+ 
Sbjct  62   IVAANQSVANQWVRDNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIKKSID  121

Query  483  KFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFDVYPY  659
               +  IK+GTPLAMDML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF DVYPY
Sbjct  122  GHRIHNIKIGTPLAMDMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFIDVYPY  181

Query  660  F  662
            F
Sbjct  182  F  182



>gb|AAM64490.1| beta-1,3-glucanase, putative [Arabidopsis thaliana]
Length=476

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 137/186 (74%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPSPYQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+L   S+     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   +  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPMMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>emb|CDY63754.1| BnaAnng19080D [Brassica napus]
Length=478

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            + +++ +GI YG+ GNNLP+P +S  LI  LKA  VK+YDA+ + L  L  +++ V++MV
Sbjct  33   SSLASRIGISYGRSGNNLPSPYQSINLIKTLKAGHVKLYDADQETLTLLSKTNLYVTIMV  92

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I  I +DQ  AD WV TNV+P Y +T+IR++LVGNEIL   S+    TW  LVPAM
Sbjct  93   PNNQIITIGADQTAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQTWANLVPAM  152

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            RKI  S++  G+  IKVGTPLAMD+L +SYPPSSGAFR ++   V  PLL+FL+ TNSFF
Sbjct  153  RKIVNSLRARGIHNIKVGTPLAMDVLRSSYPPSSGAFREEVAALVMLPLLKFLNGTNSFF  212

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  213  FLDVYPYF  220



>ref|XP_009625838.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Nicotiana tomentosiformis]
Length=470

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 140/185 (76%), Gaps = 2/185 (1%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            ++  +G+ YG+LGNNLP+P  S ELI  +KA +VK+YDANP+ILR L  +++ VS+MVPN
Sbjct  28   LANMIGVNYGRLGNNLPSPYESIELIKTMKAGKVKLYDANPEILRLLSGTNLHVSIMVPN  87

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIR  470
            + I  ++++Q++A++WV  NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I+
Sbjct  88   DQISIVAANQSVANQWVRDNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIK  147

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFD  647
            +S+    +  IK+GTPLAMDML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF D
Sbjct  148  KSIDGHRIHNIKIGTPLAMDMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFID  207

Query  648  VYPYF  662
            VYPYF
Sbjct  208  VYPYF  212



>ref|NP_189019.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 dbj|BAB01853.1| beta-1,3-glucanase [Arabidopsis thaliana]
 gb|ABE65959.1| glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
 gb|AEE76811.1| O-glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=476

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP P +S  LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPFPYQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+L   S+     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>gb|ABK28569.1| unknown [Arabidopsis thaliana]
Length=477

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP P +S  LI  +KA  VK+YDA+P+ L+ L  +++ V++MVPN
Sbjct  33   LASRIGINYGKLGNNLPFPYQSINLIKTIKAGHVKLYDADPETLKLLSTTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+PF+ +T+IR++LVGNE+L   S+     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVATNVLPFHPQTRIRFVLVGNEVLSYSSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD L +S+PPSSG FR D+   V  PLL+FL+ TNSFFF 
Sbjct  153  VVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGTFREDIAVPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_009135862.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+ GNNLP+P +S  LI  + A  VK+YDA+P+ L  L  +++ V++MVPN
Sbjct  37   LASRIGINYGRFGNNLPSPYQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPN  96

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPN---TTWFQLVPAMRK  464
              I  I +DQA AD WV TNV+  Y +TKIR++LVGNEILSN  +    TW  LVPAMRK
Sbjct  97   NHIIPIGADQAAADNWVNTNVLAHYPQTKIRFVLVGNEILSNNSDQDKQTWSSLVPAMRK  156

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I  S++  G+  IKVGTPLAMD+L  S+PPSSGAFR ++   V  PLL+FL+ TNSFFF 
Sbjct  157  IVTSLRARGIHNIKVGTPLAMDVLRTSFPPSSGAFREEVAALVMLPLLKFLNGTNSFFFL  216

Query  645  DVYPYF  662
            DVYPYF
Sbjct  217  DVYPYF  222



>ref|XP_009385472.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009385473.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Musa 
acuminata subsp. malaccensis]
Length=474

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 132/183 (72%), Gaps = 2/183 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            A +GI YG LG++LP+ +RS  L+H + A  VKIYDANP ILRAL  +  +VS+MVPNEI
Sbjct  28   ARLGINYGTLGDDLPSAARSVHLLHSIGAGAVKIYDANPAILRALAGTRFRVSIMVPNEI  87

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRR  473
            IP++  + + AD WV TN+ PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I R
Sbjct  88   IPSLGVNASAADAWVGTNLGPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHR  147

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            ++    +R +KVGT LAMD L  S+PPS+GAFRSD+   V +PLL+FL RT S++F D Y
Sbjct  148  ALSARSIRDVKVGTTLAMDALVTSFPPSAGAFRSDIAEPVMRPLLRFLHRTRSYYFVDAY  207

Query  654  PYF  662
            PYF
Sbjct  208  PYF  210



>ref|XP_008439043.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Cucumis 
melo]
Length=467

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 137/188 (73%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +G+ YGQLGNNLP P+ + E+++ +K  RVK+YDAN +IL  L  +  QVS+M+
Sbjct  22   AEISSKIGVNYGQLGNNLPPPNLAIEMMNSMKVGRVKLYDANHEILGNLSKTKFQVSIMI  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I +I+++Q  AD+W+  NV+PFY +T IR++LVGNE+L   S+     W  LVPAM
Sbjct  82   PNNEISDIANNQTRADQWISNNVLPFYPQTMIRFILVGNEVLSFDSDKDRQVWNDLVPAM  141

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+I  S+K   L+ IKVGTP+AMD+LE ++PPS G FRSD+  +V  P+L FL+ T SFF
Sbjct  142  RRIWSSLKANNLQTIKVGTPVAMDILETTFPPSRGTFRSDIQQTVVAPMLNFLNETRSFF  201

Query  639  FFDVYPYF  662
            F +VYPYF
Sbjct  202  FANVYPYF  209



>emb|CDY53213.1| BnaC03g74070D [Brassica napus]
Length=480

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  LI  + A  VK+YDA+P+ L  L  +++ V++MVPN
Sbjct  37   LASRIGINYGRLGNNLPSPYQSINLIKSINAGHVKLYDADPETLMVLSQTNLYVTIMVPN  96

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPN---TTWFQLVPAMRK  464
              I  I +DQA AD WV TNV+  Y +T+IR++LVGNEILSN  +    TW  LVPAMRK
Sbjct  97   NQIIPIGADQAAADNWVNTNVLAHYPQTRIRFVLVGNEILSNNSDQDKQTWSSLVPAMRK  156

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I  S++  G+  IKVGTPLAMD+L  S+PPSSGAFR ++   V  PLL+FL+ TNSFFF 
Sbjct  157  IITSLRARGIHNIKVGTPLAMDVLRTSFPPSSGAFREEVAAPVMLPLLKFLNGTNSFFFL  216

Query  645  DVYPYF  662
            D YPYF
Sbjct  217  DSYPYF  222



>ref|XP_010532729.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=480

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            + +G+ YG+ GNNLP+P +S  LI  +KA  VK+YDA+P+ L  L  +++ V++MVPN  
Sbjct  39   SKIGVNYGRQGNNLPSPYQSINLIKSVKAGHVKLYDADPETLTLLSQTNLYVTIMVPNHQ  98

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMRKIR  470
            + +I SDQ  AD WV+TNV+P+Y +T IR++LVGNE+LS   +     W  LVPAMRK+ 
Sbjct  99   VISIGSDQTAADNWVKTNVLPYYPQTLIRFVLVGNEVLSYSTDQDREVWRNLVPAMRKLV  158

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+R IKVGTPLAMD+L++++PPSSG FR D+ G V  PLL+FL+ TNSFFF D 
Sbjct  159  NSLRAQGIRNIKVGTPLAMDVLQSTFPPSSGTFREDIAGPVMLPLLKFLNGTNSFFFIDA  218

Query  651  YPYF  662
            YPYF
Sbjct  219  YPYF  222



>gb|KJB28087.1| hypothetical protein B456_005G026800 [Gossypium raimondii]
Length=462

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 138/185 (75%), Gaps = 0/185 (0%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YG++GNNLP+P ++ E +  + A R+K+YD++P+IL+ L  +++ VSVMV
Sbjct  20   AEISSKIGINYGRIGNNLPSPYQTIETVKSMNAGRIKLYDSDPEILKLLSGTNIHVSVMV  79

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
             N  I  I+S QA+A++WV+ NV+ +Y +T IR++LVGNE+LS+     W  LV AMR+I
Sbjct  80   QNNDIIRIASSQAVAEQWVQDNVLAYYPDTMIRFVLVGNEVLSHQDRRIWLSLVSAMRRI  139

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S+    ++ IKVGTPLAMD++++++PPSS  FR D+T +V  PLL+FL+ T SFFF D
Sbjct  140  KNSLNTHDIKNIKVGTPLAMDVMQSTFPPSSSRFRPDITDTVMAPLLRFLNGTKSFFFID  199

Query  648  VYPYF  662
            VYPY 
Sbjct  200  VYPYL  204



>ref|XP_006349905.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Solanum tuberosum]
Length=470

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 135/183 (74%), Gaps = 2/183 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            + +GI YG++ NNLP+P  S EL+  +KA RVKIYDANP+ILR L  +++QVS+MVPN  
Sbjct  29   SIIGINYGRVANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNNQ  88

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNT-TWFQLVPAMRKIRRS  476
            I  ++++Q+ A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR S
Sbjct  89   ISIVAANQSAANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRNS  148

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLT-GSVFKPLLQFLDRTNSFFFFDVY  653
            + +  +  IK+GTP AMD+LE S+PPSSG FR D++  ++  PLL+FL+ T S+FF D Y
Sbjct  149  IDQHNIHNIKIGTPFAMDILETSFPPSSGEFRLDISRNNLLMPLLRFLNWTKSYFFLDAY  208

Query  654  PYF  662
            PYF
Sbjct  209  PYF  211



>ref|XP_006373100.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
 gb|ERP50897.1| hypothetical protein POPTR_0017s08720g [Populus trichocarpa]
Length=466

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  +G+ YG LGNNLP+  +S E +  +KA  VK+YDANP+ILR L  +D++VS+MVPN 
Sbjct  24   SGKIGVNYGLLGNNLPSAGQSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNY  83

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKI  467
             I NI+++Q  A++WVE NV+ ++ ET IR +LVGNE+L   S+     W  LVPAMR+I
Sbjct  84   EIINIATNQTSANKWVEDNVLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVPAMRRI  143

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S++   +R IKVGTPLAMD+L+ ++PPS+G FR D++ +V  PLL+FL+ T SFFF D
Sbjct  144  KISLRAQDIRNIKVGTPLAMDVLQTTFPPSTGTFRPDISTTVMVPLLKFLNSTKSFFFID  203

Query  648  VYPYF  662
            VYPYF
Sbjct  204  VYPYF  208



>ref|XP_010314851.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Solanum 
lycopersicum]
Length=463

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            ++ +G+ YG++ NNLP+P  S EL+  +KA RVKIYDANP+ILR L  +++QVS+MVPN 
Sbjct  22   ASPIGVNYGRVANNLPSPYDSIELLKNMKAGRVKIYDANPEILRLLSGTNLQVSIMVPNN  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNT-TWFQLVPAMRKIRR  473
             I  ++++Q  A++WV  NV+P+Y  T IRY+LVGNE+LSN  +   W+ L+PAM  IR 
Sbjct  82   QISVVAANQTAANQWVRDNVLPYYPNTMIRYILVGNEVLSNKDDQGLWYDLIPAMNNIRN  141

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLT-GSVFKPLLQFLDRTNSFFFFDV  650
            S+ +  +  IK+GTP AMD+LE ++PPSSG FR D++  ++  PLL+FL+ T S+FF D 
Sbjct  142  SIDQHNIHNIKIGTPFAMDLLETTFPPSSGEFRLDISRNNILMPLLRFLNWTRSYFFLDA  201

Query  651  YPYF  662
            YPYF
Sbjct  202  YPYF  205



>ref|XP_009106344.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=476

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  L+  +KA  VK+YDA+ + L  L  +++ V++MVPN
Sbjct  33   LASRIGINYGRLGNNLPSPYQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+P Y +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I  S++  G+  IKVGTPLAMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF 
Sbjct  153  IVNSLRARGIHNIKVGTPLAMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_008792940.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Phoenix dactylifera]
Length=467

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            A +G+ YG LG++LP+ +RS   +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++
Sbjct  25   AKLGVNYGTLGDDLPSAARSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQV  84

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRS  476
             P+++++++LAD W+  N++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+
Sbjct  85   FPSLAANRSLADAWLAANLLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRA  144

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            ++   +R +KVGT LAMD L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+F DVYP
Sbjct  145  LRARSIRDVKVGTTLAMDSLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFYFVDVYP  204

Query  657  YF  662
            YF
Sbjct  205  YF  206



>emb|CDY50110.1| BnaC01g43580D [Brassica napus]
Length=476

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  L+  +KA  VK+YDA+ + L  L  +++ V++MVPN
Sbjct  33   LASRIGINYGRLGNNLPSPYQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+P Y +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I  S++  G+  IKVGTPLAMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF 
Sbjct  153  IVNSLRARGIHNIKVGTPLAMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|XP_008792939.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Phoenix dactylifera]
Length=470

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            A +G+ YG LG++LP+ +RS   +  L+A  VKIYDANP ILRAL  + ++VS+MVPN++
Sbjct  28   AKLGVNYGTLGDDLPSAARSIGFLQSLRAGAVKIYDANPAILRALAGTRLRVSIMVPNQV  87

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN-PPNTTWFQLVPAMRKIRRS  476
             P+++++++LAD W+  N++PFY + +IR+LLVGNE+LS+    ++W  LVPAM  + R+
Sbjct  88   FPSLAANRSLADAWLAANLLPFYPQARIRFLLVGNEVLSDYSVKSSWPSLVPAMANLHRA  147

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            ++   +R +KVGT LAMD L+ S+PPS+G FR D+ G+V +PLL+F +RT SF+F DVYP
Sbjct  148  LRARSIRDVKVGTTLAMDSLKTSFPPSAGEFRDDIAGTVIRPLLRFANRTRSFYFVDVYP  207

Query  657  YF  662
            YF
Sbjct  208  YF  209



>ref|XP_009777293.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Nicotiana 
sylvestris]
Length=470

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 138/185 (75%), Gaps = 2/185 (1%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            ++  +G+ YG+LGNNLP+   S E +  +KA RVK+YDANP+ILR L  +++ VS+MVPN
Sbjct  28   LANMIGVNYGRLGNNLPSQYESIEHMKNMKAGRVKLYDANPEILRLLSGTNLHVSIMVPN  87

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIR  470
            + I  ++++Q+ A++WV  NV+ +Y  T IRY+LVGNE+LSN  + + W+ LVPAMR I+
Sbjct  88   DQISIVAANQSAANQWVRDNVLSYYPNTMIRYILVGNEVLSNKDDQSLWYDLVPAMRNIK  147

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDL-TGSVFKPLLQFLDRTNSFFFFD  647
            +S+ +  +  IK+GTPLAMDML+ S+PPSSG FR D+   S+  PLL+FL+ T S+FF D
Sbjct  148  KSIDEHRIHNIKIGTPLAMDMLQTSFPPSSGEFRLDIPRNSLLIPLLRFLNWTKSYFFID  207

Query  648  VYPYF  662
            VYPYF
Sbjct  208  VYPYF  212



>gb|KDP32593.1| hypothetical protein JCGZ_13143 [Jatropha curcas]
Length=479

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 139/189 (74%), Gaps = 6/189 (3%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A +S  +GI YGQLG+NLP+P +S +++  + A RVK+Y+A+P+ILR L  S +QVS+MV
Sbjct  35   AQVSGKMGINYGQLGSNLPSPYQSIQILKSINASRVKLYNADPEILRLLAGSKIQVSIMV  94

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN----PPNTTWFQLVPA  455
            PN+ I  I+SDQ LA++WV  NV+ +Y  T IR++LVGNEI S+      N  W  LVPA
Sbjct  95   PNQEIIRIASDQTLANQWVRQNVLQYYPNTMIRFILVGNEIFSSVSVQEQNYVWPNLVPA  154

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            MR I+ S+K   ++ IKVGTPL+MD+L+ ++PPS+G FR+++  S+  PLL+FL+ T S+
Sbjct  155  MRNIKNSLKIHNIKNIKVGTPLSMDILQTTFPPSNGTFRTNV--SILPPLLKFLNGTKSY  212

Query  636  FFFDVYPYF  662
            FF DVYPYF
Sbjct  213  FFIDVYPYF  221



>emb|CDY18092.1| BnaA01g23530D [Brassica napus]
Length=476

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+LGNNLP+P +S  L+  +KA  VK+YDA+ + L  L  +++ V++MVPN
Sbjct  33   LASRIGINYGRLGNNLPSPYQSINLVKSIKAGHVKLYDADQETLMLLSQTNLYVTIMVPN  92

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRK  464
              I +I +DQA AD WV TNV+P Y +T+IR++LVGNEIL   S+     W  LVPAMRK
Sbjct  93   NQIISIGADQAAADNWVNTNVLPHYPQTRIRFVLVGNEILSYNSDQDKQIWANLVPAMRK  152

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            +  S++  G+  IKVGTPLAMD+L +S+PPS+G FR ++   V  PLL+FL+ TNSFFF 
Sbjct  153  MVNSLRARGIHNIKVGTPLAMDVLRSSFPPSNGTFREEVAAPVMLPLLKFLNGTNSFFFL  212

Query  645  DVYPYF  662
            DVYPYF
Sbjct  213  DVYPYF  218



>ref|NP_193144.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
 sp|Q06915.1|EA6_ARATH RecName: Full=Probable glucan endo-1,3-beta-glucosidase A6; AltName: 
Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Anther-specific protein A6; AltName: 
Full=Beta-1,3-endoglucanase; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA49853.1| A6 [Arabidopsis thaliana]
 emb|CAB10187.1| A6 anther-specific protein [Arabidopsis thaliana]
 emb|CAB78450.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAM20432.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AAN72161.1| A6 anther-specific protein [Arabidopsis thaliana]
 gb|AEE83368.1| putative glucan endo-1,3-beta-glucosidase A6 [Arabidopsis thaliana]
Length=478

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  37   DLASKIGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVP  96

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I  +SS+Q +AD WV TN++P+Y +T+IR++LVGNEILS         LVPAMRKI 
Sbjct  97   NHQITALSSNQTIADEWVRTNILPYYPQTQIRFVLVGNEILSYNSGNVSVNLVPAMRKIV  156

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +S+PPS+G FR ++TG V  PLL+FL+ TNS+FF +V
Sbjct  157  NSLRLHGIHNIKVGTPLAMDSLRSSFPPSNGTFREEITGPVMLPLLKFLNGTNSYFFLNV  216

Query  651  YPYF  662
            +PYF
Sbjct  217  HPYF  220



>gb|EYU31523.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=426

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
             ++ S  +G+ YG+LGNNLP+P  S +L+  +KA  VK+YDA+P++L+ L ++D+ V++M
Sbjct  27   ASNSSNKIGVNYGRLGNNLPSPFESIQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIM  86

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            V N+ I  I+S+++ AD W++ NV+  Y  TKIR++LVGNE+ S      W  LVPAMR+
Sbjct  87   VTNQEISMIASNESHADAWIDDNVLAHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRR  146

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+ K  +  IKVGTPLAMD LE+++PPSS  FRS +   V  PL++FL+ T SFFF 
Sbjct  147  IKRSLNKHQIHNIKVGTPLAMDALESTFPPSSARFRSSIPAEVIVPLMRFLNSTKSFFFV  206

Query  645  DVYPYF  662
            DVY YF
Sbjct  207  DVYTYF  212



>ref|XP_009411847.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=455

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 130/181 (72%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG LG++LP+ +RS  L+  L A  VKIYDANP IL AL  + ++VS+MVPNEI+P
Sbjct  11   LGVNYGTLGDDLPSAARSVALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVP  70

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSV  479
            ++ ++ +LAD WV  N+ PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R++
Sbjct  71   SLGANASLADAWVADNLAPFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRAL  130

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
            +   +  +KVGT LAMD L  ++PPS+GAFR+D+ G V +PLL FL RT S++F D YPY
Sbjct  131  RARSVCDVKVGTTLAMDALATAFPPSAGAFRADIAGPVMRPLLDFLSRTRSYYFVDAYPY  190

Query  660  F  662
             
Sbjct  191  L  191



>ref|XP_004147671.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Cucumis sativus]
Length=461

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YGQLGNNLP P+ + E+++ ++  RVK+YDAN +IL  L  +  QVS+M+
Sbjct  16   AEISSKIGINYGQLGNNLPAPNLAIEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMI  75

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I  I+++Q  AD+W+  N++PFY +T IR++LVGNE+L   S+     W  LVPAM
Sbjct  76   PNNEISGIANNQTRADQWILNNLLPFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAM  135

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+I  S+K   L+ I+VGTP+AMD+LE ++PPS G FRSD+  +V  P+L FL+ T SFF
Sbjct  136  RRIWSSLKANNLQIIRVGTPVAMDVLETTFPPSRGTFRSDIQRTVVAPMLDFLNETRSFF  195

Query  639  FFDVYPYF  662
            F +VYPYF
Sbjct  196  FANVYPYF  203



>ref|XP_002868315.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44574.1| hypothetical protein ARALYDRAFT_493503 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  37   DLASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVP  96

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++SS+Q  AD WV TN++P+Y +T+IR++LVGNEILS         LVPAMRKI 
Sbjct  97   NHQITSLSSNQTTADEWVRTNILPYYPQTQIRFVLVGNEILSYNYGNVSANLVPAMRKIV  156

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +S+PPS+G FR ++TG V  PLL+FL+ TNS+FF +V
Sbjct  157  NSLRLHGIHNIKVGTPLAMDSLRSSFPPSNGTFREEITGPVMLPLLKFLNGTNSYFFLNV  216

Query  651  YPYF  662
            +PYF
Sbjct  217  HPYF  220



>ref|XP_011010072.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=466

 Score =   201 bits (511),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  VG+ YG LGNNLP+  +S E +  +KA  VK+YDANP+ILR L  +D++VS+MVPN 
Sbjct  24   SGKVGVNYGLLGNNLPSAGQSIESLRAMKAGSVKLYDANPEILRLLAGTDIRVSIMVPNY  83

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKI  467
             I +I+++Q  A++WVE NV+ ++ ET IR +LVGNE+L   S+     W  LV AMR+I
Sbjct  84   EIISIATNQTSANKWVEDNVLAYHPETMIRTILVGNEVLSYCSDEGKRIWNHLVLAMRRI  143

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
            + S++   +R IKVGTPLAMD+L+ ++PPS+G FRSD++ +V  PLL+FL+ T SFFF D
Sbjct  144  KISLRAQDIRNIKVGTPLAMDVLQTAFPPSTGIFRSDISTTVMVPLLKFLNSTKSFFFID  203

Query  648  VYPYF  662
            VYPYF
Sbjct  204  VYPYF  208



>gb|KGN57233.1| hypothetical protein Csa_3G172380 [Cucumis sativus]
Length=487

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A+IS+ +GI YGQLGNNLP P+ + E+++ ++  RVK+YDAN +IL  L  +  QVS+M+
Sbjct  22   AEISSKIGINYGQLGNNLPAPNLAIEMMNSMRVGRVKLYDANHEILSNLSKTKFQVSIMI  81

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAM  458
            PN  I  I+++Q  AD+W+  N++PFY +T IR++LVGNE+L   S+     W  LVPAM
Sbjct  82   PNNEISGIANNQTRADQWILNNLLPFYPQTMIRFILVGNEVLSLDSDIDRQVWNDLVPAM  141

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R+I  S+K   L+ I+VGTP+AMD+LE ++PPS G FRSD+  +V  P+L FL+ T SFF
Sbjct  142  RRIWSSLKANNLQIIRVGTPVAMDVLETTFPPSRGTFRSDIQRTVVAPMLDFLNETRSFF  201

Query  639  FFDVYPYF  662
            F +VYPYF
Sbjct  202  FANVYPYF  209



>ref|XP_009411846.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=469

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 130/181 (72%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG LG++LP+ +RS  L+  L A  VKIYDANP IL AL  + ++VS+MVPNEI+P
Sbjct  25   LGVNYGTLGDDLPSAARSVALLQSLGAGAVKIYDANPAILCALAGTGLRVSIMVPNEIVP  84

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSV  479
            ++ ++ +LAD WV  N+ PFY   ++RY+LVGNEILS+    N+TW  LVPAM  I R++
Sbjct  85   SLGANASLADAWVADNLAPFYPAVRVRYVLVGNEILSDASLANSTWPFLVPAMANIHRAL  144

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
            +   +  +KVGT LAMD L  ++PPS+GAFR+D+ G V +PLL FL RT S++F D YPY
Sbjct  145  RARSVCDVKVGTTLAMDALATAFPPSAGAFRADIAGPVMRPLLDFLSRTRSYYFVDAYPY  204

Query  660  F  662
             
Sbjct  205  L  205



>ref|XP_002976500.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
 gb|EFJ22169.1| hypothetical protein SELMODRAFT_105435, partial [Selaginella 
moellendorffii]
Length=461

 Score =   200 bits (509),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 134/183 (73%), Gaps = 4/183 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YGQLGNNLP P +S ELI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP
Sbjct  1    IGVNYGQLGNNLPAPPKSVELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIP  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSV  479
            +++S Q+ AD WV++NV  +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+
Sbjct  61   SVASSQSFADEWVKSNVTAYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSL  120

Query  480  KKFGL-RKIKVGTPLAMDMLEA-SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
             K GL RKIKV TP A+ +L+   +PPS+G FR D+   + +P+L+FL  TNS FF D Y
Sbjct  121  AKLGLHRKIKVSTPHALLVLQGYVFPPSNGTFRDDIAEPIIRPMLEFLHSTNSPFFVDAY  180

Query  654  PYF  662
            P+F
Sbjct  181  PFF  183



>gb|EYU31522.1| hypothetical protein MIMGU_mgv1a005774mg [Erythranthe guttata]
Length=471

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
             ++ S  +G+ YG+LGNNLP+P  S +L+  +KA  VK+YDA+P++L+ L ++D+ V++M
Sbjct  27   ASNSSNKIGVNYGRLGNNLPSPFESIQLLLSMKAGHVKLYDADPEVLKLLSDTDLHVTIM  86

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRK  464
            V N+ I  I+S+++ AD W++ NV+  Y  TKIR++LVGNE+ S      W  LVPAMR+
Sbjct  87   VTNQEISMIASNESHADAWIDDNVLAHYPSTKIRFILVGNEVFSYNDRQLWLDLVPAMRR  146

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFF  644
            I+RS+ K  +  IKVGTPLAMD LE+++PPSS  FRS +   V  PL++FL+ T SFFF 
Sbjct  147  IKRSLNKHQIHNIKVGTPLAMDALESTFPPSSARFRSSIPAEVIVPLMRFLNSTKSFFFV  206

Query  645  DVYPYF  662
            DVY YF
Sbjct  207  DVYTYF  212



>ref|XP_011101604.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Sesamum 
indicum]
Length=468

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 130/182 (71%), Gaps = 0/182 (0%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  +GI YG+LGNNLP+P ++  L++ ++A  VK+YDANP++L+ L  +D+ VS+MV NE
Sbjct  28   SEKIGINYGRLGNNLPSPYQTITLLNSMEAGHVKLYDANPEVLKLLSGTDLHVSIMVTNE  87

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             I  I+++Q+ AD WV+ NVV +Y  TKIR++LVGNE+ S      W  LVPAMR I+RS
Sbjct  88   QISGIAANQSKADLWVQENVVAYYPSTKIRFVLVGNEVFSYNDLKMWHDLVPAMRNIKRS  147

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            +    +  +KV T +AM+ LE+S+PPSSG FRSD+ G V  PLL+FL+ T SF F DVY 
Sbjct  148  LSIRDIHNVKVSTAIAMETLESSFPPSSGKFRSDIPGEVILPLLKFLNGTKSFLFLDVYT  207

Query  657  YF  662
            YF
Sbjct  208  YF  209



>ref|XP_011045808.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Populus 
euphratica]
Length=475

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 132/182 (73%), Gaps = 3/182 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG+ GNNLP+   S E++  +KA  VK+YDANP+ILR L  +++ VS+MV N+ I 
Sbjct  36   IGVNYGRFGNNLPSAYESIEILRSMKAGSVKLYDANPEILRLLARTNIHVSIMVSNDEII  95

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEIL---SNPPNTTWFQLVPAMRKIRRS  476
            NI+++Q  A++WVE NV+ +Y +T IR +LVGNE+L   S+     W  LVPAMR+I  S
Sbjct  96   NIAANQTTANKWVEDNVLRYYPDTIIRIILVGNEVLSYSSDAGKQIWNNLVPAMRRINIS  155

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            ++   +R IKVGTPLAMD+L+ ++PPS+G FRSD++ SV  PLL FL+ T SFFF D YP
Sbjct  156  LRAQDIRNIKVGTPLAMDVLQTAFPPSNGIFRSDISTSVMVPLLNFLNSTKSFFFIDAYP  215

Query  657  YF  662
            YF
Sbjct  216  YF  217



>ref|XP_006282877.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
 gb|EOA15775.1| hypothetical protein CARUB_v10006945mg [Capsella rubella]
Length=478

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  37   DLASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVP  96

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++SS+Q +AD WV TN++P+Y +T+IR++LVG+EILS         LVPAMRKI 
Sbjct  97   NHQITSLSSNQTIADEWVRTNIIPYYPQTQIRFVLVGHEILSYNYGNVSANLVPAMRKIV  156

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  157  NSLRFHGIHNIKVGTPLAMDSLRSSFPPSNGTFREEVAGPVILPLLKFLNGTNSYFFINV  216

Query  651  YPYF  662
            +PYF
Sbjct  217  HPYF  220



>emb|CDP15106.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 135/186 (73%), Gaps = 1/186 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A IS+ +GI YG  G+NL +   S  L+  + A RVKIYDANP++L+ L  + +Q S+M+
Sbjct  25   ATISSKIGINYGLNGDNLQSVHHSINLLQSMNASRVKIYDANPEVLKLLSGTKLQASIMI  84

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
             + +IP+I+SDQ++AD+WV  NV+ +Y +T IR++LVGNEILS+     W+ LVPAM +I
Sbjct  85   QDGLIPDIASDQSIADQWVRDNVLAYYPQTMIRFVLVGNEILSSNNTLLWYNLVPAMVRI  144

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSD-LTGSVFKPLLQFLDRTNSFFFF  644
              S+K   ++ IKVGTP+AMD+LE+++PPSSG FR + L   V  PLL FL++T SFFF 
Sbjct  145  HNSIKAQNIQNIKVGTPVAMDILESTFPPSSGKFRPEILNHQVTVPLLSFLNKTRSFFFV  204

Query  645  DVYPYF  662
            +V+PYF
Sbjct  205  NVFPYF  210



>gb|KFK36299.1| hypothetical protein AALP_AA4G104300 [Arabis alpina]
Length=479

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 134/184 (73%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++  GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLASKAGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPETLTLLSQTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++SS+Q++A+ WV+TN++P+Y +T+IR++LVGNEILS         LVPAMRKI 
Sbjct  98   NHQITSLSSNQSIAEDWVKTNILPYYPQTQIRFVLVGNEILSAQDTNVTANLVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF +V
Sbjct  158  NSLRTHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDIAGPLVLPLLKFLNGTNSYFFINV  217

Query  651  YPYF  662
            +PYF
Sbjct  218  HPYF  221



>ref|XP_010450129.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPECLTLLSQTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++SS+Q  AD WV TN++P+Y +T+IR++LVGNE+LS         LVPAMRKI 
Sbjct  98   NHQITSLSSNQTTADEWVRTNILPYYPQTQIRFVLVGNEVLSYNYGNISANLVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  158  NSLRFRGIHNIKVGTPLAMDALRSSFPPSNGTFREEIAGPVVLPLLKFLNGTNSYFFINV  217

Query  651  YPYF  662
            +PYF
Sbjct  218  HPYF  221



>ref|XP_002462618.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
 gb|EER99139.1| hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Length=483

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 132/184 (72%), Gaps = 5/184 (3%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +++P+P RS EL+    A  VKIYDANP +LRAL  +   VS+MVPNEIIP
Sbjct  37   LGVNYGRVADDIPSPRRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNEIIP  96

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSV  479
            ++++  A ADRWV  N+VP+Y  T++++LLVGNEILS+    N+TW +LVPAM  I RS+
Sbjct  97   DLAASVAAADRWVAKNLVPYYPATRVKFLLVGNEILSDHSIANSTWPRLVPAMENIHRSL  156

Query  480  KKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            +K G+  +K+GT LAMD L       PPS+  FR+D+  +V +PLL FL+ TNS++F D 
Sbjct  157  RKRGISSVKIGTTLAMDALADGAFPRPPSAATFRADIAEAVVRPLLHFLNGTNSYYFVDA  216

Query  651  YPYF  662
            YPYF
Sbjct  217  YPYF  220



>ref|XP_007034194.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY05120.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=552

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 139/187 (74%), Gaps = 4/187 (2%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            +IS+ +GI YG+ G+NLP+P +S E++  +KA+RVK+YD++P+IL+    +++ +++MVP
Sbjct  109  EISSKIGINYGRQGDNLPSPYQSIEIMKSMKARRVKLYDSDPEILKLFSGTNIDMAIMVP  168

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---NPPNTTWFQLVPAMR  461
            N+ I  ISS Q  A++WV  NV+  Y  T IR++LVGNE+LS       T W  LVPAMR
Sbjct  169  NKDIVLISSSQTAAEQWVRNNVLA-YPNTNIRFVLVGNEVLSYVSKQDQTIWAHLVPAMR  227

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            +I+ S+    ++ IK+GTPLAMD+L++++PPSSG FRSD++ +V  PLL+FL+ + SFFF
Sbjct  228  RIKNSLSANDIKNIKIGTPLAMDILQSTFPPSSGTFRSDISNTVMAPLLKFLNGSKSFFF  287

Query  642  FDVYPYF  662
             DVYPYF
Sbjct  288  LDVYPYF  294



>ref|XP_002444717.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
 gb|EES14212.1| hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
Length=484

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG + ++LP+ SRS +L+    A  VKIYDAN  ILRAL  + + VS+MVPN  IP
Sbjct  48   LGINYGTVADDLPSASRSVQLLRATGAGAVKIYDANADILRALAGTGMPVSIMVPNSAIP  107

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSV  479
            +++S +A A+ WV  N+ P    T++ YLLVGNE+LSN     +TW  +VPAM  + R++
Sbjct  108  SLASSRAAAEDWVAANLAPHIPATRVAYLLVGNEVLSNRAIAGSTWRSVVPAMANLHRAL  167

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
            +  G+RK+K+GT LAMD L ASYPPS+GAFR D+   V +PLL+FL+ T S++F D YPY
Sbjct  168  RAHGIRKVKIGTTLAMDALSASYPPSAGAFRDDIAEDVVRPLLRFLNATGSYYFVDAYPY  227

Query  660  F  662
            F
Sbjct  228  F  228



>ref|XP_010450110.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I +ISS+Q  AD WV TN++PFY +T+IR++LVGNE+L+         LVPAMRKI 
Sbjct  98   NHQITSISSNQTTADEWVRTNILPFYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  158  NSLRFRGIHNIKVGTPLAMDSLRSSFPPSNGTFREEIAGPVILPLLKFLNGTNSYFFINV  217

Query  651  YPYF  662
            +PYF
Sbjct  218  HPYF  221



>emb|CAB71021.1| putative beta-1,3-glucanase [Hieracium piloselloides]
Length=379

 Score =   194 bits (492),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 135/189 (71%), Gaps = 5/189 (3%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A IS  +GI YG+LGNNLP+P++S EL+  + A RVK+YDA+ +IL  L   D++V++ V
Sbjct  34   AAISNRIGINYGRLGNNLPSPAKSIELLESMNAGRVKLYDADHEILHLLSGKDIEVAITV  93

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQ----LVPA  455
             N+ I  I+++Q LAD+WV  +V+  Y  TKIR++LVGNE+ S+  N    Q    LVPA
Sbjct  94   ANDEISAIAANQHLADQWVYEHVLAHYPNTKIRFILVGNEVFSSTNNVQDMQIARDLVPA  153

Query  456  MRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
            MR+I+ ++K  G+R IKVGTPLAMDM+E ++PPS+G+F+ D+   +  PLL++L+ T SF
Sbjct  154  MRRIKNTIKAQGIRNIKVGTPLAMDMMETTFPPSNGSFKPDIR-ELMIPLLKYLNGTRSF  212

Query  636  FFFDVYPYF  662
               DVYPYF
Sbjct  213  VLVDVYPYF  221



>gb|KHN47213.1| Putative glucan endo-1,3-beta-glucosidase A6 [Glycine soja]
Length=345

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 3/158 (2%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            +KA RVKIYDANP+ILR L N+ ++VS+M+PN  I  I+++Q++AD WV  NV+P+Y  T
Sbjct  1    MKAGRVKIYDANPEILRLLSNTKLKVSIMIPNNEISGIAANQSIADEWVRNNVLPYYPNT  60

Query  378  KIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  548
             IRYLL+GNE+LS      +  W  LVPAMR I RS++   +R IK+GTPLAMD+L++++
Sbjct  61   MIRYLLMGNEVLSYNSEQGHQMWRDLVPAMRSIERSLRAQNIRDIKIGTPLAMDVLQSTF  120

Query  549  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            PPSS AFRSD+  SV  P+L+FLD+T SFFF DVYPYF
Sbjct  121  PPSSSAFRSDIRDSVMVPMLKFLDQTKSFFFIDVYPYF  158



>ref|XP_009383833.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=476

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            A +GI YG LG++LP+ +RS  L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEI
Sbjct  30   ARLGINYGTLGDDLPSAARSVALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEI  89

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRR  473
            IP++ ++ +LAD WV   + PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I R
Sbjct  90   IPSLGTNASLADAWVAAYLTPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHR  149

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            S+    +R +KV T  AMD L  S+PPS+GAFRSD+   V +PLL+FL +T S++F D Y
Sbjct  150  SLIARSIRDVKVSTTFAMDALGISFPPSAGAFRSDIAEPVIRPLLRFLHKTRSYYFVDAY  209

Query  654  PYF  662
            PY 
Sbjct  210  PYL  212



>ref|XP_009383834.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=475

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 129/183 (70%), Gaps = 2/183 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            A +GI YG LG++LP+ +RS  L+  + A  VKIYDANP ILRAL  + ++VS+MVPNEI
Sbjct  29   ARLGINYGTLGDDLPSAARSVALLRSIGAGAVKIYDANPAILRALAGTRLRVSIMVPNEI  88

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS--NPPNTTWFQLVPAMRKIRR  473
            IP++ ++ +LAD WV   + PFY   ++RYLLVGNEILS  +  N+TW  LVPAM  I R
Sbjct  89   IPSLGTNASLADAWVAAYLTPFYPAVRVRYLLVGNEILSYTSLANSTWPFLVPAMVNIHR  148

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            S+    +R +KV T  AMD L  S+PPS+GAFRSD+   V +PLL+FL +T S++F D Y
Sbjct  149  SLIARSIRDVKVSTTFAMDALGISFPPSAGAFRSDIAEPVIRPLLRFLHKTRSYYFVDAY  208

Query  654  PYF  662
            PY 
Sbjct  209  PYL  211



>ref|XP_002973407.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
 gb|EFJ25781.1| hypothetical protein SELMODRAFT_413735 [Selaginella moellendorffii]
Length=541

 Score =   197 bits (500),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 135/184 (73%), Gaps = 5/184 (3%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YGQLGNNLP P +S ELI  LK  RVKIYDANP IL AL N+ V+V+VMVPN+ IP
Sbjct  93   IGVNYGQLGNNLPVPLKSVELIRQLKLGRVKIYDANPSILSALANTSVKVTVMVPNQQIP  152

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSV  479
            +++S Q+ AD WV++NV  +Y  T+IR +L+GNEILS+     +TW +LVPAM+ I RS+
Sbjct  153  SVASSQSFADEWVKSNVTAYYPFTRIRTVLIGNEILSDFSIRQSTWPKLVPAMKNIHRSL  212

Query  480  KKFGL-RKIKVGTPLA-MDMLEAS-YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             K GL RKIKV TP A +++L+   +PPS+G FR D+   + +P+L+FL  TNS FF D 
Sbjct  213  AKLGLHRKIKVSTPHALLNVLQGYVFPPSNGTFRDDIAEPIIRPMLEFLHSTNSPFFVDA  272

Query  651  YPYF  662
            YP+F
Sbjct  273  YPFF  276



>ref|XP_003572424.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=590

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG LG+NLPTP+RS  L+    A  VKIYDANP+IL A   + + VS MVPNEIIP
Sbjct  44   LGVNYGTLGDNLPTPTRSVRLLRDAGAGAVKIYDANPEILSAFAGTGIPVSAMVPNEIIP  103

Query  306  NISSDQALADRWVETNV-VPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRS  476
            +I++ +A A +WV  N+  P     KI YLLVGNE+LSN    ++TW  +VPAMR +R +
Sbjct  104  SIAASRAAAHKWVVNNLPKPSSHGPKIVYLLVGNELLSNQAIKDSTWGAIVPAMRNLRHA  163

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            ++K G+ ++K+GTPLAMD L ASYPPSS  FR D+   V +PLL+FL+ T S++F D YP
Sbjct  164  LRKHGMGRVKLGTPLAMDALSASYPPSSSLFRDDIELKVMRPLLRFLNLTKSYYFVDAYP  223

Query  657  YF  662
            YF
Sbjct  224  YF  225



>ref|XP_010435194.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Camelina 
sativa]
Length=479

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 133/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSRTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++SS+Q  AD WV TN++P+Y +T+IR++LVGNE+L+         LVPAMRKI 
Sbjct  98   NHQITSLSSNQTTADEWVRTNILPYYPQTQIRFVLVGNEVLNYNYGNISANLVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +S+PPS+G FR ++ G V  PLL+FL+ TNS+FF +V
Sbjct  158  NSLRFRGIHNIKVGTPLAMDSLRSSFPPSNGTFREEIAGPVILPLLKFLNGTNSYFFINV  217

Query  651  YPYF  662
            +PYF
Sbjct  218  HPYF  221



>ref|XP_010527440.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Tarenaya 
hassleriana]
Length=489

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 132/188 (70%), Gaps = 6/188 (3%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  VGI YG+ G+NLP+P +S  LI  + A  VK+YDA+P+ L  L  ++++V++MV N 
Sbjct  39   SGRVGISYGRQGDNLPSPYKSINLIKSVNAGHVKLYDADPETLILLSQTNLRVTIMVQNH  98

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS----NPPNTTWFQLVPAMRK  464
             I +I SDQ  AD WV TNV+P+Y  T IR++LVGNE+LS    +     W  LVPAMRK
Sbjct  99   DIVSIGSDQRAADDWVRTNVLPYYPRTLIRFVLVGNEVLSYYNTDQDRDIWRNLVPAMRK  158

Query  465  IRRSVKKFGLRKIKVGTPLAMDMLEA--SYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            I +S++  G+  +KVGTPLAMD+L++  ++PPSSG FR D+   V  PLL+FL+ TNSFF
Sbjct  159  IVKSLRAQGIHNVKVGTPLAMDVLQSATTFPPSSGTFRDDIAFPVMLPLLKFLNGTNSFF  218

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  219  FIDVYPYF  226



>ref|XP_007199923.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
 gb|EMJ01122.1| hypothetical protein PRUPE_ppa006984mg [Prunus persica]
Length=387

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +3

Query  279  VMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAM  458
            +MVPNE+I NISS+Q LAD+WV  NVVPFY ET IRYLLVGNEILS P  T WF LVPAM
Sbjct  1    MMVPNELINNISSNQTLADQWVHANVVPFYPETLIRYLLVGNEILSQPDKTIWFNLVPAM  60

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            RKI+ ++K  G+ K+KVGTPLAMD+LE+S+PPS+G FRSD++ SV KPLLQF+++T SFF
Sbjct  61   RKIKAALKTHGITKVKVGTPLAMDVLESSFPPSNGTFRSDISTSVIKPLLQFVNKTKSFF  120

Query  639  FFDVYPYF  662
            F DVY YF
Sbjct  121  FVDVYTYF  128



>ref|XP_006414816.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
 gb|ESQ56269.1| hypothetical protein EUTSA_v10025081mg [Eutrema salsugineum]
Length=479

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 132/184 (72%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L ++++ V++ VP
Sbjct  38   DLASKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSHTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++ S+Q  A+ WV+TN++P+Y +T+IR++LVGNEILS         LVPAMRKI 
Sbjct  98   NHQIISLGSNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSAENRNITANLVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +++PPS+  FR D+ G +  PL++FL+ TNS+FF ++
Sbjct  158  TSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDIAGELMLPLMKFLNGTNSYFFINL  217

Query  651  YPYF  662
             PYF
Sbjct  218  QPYF  221



>ref|NP_001149815.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 gb|ACG36890.1| glucan endo-1,3-beta-glucosidase A6 precursor [Zea mays]
 tpg|DAA62204.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=479

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA     +G+ YG++ +++P+P RS EL+    A  VKIYDANP +LRAL  +   VS+M
Sbjct  26   GASGGYGLGVNYGRVADDIPSPWRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIM  85

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAM  458
            VPN+IIP++++  A ADRWV  N+VP+Y  T++++LLVGNEILS+    N+TW  LVPAM
Sbjct  86   VPNQIIPDLAASAAAADRWVAENLVPYYPATRVKFLLVGNEILSDLSIANSTWPHLVPAM  145

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTN  629
              I RS++K  +  +K+GT LAMD L       PPS+ AFR+D+  +V +PLL FL+ TN
Sbjct  146  ENIHRSLRKRSISSVKIGTTLAMDALADGAFPRPPSAAAFRADIAEAVVRPLLHFLNGTN  205

Query  630  SFFFFDVYPYF  662
            S++F D YPYF
Sbjct  206  SYYFVDAYPYF  216



>ref|XP_004957267.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6-like 
[Setaria italica]
Length=483

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 129/180 (72%), Gaps = 5/180 (3%)
 Frame = +3

Query  138  YGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISS  317
            YG++ +++P+P RS EL+    A  VKIYDANP +LRAL  +   VS+MVPN+IIP+I++
Sbjct  42   YGRVADDIPSPRRSVELLRAAGAGSVKIYDANPGVLRALAGTRWPVSIMVPNQIIPDIAA  101

Query  318  DQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSVKKFG  491
              A ADRWV  N+VP+Y  T++++LLVGNEILS+    N+TW +LVPAM  I  S++K G
Sbjct  102  SAAAADRWVAENLVPYYPATRVKFLLVGNEILSDYSIANSTWLRLVPAMENIHLSLRKRG  161

Query  492  LRKIKVGTPLAMDML---EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            +  +K+GT LAMD L   +   PPS+ AFR D+  SV +PLL FL+ TNS++F D YPYF
Sbjct  162  ISSVKIGTTLAMDALADGDFPRPPSAAAFRPDIAASVVRPLLHFLNGTNSYYFVDAYPYF  221



>gb|EEC84834.1| hypothetical protein OsI_31928 [Oryza sativa Indica Group]
Length=477

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 133/184 (72%), Gaps = 5/184 (3%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +++P P+RS EL+  + A  VKIYDAN  +LRAL  + ++VS+MVPNEIIP
Sbjct  31   IGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAGTRMRVSIMVPNEIIP  90

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSV  479
             +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM  +  S+
Sbjct  91   GLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAMENLHVSL  150

Query  480  KKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            ++  +  +K+ T LAMD L +     PPS+ AFR D+ G V +PLL+FL+ TNS++F D 
Sbjct  151  RRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGDVVRPLLRFLNGTNSYYFVDA  210

Query  651  YPYF  662
            YPYF
Sbjct  211  YPYF  214



>ref|NP_001063586.1| Os09g0502200 [Oryza sativa Japonica Group]
 dbj|BAF25500.1| Os09g0502200 [Oryza sativa Japonica Group]
 gb|EEE69998.1| hypothetical protein OsJ_29910 [Oryza sativa Japonica Group]
Length=480

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 133/184 (72%), Gaps = 5/184 (3%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +++P P+RS EL+  + A  VKIYDAN  +LRAL  + ++VS+MVPNEIIP
Sbjct  34   IGVNYGRVADDIPPPARSVELLRAVGAGSVKIYDANSSVLRALAGTRMRVSIMVPNEIIP  93

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRRSV  479
             +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM  +  S+
Sbjct  94   GLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAMENLHVSL  153

Query  480  KKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            ++  +  +K+ T LAMD L +     PPS+ AFR D+ G V +PLL+FL+ TNS++F D 
Sbjct  154  RRRRISSVKISTTLAMDALTSGSFPRPPSAAAFRPDIAGDVVRPLLRFLNGTNSYYFVDA  213

Query  651  YPYF  662
            YPYF
Sbjct  214  YPYF  217



>gb|AEN82021.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82022.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82024.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82028.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   178 bits (451),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  569
            GNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  570  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            R DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  151



>dbj|BAK05423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = +3

Query  123  TVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEII  302
             +G+ YG L ++LPT +RS +L+    A  VK+Y+A+ +IL AL  + + VSVMVPN++I
Sbjct  33   AIGVNYGSLADDLPTATRSVKLLRKANAGAVKLYNADQRILHALAGTGIPVSVMVPNDLI  92

Query  303  PNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRS  476
            P+++  +A A +WV  N+   +   ++ YLLVGNE+LS P    +TW ++VPAM+ +R +
Sbjct  93   PSLADSRAAARKWVANNL-KRHPRVRVMYLLVGNELLSYPAIAASTWGKIVPAMKNLRYA  151

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            ++  GL ++K+GTPLAMD L ASYPPS+GAFR D+ G+V +PLL FL+ T S++F D YP
Sbjct  152  LRAIGLGRVKLGTPLAMDALAASYPPSAGAFREDIAGTVMRPLLHFLNYTRSYYFVDAYP  211

Query  657  YF  662
            YF
Sbjct  212  YF  213



>ref|XP_002534357.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF28022.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=388

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            MVPNE+I NIS  Q+L+D+WV +NVVPFY + KIRYLL+GNEIL+NP   TWF LVPAMR
Sbjct  1    MVPNELIANISKSQSLSDQWVNSNVVPFYPDVKIRYLLIGNEILTNPDTGTWFNLVPAMR  60

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            +I+ S++   + KIKV TP AM++LE+S+PPS+G FRSD++G + KP+LQFL+RT SFFF
Sbjct  61   RIKSSLRTHKIHKIKVSTPHAMNVLESSFPPSNGTFRSDISGPIIKPMLQFLNRTKSFFF  120

Query  642  FDVYPYF  662
             DVYPYF
Sbjct  121  LDVYPYF  127



>gb|KJB10880.1| hypothetical protein B456_001G230200 [Gossypium raimondii]
Length=386

 Score =   184 bits (466),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            MVPNEII NIS+ Q LAD WVETNVVPFY  TKIRYLLVGNE++S  P   W  +VPAMR
Sbjct  1    MVPNEIINNISTSQKLADSWVETNVVPFYSTTKIRYLLVGNEVISGSPKDIWPNIVPAMR  60

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            KI++S+K  GL KIKV T +AMD+LE+S+PPS+G FRSD+  S+ +PLLQFL RT SF+F
Sbjct  61   KIKKSLKTHGLDKIKVSTSMAMDVLESSFPPSNGTFRSDIADSIVRPLLQFLHRTKSFYF  120

Query  642  FDVYPYF  662
             DVYPYF
Sbjct  121  LDVYPYF  127



>gb|AEN82027.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 113/151 (75%), Gaps = 3/151 (2%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I ++ +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISVGTDQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  569
            GNE+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  570  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            R DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  151



>ref|XP_009144683.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            ++++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   ELASKIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++S++Q  AD WV+TN++P+Y +T+IR++LVGNEILS         +VPAMRKI 
Sbjct  98   NHQITSLSANQTTADDWVKTNILPYYPQTQIRFVLVGNEILSVKDRNITANVVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  158  NSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINL  217

Query  651  YPYF  662
             PYF
Sbjct  218  QPYF  221



>emb|CDY08310.1| BnaA05g13090D [Brassica napus]
Length=479

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 131/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            ++++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   ELASRIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            N  I ++S++Q  AD WV+TN++P+Y +T+IR++LVGNEILS         +VPAMRKI 
Sbjct  98   NHQITSLSANQTTADDWVKTNILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  158  NSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINL  217

Query  651  YPYF  662
             PYF
Sbjct  218  QPYF  221



>gb|AEN82023.1| AT3G23770-like protein, partial [Capsella rubella]
 gb|AEN82026.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   176 bits (445),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  569
            GNE+LS   +     W  LVPAM K+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  570  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            R DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTNSFFFLDVYPYF  151



>ref|XP_010673323.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Beta 
vulgaris subsp. vulgaris]
Length=473

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 125/179 (70%), Gaps = 1/179 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG+LG+NLP+P +S ELI  + A  VK+YDA+P+ ++ L  +D+ VS+MV N+ I 
Sbjct  39   IGVNYGKLGSNLPSPYKSIELIKSMNASMVKLYDADPETMKLLAGTDLHVSIMVRNDEIV  98

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
             ++++  LA++WV  NV  +Y  T IR ++VGNE+ SN     W  LV AM+ IR ++  
Sbjct  99   ELATNDTLANQWVHENVFAYYPTTMIRSIMVGNEVYSNHNLEQWDNLVLAMQHIRNTLHT  158

Query  486  FGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
              +  IKVGTPLAMD+L +++PPS+G FR D T +   PLLQFL+RT SFFF D+YPYF
Sbjct  159  HDIHNIKVGTPLAMDILGSTFPPSNGTFRVD-TLTTIVPLLQFLNRTGSFFFLDIYPYF  216



>dbj|BAJ88052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 131/184 (71%), Gaps = 5/184 (3%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +++PTP RS +L+    A  VKIYDANP +LRAL  + + VS+MVPN++IP
Sbjct  43   LGVNYGRVADDIPTPRRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIP  102

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSV  479
            ++++  A ADRWV  N++P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS+
Sbjct  103  DLAASYAAADRWVAANLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSL  162

Query  480  KKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            +   + ++K+GT LAMD L A     PPS+ AFR D+  SV +PLL+FL+ TNS++F D 
Sbjct  163  RARRVSRVKLGTTLAMDALVAGAFPRPPSAAAFRPDIAESVLRPLLRFLEGTNSYYFVDA  222

Query  651  YPYF  662
            Y YF
Sbjct  223  YTYF  226



>gb|KCW48409.1| hypothetical protein EUGRSUZ_K02112 [Eucalyptus grandis]
Length=418

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 131/202 (65%), Gaps = 34/202 (17%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHG-LKAKRVKIYDANPKILRALGNSDVQVSV  281
            GA+ ++ + + YGQL NNLP+   +  LI   L +K VK+YDANP+IL AL N+ ++V  
Sbjct  17   GAEATSALRVNYGQLCNNLPSSPDAVRLIKKRLSSKSVKLYDANPQILLALRNTGLEVCA  76

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            MVPNE+I NIS+DQAL+D WV +N++PFY +TKIR+LLVGNEILS+P N           
Sbjct  77   MVPNELIANISADQALSDHWVGSNIIPFYPDTKIRHLLVGNEILSDPGN-----------  125

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRT---  626
                   +  +R +KVG  +AM+ LE S  YPPS+G+FRSD++GSV KP+LQFL  T   
Sbjct  126  -------RHRIRNVKVGISMAMETLEGSSVYPPSNGSFRSDISGSVMKPMLQFLSETKSD  178

Query  627  ----------NSFFFFDVYPYF  662
                       S+ +FD YPYF
Sbjct  179  LHFFFFFFGRESYLYFDAYPYF  200



>ref|XP_002964439.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
 gb|EFJ34772.1| hypothetical protein SELMODRAFT_230318 [Selaginella moellendorffii]
Length=339

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            A VGI YG++ NNLP+PS +  LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ 
Sbjct  12   AQVGINYGRVANNLPSPSTAVSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQD  71

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRR  473
            IP I+S+ + AD WV  NVV  Y  T I  +LVGNEILS+    ++TW  LVPAM  I  
Sbjct  72   IPGIASNASHADSWVAQNVVHHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFA  131

Query  474  SVKKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            S++   L  KIKV TPLA D L  SYPPS+GAF S++  SV +PLL FL +T S +  +V
Sbjct  132  SLQARNLTAKIKVSTPLASDALSTSYPPSAGAFHSEIATSVIQPLLAFLAKTGSSYHANV  191

Query  651  YPYF  662
            YPYF
Sbjct  192  YPYF  195



>gb|ADG38498.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38500.1| AT3G23770-like protein [Capsella grandiflora]
 gb|ADG38501.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   175 bits (443),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  575
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  576  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDVYPYF  149



>gb|ADG38497.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   174 bits (442),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  575
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  576  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDVYPYF  149



>dbj|BAK04571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 131/184 (71%), Gaps = 5/184 (3%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +++PTP RS +L+    A  VKIYDANP +LRAL  + + VS+MVPN++IP
Sbjct  91   LGVNYGRVADDIPTPRRSVQLLRAAGAGSVKIYDANPAVLRALAGTGMAVSIMVPNQVIP  150

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAMRKIRRSV  479
            ++++  A ADRWV  N++P+   T++++LLVGNE+LS+     +TW ++VPAM  + RS+
Sbjct  151  DLAASYAAADRWVAANLLPYLPRTRVKFLLVGNEVLSDGSIAASTWPRIVPAMENLHRSL  210

Query  480  KKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            +   + ++K+GT LAMD L A     PPS+ AFR D+  SV +PLL+FL+ TNS++F D 
Sbjct  211  RARRVSRVKLGTTLAMDALVAGAFPRPPSAAAFRPDIAESVLRPLLRFLEGTNSYYFVDA  270

Query  651  YPYF  662
            Y YF
Sbjct  271  YTYF  274



>gb|AEN82025.1| AT3G23770-like protein, partial [Capsella rubella]
Length=165

 Score =   174 bits (440),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +3

Query  219  IYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLV  398
            +YDA+P+ L+ L  +++ V++MVPN+ I +I +DQA AD WV TNV+PFY +T+IR++LV
Sbjct  1    LYDADPETLKLLSKTNLYVTIMVPNDQIISIGADQAAADNWVATNVLPFYPQTRIRFVLV  60

Query  399  GNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAF  569
            GNE+LS   +     W  LVPAM K+  S++  G+  IKVGTPLAMD L +S+PPSSGAF
Sbjct  61   GNEVLSYSSDQDKQIWANLVPAMHKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAF  120

Query  570  RSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            R DL   V  PLL+FL+ T+SFFF DVYPYF
Sbjct  121  REDLAVPVMLPLLKFLNGTSSFFFLDVYPYF  151



>ref|XP_002971665.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
 gb|EFJ27414.1| hypothetical protein SELMODRAFT_231791 [Selaginella moellendorffii]
Length=449

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 124/182 (68%), Gaps = 3/182 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG L N +  P  +  LI  L   R KI+ A+  I+RA  NS V++SVMV N+ IP
Sbjct  1    MGINYGTLSNEILRPPEAVGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIP  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSV  479
             I+S Q+ AD WVE NV  +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ +V
Sbjct  61   EIASSQSSADAWVEKNVAAYYPKTAIESVLVGNEILSDSSIRESTWPKLVPAMEKIQSAV  120

Query  480  KKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            +KF L   IKV TPLA D L  SYPPS+G+F+SD+  S+ +PLL+FL RTNSF+  +VYP
Sbjct  121  EKFELAGSIKVSTPLASDALGNSYPPSAGSFKSDIAESIIQPLLEFLSRTNSFYCGNVYP  180

Query  657  YF  662
            YF
Sbjct  181  YF  182



>gb|ADG38499.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN  I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNXQIISVGSDQAAADXWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  575
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  576  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            DL   V  PLL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLPLLKFLNGTNSFFFLDVYPYF  149



>gb|ADG38503.1| AT3G23770-like protein [Neslia paniculata]
Length=169

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I  I SDQA AD WV T V+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIITIGSDQAAADNWVATKVIPFYPQTRIRFVLVGN  60

Query  405  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  575
            EILS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L++S+PPSSGAFR 
Sbjct  61   EILSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALQSSFPPSSGAFRE  120

Query  576  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            D+   V  PLL+FL+ TN+FFF DVYPYF
Sbjct  121  DIAVPVMLPLLKFLNGTNTFFFLDVYPYF  149



>gb|ABR16205.1| unknown [Picea sitchensis]
Length=494

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 126/181 (70%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG++ +NLP+PS +  LI  L+A  VKIYDA+P++L AL N+ +QV++ V N+ I 
Sbjct  48   LGINYGRVADNLPSPSSAVALIKNLQAGYVKIYDADPQVLSALSNTALQVTITVRNQDIS  107

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPN-TTWFQLVPAMRKIRRSVK  482
            NISS   +A++WV+ NV+P Y  T I  ++VGNE+LS+  N  TW  ++PAM  I  S+ 
Sbjct  108  NISSSPTVAEQWVQANVLPHYPSTLITAIMVGNEVLSDYQNQATWLLMLPAMPNIHASLL  167

Query  483  KFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
              GL   IKV T LAMD+L +SYPPS G FR+D+   V +PLL F++RT SF F D+YP+
Sbjct  168  NHGLADSIKVTTSLAMDVLSSSYPPSEGTFRNDVASPVLQPLLDFVNRTGSFVFLDIYPF  227

Query  660  F  662
            F
Sbjct  228  F  228



>ref|XP_010238330.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=477

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 133/191 (70%), Gaps = 5/191 (3%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            G+     +G+ YG++ +++P+P RS +L+    A  VKIYDANP +LRAL  + + VS+M
Sbjct  28   GSRTPHGLGVNYGRVADDIPSPRRSVQLLRAAGAGSVKIYDANPAVLRALAGTRIPVSIM  87

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAM  458
            VPNEIIP++++  A AD WV  N++P+  +T++++LLVGNE+LS+     +TW ++VPAM
Sbjct  88   VPNEIIPDLAASAAKADEWVVQNLLPYLAKTRVKFLLVGNEVLSDRSIATSTWPRIVPAM  147

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASY---PPSSGAFRSDLTGSVFKPLLQFLDRTN  629
              + RS++   +  +K+GT LAMD L +     PPS+  FR+D+  +V +PLL+FL+ TN
Sbjct  148  ENLHRSLRARRVSSVKLGTTLAMDALVSGAFPRPPSAAVFRADIAEAVVRPLLRFLNGTN  207

Query  630  SFFFFDVYPYF  662
            S++F D YPYF
Sbjct  208  SYYFVDAYPYF  218



>emb|CAA49513.1| beta-1,3-glucanase homologue [Brassica napus]
Length=474

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            ++++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  33   ELASKIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVP  92

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
               I ++S++Q  A+ WV+TN++P+Y +T+IR++LVGNEILS         +VPAMRKI 
Sbjct  93   THQITSLSANQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIV  152

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  153  NSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINL  212

Query  651  YPYF  662
             PYF
Sbjct  213  QPYF  216



>emb|CDY06469.1| BnaC06g11750D [Brassica napus]
Length=479

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 130/184 (71%), Gaps = 0/184 (0%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            ++++ +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   ELASKIGINYGRQGNNLPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
               I ++S++Q  A+ WV+TN++P+Y +T+IR++LVGNEILS         +VPAMRKI 
Sbjct  98   THQITSLSANQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIV  157

Query  471  RSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
             S++  G+  IKVGTPLAMD L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++
Sbjct  158  NSLRAHGIHNIKVGTPLAMDSLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINL  217

Query  651  YPYF  662
             PYF
Sbjct  218  QPYF  221



>emb|CDY01191.1| BnaA04g06280D [Brassica napus]
Length=480

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 128/185 (69%), Gaps = 1/185 (1%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+ + +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLPSKIGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKI  467
            N +I ++S++Q  A+ WV+TN++P+Y +T IR++LVGNEILS          +VPAMRKI
Sbjct  98   NHLITSLSTNQTTAEDWVQTNIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKI  157

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
              S++  G+  IKVGT L MD L +S+PPS+  FR D+   +  PLL+FL+ TNS+FF +
Sbjct  158  VTSLRAHGIHNIKVGTALDMDSLRSSFPPSNSTFREDIAEPLMLPLLKFLNGTNSYFFIN  217

Query  648  VYPYF  662
            + PYF
Sbjct  218  LQPYF  222



>ref|XP_009139564.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=480

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 128/185 (69%), Gaps = 1/185 (1%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+ + +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLPSKIGINYGRRGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKI  467
            N +I ++S++Q  A+ WV+TN++P+Y +T IR++LVGNEILS          +VPAMRKI
Sbjct  98   NHLITSLSTNQTTAEDWVQTNIIPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKI  157

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
              S++  G+  IKVGT L MD L +S+PPS+  FR D+   +  PLL+FL+ TNS+FF +
Sbjct  158  VTSLRAHGIHNIKVGTALDMDSLRSSFPPSNSTFREDIAEPLMLPLLKFLNGTNSYFFIN  217

Query  648  VYPYF  662
            + PYF
Sbjct  218  LQPYF  222



>gb|ADG38502.1| AT3G23770-like protein [Capsella grandiflora]
Length=169

 Score =   172 bits (435),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +3

Query  225  DANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGN  404
            DA+P+ L+ L  +++ V++MVPN+ I ++ SDQA AD WV TNV+PFY +T+IR++LVGN
Sbjct  1    DADPETLKLLSKTNLYVTIMVPNDQIISVGSDQAAADNWVATNVLPFYPQTRIRFVLVGN  60

Query  405  EILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRS  575
            E+LS   +     W  LVPAMRK+  S++  G+  IKVGTPLAMD L +S+PPSSGAFR 
Sbjct  61   EVLSYSSDQDKQIWANLVPAMRKVVNSLRARGIHNIKVGTPLAMDALRSSFPPSSGAFRE  120

Query  576  DLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            DL   V   LL+FL+ TNSFFF DVYPYF
Sbjct  121  DLAVPVMLXLLKFLNGTNSFFFLDVYPYF  149



>emb|CDY12732.1| BnaC04g29090D [Brassica napus]
Length=480

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 128/185 (69%), Gaps = 1/185 (1%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            D+ + +GI YG+ GNNLP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP
Sbjct  38   DLPSKIGINYGRQGNNLPSPYQSINFIKSIKAGHVKLYDADPESLTLLSQTNLYVTITVP  97

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS-NPPNTTWFQLVPAMRKI  467
            N +I ++S++Q  A+ WV+TN+ P+Y +T IR++LVGNEILS          +VPAMRKI
Sbjct  98   NHLITSLSTNQTSAEDWVQTNITPYYPQTHIRFVLVGNEILSVEERRNITANVVPAMRKI  157

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
              S++  G+  IKVGT L MD L +++PPS+  FR D+  ++  PLL+FL+ TNS+FF +
Sbjct  158  VTSLRAHGIHNIKVGTALDMDSLRSTFPPSNSTFREDIAETLMLPLLKFLNGTNSYFFIN  217

Query  648  VYPYF  662
            + PYF
Sbjct  218  LQPYF  222



>gb|KEH22560.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=386

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            M+PNE+I NISS+Q L+D+W+++N++P+Y +T IRYLLVGNEI+S+ PN+TW  LVPAMR
Sbjct  1    MLPNELITNISSNQTLSDQWIKSNILPYYPQTLIRYLLVGNEIISSTPNSTWLHLVPAMR  60

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            +I+ S+KKF +++IKVGT  AMD+LE S+PPS+ AFR D+   V KP+L+FL+RT SFFF
Sbjct  61   RIKHSLKKFRVKRIKVGTSSAMDVLETSFPPSNAAFRKDIAVQVIKPMLRFLNRTKSFFF  120

Query  642  FDVYPYF  662
             DVYP+F
Sbjct  121  LDVYPFF  127



>ref|XP_002965673.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
 gb|EFJ33093.1| hypothetical protein SELMODRAFT_85067 [Selaginella moellendorffii]
Length=449

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 124/182 (68%), Gaps = 3/182 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG L N +  P  +  LI  L   R KI+ A+  I+RA  NS V++SVMV N+ IP
Sbjct  1    MGINYGTLSNEILRPPEAVGLIKDLGFDRAKIFSADSSIIRAFANSGVKLSVMVANQQIP  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSV  479
             I+S Q+ AD WV+ NV  +Y +T I  +LVGNEILS+     +TW +LVPAM KI+ ++
Sbjct  61   EIASSQSSADAWVKKNVAAYYPKTAIDSVLVGNEILSDSSIRESTWPKLVPAMEKIQSAL  120

Query  480  KKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            +KF L   IKV TPLA D L  SYPPS+G+F+SD+  S+ +PLL+FL RTNSF+  +VYP
Sbjct  121  EKFELAGSIKVSTPLASDALGNSYPPSAGSFKSDIAESIIQPLLEFLSRTNSFYCGNVYP  180

Query  657  YF  662
            YF
Sbjct  181  YF  182



>ref|XP_002298669.2| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE83474.2| glucan endo-1 family protein [Populus trichocarpa]
Length=416

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = +3

Query  198  LKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGET  377
            +KA  VK+YDANP+ILR L  +++ VS+MV N+ I NI+++Q  A++WVE NV+ +Y +T
Sbjct  1    MKAGSVKLYDANPEILRLLARTNIHVSIMVRNDEIINIAANQTTANKWVEDNVLRYYPDT  60

Query  378  KIRYLLVGNEILS---NPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASY  548
             IR +LVGNE+LS   +     W  LVPAMR+I+ S++   +R IKVGTPLAMD+L+ ++
Sbjct  61   IIRTILVGNEVLSYSSDAGKQIWNHLVPAMRRIKISLRAQDIRNIKVGTPLAMDVLQTAF  120

Query  549  PPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            PPS+G FRSD++ SV  PLL FL+ T SFFF D YPYF
Sbjct  121  PPSNGTFRSDISTSVMVPLLNFLNSTKSFFFIDAYPYF  158



>emb|CDY12371.1| BnaC08g08340D [Brassica napus]
Length=479

 Score =   178 bits (451),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+ G +LP+P +S   I  +KA  VK+YDA+P+ L  L ++++ VS+ V N
Sbjct  39   LASKIGINYGRQGKDLPSPYQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHN  98

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
              I ++ ++Q  A+ WV+TN++P+Y +T+IR++LVGNEILS         LVPAMRKI  
Sbjct  99   HQITSLGTNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVQDRNITANLVPAMRKIVN  158

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            +++  G+  IKVGTPL MD L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++ 
Sbjct  159  ALRAHGIHNIKVGTPLPMDSLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINLQ  218

Query  654  PYF  662
            PY+
Sbjct  219  PYY  221



>ref|XP_002972033.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
 gb|EFJ26950.1| hypothetical protein SELMODRAFT_96745, partial [Selaginella moellendorffii]
Length=459

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG++ +NLP P+R  EL+  LK + VKIYDANP +L+AL +++++V++MV N+ I 
Sbjct  1    IGINYGRVADNLPPPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEIE  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSV  479
             +++    +D+WV+ NV   Y  TKI   +VGNEILS+     T W +LVPAM  +  S+
Sbjct  61   QMAASSNFSDQWVQQNVAA-YPATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLHSSL  119

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
            ++ G  KIKV T LA+D L+ S+PPS GAFR D++ ++ +P+L+FL+ T S FF +VYPY
Sbjct  120  QRLGHGKIKVTTSLAIDCLKVSFPPSEGAFRDDVSDTIIQPMLKFLETTQSPFFINVYPY  179

Query  660  F  662
            F
Sbjct  180  F  180



>emb|CDY27122.1| BnaA08g07600D [Brassica napus]
Length=479

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+ G ++P+P +S   I  +KA  VK+YDA+P+ L  L ++++ VS+ V N
Sbjct  39   LASKIGINYGRQGKDIPSPYQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHN  98

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
              I ++ ++Q  A+ WV+TN++P+Y +T+IR++LVGNEILS         LVPAMRKI  
Sbjct  99   HQITSLGTNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVN  158

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            +++  G+  IKVGTPL MD L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++ 
Sbjct  159  ALRAHGIHNIKVGTPLPMDSLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINLQ  218

Query  654  PYF  662
            PY+
Sbjct  219  PYY  221



>ref|XP_009108090.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brassica 
rapa]
Length=479

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 128/183 (70%), Gaps = 0/183 (0%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +++ +GI YG+ G ++P+P +S   I  +KA  VK+YDA+P+ L  L ++++ VS+ V N
Sbjct  39   LASKIGINYGRQGKDIPSPYQSINFIKSIKAGHVKLYDADPETLTLLSHTNLYVSITVHN  98

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
              I ++ ++Q  A+ WV+TN++P+Y +T+IR++LVGNEILS         LVPAMRKI  
Sbjct  99   HQITSLGTNQTTAEDWVKTNILPYYPQTQIRFVLVGNEILSVQDRNITSNLVPAMRKIVN  158

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            +++  G+  IKVGTPL MD L +++PPS+  FR D+ G +  PLL+FL+ TNS+FF ++ 
Sbjct  159  ALRAHGIHNIKVGTPLPMDSLRSTFPPSNSTFREDIAGPLMLPLLKFLNGTNSYFFINLQ  218

Query  654  PYF  662
            PY+
Sbjct  219  PYY  221



>gb|KEH18116.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=383

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  282  MVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMR  461
            M+PNE++ N+SS+Q LA++WV+TN+VPFY +T IRYLLVGNE++S+  N TW  +VPAM 
Sbjct  1    MLPNELVTNVSSNQTLANQWVQTNLVPFYSKTLIRYLLVGNELISSTTNQTWPHIVPAMY  60

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFF  641
            +++ S+  FGL K+KVGTPLAMD+L+ S+PPS+G FR+D+  SV KP+L+FL  TNSFFF
Sbjct  61   RMKHSLTIFGLHKVKVGTPLAMDVLQTSFPPSNGTFRNDIALSVMKPMLEFLHVTNSFFF  120

Query  642  FDVYPYF  662
             DVYP+F
Sbjct  121  LDVYPFF  127



>ref|NP_001062294.2| Os08g0525800 [Oryza sativa Japonica Group]
 dbj|BAF24208.2| Os08g0525800 [Oryza sativa Japonica Group]
Length=471

 Score =   175 bits (443),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG + ++LPT +RS EL+    A  V+IYDAN  ILRAL  + V VSV VPN+ IP
Sbjct  33   LGVNYGTVADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTGVPVSVTVPNDAIP  92

Query  306  NISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRR  473
            ++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T W  LVPAM  +RR
Sbjct  93   SLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTAWPSLVPAMANLRR  152

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            ++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+FL+ T S++F D Y
Sbjct  153  ALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEFLNATGSYYFVDAY  212

Query  654  PYF  662
            PYF
Sbjct  213  PYF  215



>ref|XP_002972579.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
 gb|EFJ26665.1| hypothetical protein SELMODRAFT_97838, partial [Selaginella moellendorffii]
Length=460

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 126/181 (70%), Gaps = 3/181 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG++ +NLP P+R  EL+  LK + VKIYDANP +L+AL +++++V++MV N+ I 
Sbjct  1    IGINYGRVADNLPPPARVVELLQSLKIRSVKIYDANPDVLKALQSTNLRVAIMVTNQEIE  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSV  479
             +++    +D+WV+ NV   Y  TKI   +VGNEILS+     T W +LVPAM  +  S+
Sbjct  61   QMAASSNFSDQWVQQNVAA-YPATKIETAIVGNEILSDLSLRQTVWSKLVPAMENLHSSL  119

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
            ++ G  KIKV T LA+D L+ S+PPS G FR D++ ++ +P+L+FL+ T S FF +VYPY
Sbjct  120  QRLGHGKIKVTTSLAIDCLKVSFPPSDGVFRDDISDAIIQPMLKFLETTQSPFFINVYPY  179

Query  660  F  662
            F
Sbjct  180  F  180



>dbj|BAC75423.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
Length=482

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG + ++LPT +RS EL+    A  V+IYDAN  ILRAL  + V VSV VPN+ IP
Sbjct  33   LGVNYGTVADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTGVPVSVTVPNDAIP  92

Query  306  NISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRR  473
            ++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T W  LVPAM  +RR
Sbjct  93   SLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTAWPSLVPAMANLRR  152

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            ++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+FL+ T S++F D Y
Sbjct  153  ALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEFLNATGSYYFVDAY  212

Query  654  PYF  662
            PYF
Sbjct  213  PYF  215



>ref|XP_002980798.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
 gb|EFJ17983.1| hypothetical protein SELMODRAFT_444643 [Selaginella moellendorffii]
Length=464

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +N+P+P+++ EL+  +  + VK++DANP++L AL NS ++V++MVPNEII 
Sbjct  30   IGVNYGRVSDNIPSPNQTVELLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPNEIIG  89

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVK  482
             ++S Q+ AD W+  +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + RS++
Sbjct  90   AVASSQSSADDWIAQSVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLHRSLQ  149

Query  483  KFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
               L  +IK+ T +A D+L ASYPPS G FR D+  +V KPLL FL  T + F+ ++YPY
Sbjct  150  SHNLDDRIKITTSVAGDVLAASYPPSVGRFRPDIRDTVLKPLLGFLRTTRAPFYINLYPY  209

Query  660  F  662
            F
Sbjct  210  F  210



>ref|XP_010539314.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13 [Tarenaya hassleriana]
Length=462

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 123/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S +VGI YG++ +NLPTP +  EL+      RVK+YD +  +L AL NS ++V V +PNE
Sbjct  23   SGSVGINYGRIADNLPTPEKVVELLKTQGIHRVKLYDTDKTVLTALANSSIKVVVALPNE  82

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+ AD+WVE N+  +Y  T+I  + VGNE+  +P NTT F LV AM+ +  S
Sbjct  83   LLSSAAADQSFADKWVEANITKYYPSTEIEAIAVGNEVFVDPNNTTEF-LVQAMKNVHSS  141

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L R IKV +P+A+  L +SYPPS+G+F+SDL   V KP+L    +T+S+   + Y
Sbjct  142  LVKYDLDRSIKVSSPIALSSLASSYPPSAGSFKSDLVEPVIKPMLDLFRQTSSYLMVNAY  201

Query  654  PYF  662
            P+F
Sbjct  202  PFF  204



>ref|NP_001051879.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|AAO73280.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|AAS07356.1| putative beta-1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF99870.1| Glycosyl hydrolases family 17 protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13793.1| Os03g0845600 [Oryza sativa Japonica Group]
 gb|EAZ29287.1| hypothetical protein OsJ_13350 [Oryza sativa Japonica Group]
 dbj|BAG98908.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 122/189 (65%), Gaps = 3/189 (2%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
             ++I+  +G+ YG+LG++LP P R+ EL     A  V+ YD+N   L     S +     
Sbjct  20   ASEIAHFLGVNYGRLGDDLPPPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVFVPG  79

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMR  461
            VPNE+IP++++ +  AD WV   ++PF    ++RYL VGNE+LS+P   + WFQLVPAM 
Sbjct  80   VPNELIPSLAASRRAADEWVAATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVPAMA  139

Query  462  KIRRSVKKFGLRKIKVGTPLAMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSF  635
             + R++++ G+R++KV T L MD L+    +PPS+G FR D+  +V +PLL FL+RT+S+
Sbjct  140  NLERALRRHGMRRVKVSTTLGMDALDGQNVFPPSAGVFRPDIADAVVRPLLAFLERTDSY  199

Query  636  FFFDVYPYF  662
             F D Y YF
Sbjct  200  LFVDAYTYF  208



>ref|XP_002975355.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
 gb|EFJ23556.1| hypothetical protein SELMODRAFT_103308, partial [Selaginella 
moellendorffii]
Length=320

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 3/176 (2%)
 Frame = +3

Query  144  QLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQ  323
            ++ NNLP+PS +  LI  L   RVKI+DA+ ++L AL N+ ++VS+MV N+ IP I+S+ 
Sbjct  1    RVANNLPSPSTAVSLIKSLGIDRVKIFDADSQVLAALANTSIKVSIMVRNQDIPGIASNA  60

Query  324  ALADRWVETNVVPFYGETKIRYLLVGNEILSNPP--NTTWFQLVPAMRKIRRSVKKFGLR  497
            + AD WV  NVV  Y  T I  +LVGNEILS+    ++TW  LVPAM  I  S++   L 
Sbjct  61   SHADSWVAQNVVHHYPATHIATILVGNEILSDTSIKSSTWPALVPAMENIFASLQARNLT  120

Query  498  -KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
             KIKV TPLA D L  SYPPS+G F S++  SV +PLL FL +T S +  +VYPYF
Sbjct  121  AKIKVSTPLASDALSTSYPPSAGTFHSEIATSVIQPLLAFLAKTGSSYHANVYPYF  176



>gb|KDO62116.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=475

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 120/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +  VGI YG++ NNLP+P +  EL+   +  RVK YD +  +L AL NSD+ V V  PNE
Sbjct  23   TGKVGINYGRVANNLPSPEKVVELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             +   ++DQ+  D WV+ N+  +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S
Sbjct  83   ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNS  141

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L   +KV +P+A+  L+ SYPPSSG+F+SDL     KP+L+FL +T+S+   + Y
Sbjct  142  LVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAY  201

Query  654  PYF  662
            P+F
Sbjct  202  PFF  204



>gb|KDO62115.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=472

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 120/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +  VGI YG++ NNLP+P +  EL+   +  RVK YD +  +L AL NSD+ V V  PNE
Sbjct  23   TGKVGINYGRVANNLPSPEKVVELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             +   ++DQ+  D WV+ N+  +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S
Sbjct  83   ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNS  141

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L   +KV +P+A+  L+ SYPPSSG+F+SDL     KP+L+FL +T+S+   + Y
Sbjct  142  LVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAY  201

Query  654  PYF  662
            P+F
Sbjct  202  PFF  204



>gb|KDP39185.1| hypothetical protein JCGZ_00942 [Jatropha curcas]
Length=463

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 123/185 (66%), Gaps = 2/185 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            AD +  +G+ YG++ NNLPTP +  EL+      R K+YD +  +L AL NS + V V +
Sbjct  17   ADATGKIGVNYGRIANNLPTPEKVVELLKSQGINRAKLYDTDSTVLTALANSGISVVVAL  76

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE++ + ++DQ+ AD+WV+ N+  +Y +T+I  + VGNE+  +P NTT F LVPAM+ +
Sbjct  77   PNELLASTAADQSFADKWVQANISQYYPQTQIEAIAVGNEVFVDPNNTTKF-LVPAMKNV  135

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
              S+ KF    IK+ +P+A+  L++SYP S+G+F+ DL   V KP+L+FL ++ S+   +
Sbjct  136  YNSLVKFNHSSIKISSPIALSALQSSYPSSAGSFKPDLV-PVMKPMLEFLRQSGSYLMIN  194

Query  648  VYPYF  662
             YP+F
Sbjct  195  AYPFF  199



>ref|XP_002961854.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
 gb|EFJ37114.1| hypothetical protein SELMODRAFT_437767 [Selaginella moellendorffii]
Length=464

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 127/181 (70%), Gaps = 2/181 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ +N+P+P+++  L+  +  + VK++DANP++L AL NS ++V++MVPNEII 
Sbjct  30   IGVNYGRISDNIPSPNQTVALLKSMNVRLVKLFDANPQVLTALSNSSIRVTIMVPNEIIG  89

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPP-NTTWFQLVPAMRKIRRSVK  482
             ++S Q+ AD W+  +V+P+Y  T+I  ++VGNEI S P    TW QL+PA+  + R+++
Sbjct  90   AVASSQSSADDWIAQSVLPYYPSTQIIVIVVGNEIFSYPALAQTWQQLMPAIENLHRALQ  149

Query  483  KFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
               L  +IK+ T +A D+L ASYPPS G FR D+  +V KPLL FL  T + F+ ++YPY
Sbjct  150  SHNLDDRIKITTSVAGDVLAASYPPSVGRFRPDIRDTVLKPLLGFLRTTRAPFYINLYPY  209

Query  660  F  662
            F
Sbjct  210  F  210



>gb|KDO62114.1| hypothetical protein CISIN_1g0115512mg [Citrus sinensis]
Length=483

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 120/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +  VGI YG++ NNLP+P +  EL+   +  RVK YD +  +L AL NSD+ V V  PNE
Sbjct  23   TGKVGINYGRVANNLPSPEKVVELLKSQRIDRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             +   ++DQ+  D WV+ N+  +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S
Sbjct  83   ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNS  141

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L   +KV +P+A+  L+ SYPPSSG+F+SDL     KP+L+FL +T+S+   + Y
Sbjct  142  LVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAY  201

Query  654  PYF  662
            P+F
Sbjct  202  PFF  204



>ref|XP_011044921.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Populus 
euphratica]
Length=476

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 120/181 (66%), Gaps = 1/181 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
             T+G+ YG++ NNLP P+    L+      R+K+YD +  +L AL  S + V V +PNE+
Sbjct  29   GTIGVNYGRVANNLPAPAEVVSLLKSQGINRIKLYDTDSDVLTALAGSSINVVVALPNEL  88

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            + ++++DQ+ AD WV+ N+   + +TKI  + VGNE+  +P NTT F LVPAM+ +  S+
Sbjct  89   LSSVAADQSFADSWVKANISQHFPQTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNSL  147

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
             KF L  IK+ +P+A+  L++SYP S+G+F+++L G V KP+L FL +T S+   + YP+
Sbjct  148  VKFNLSSIKISSPIALSALQSSYPSSAGSFKTELIGPVIKPMLDFLRQTGSYLMINAYPF  207

Query  660  F  662
            F
Sbjct  208  F  208



>ref|XP_002316783.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE97395.2| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=476

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 121/182 (66%), Gaps = 1/182 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + T+G+ YG++ NNLP P+    L+      R+K+YD +  +L AL  S + V V +PNE
Sbjct  28   AGTIGVNYGRVANNLPAPAEVVSLLKSHGINRIKLYDTDSDVLTALAGSSINVVVALPNE  87

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ ++++DQ+ AD WV+ N+   + +TKI  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  88   LLSSVAADQSFADSWVKGNISQHFPQTKIEAIAVGNEVFVDPKNTTPF-LVPAMKNVHNS  146

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            + KF L  IK+ +P+A+  L++SYP S+G+F+++L G V KP+L FL +T S+   + YP
Sbjct  147  LVKFNLSSIKISSPIALSALQSSYPSSAGSFKTELIGPVIKPMLDFLRQTGSYLMINAYP  206

Query  657  YF  662
            +F
Sbjct  207  FF  208



>ref|XP_006452449.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
 gb|ESR65689.1| hypothetical protein CICLE_v10008176mg [Citrus clementina]
Length=473

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +  VGI YG++ NNLP+P +  EL+      RVK YD +  +L AL NSD+ V V  PNE
Sbjct  24   TGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNE  83

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             +   ++DQ+  D WV+ N+  +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S
Sbjct  84   ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNS  142

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L   +KV +P+A+  L+ SYPPSSG+F+SDL     KP+L+FL +T+S+   + Y
Sbjct  143  LVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAY  202

Query  654  PYF  662
            P+F
Sbjct  203  PFF  205



>ref|XP_008230022.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Prunus mume]
Length=344

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +A+VG+ YG++ +NLP+  R ++L+     +RVK++D++P +LRAL  S+++V+V VPNE
Sbjct  31   AASVGVNYGRVADNLPSAYRVSQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNE  90

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ +++  Q+ A  WV+ NVV ++  T+I  + VGNE+  +  NTT F L+PAM+ I  +
Sbjct  91   LLSSVAKSQSFATNWVQRNVVAYHPNTEIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTA  149

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            +  F +   IKV +P+A+  L+ SYP S+G+FR +L  +VFKP+L+FL +T S+   + Y
Sbjct  150  LIHFDIHSAIKVSSPIALSALQNSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNAY  209

Query  654  PYF  662
            PYF
Sbjct  210  PYF  212



>ref|XP_006475009.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Citrus sinensis]
Length=472

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/183 (44%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +  VGI YG++ NNLP+P +  EL+      RVK YD +  +L AL NSD+ V V  PNE
Sbjct  23   TGKVGINYGRVANNLPSPEKVVELLKSQGIGRVKTYDTDSAVLAALANSDISVVVAFPNE  82

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             +   ++DQ+  D WV+ N+  +Y  TKI  + VGNE+ ++P NTT F LVPAM+ +  S
Sbjct  83   ELSKAAADQSFTDNWVQANISKYYPATKIEAVAVGNEVFADPKNTTPF-LVPAMKNVYNS  141

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L   +KV +P+A+  L+ SYPPSSG+F+SDL     KP+L+FL +T+S+   + Y
Sbjct  142  LVKYKLDSNVKVSSPIALGALQNSYPPSSGSFKSDLIEPALKPMLEFLRKTSSYLMVNAY  201

Query  654  PYF  662
            P+F
Sbjct  202  PFF  204



>dbj|BAG16366.1| tapetum-specific protein A6 family protein [Brassica rapa var. 
perviridis]
Length=399

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 118/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  159  LPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADR  338
            LP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VPN  I ++S++Q  AD 
Sbjct  1    LPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPNHQITSLSANQTTADD  60

Query  339  WVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  518
            WV+TN++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTP
Sbjct  61   WVKTNILPYYPQTQIRFVLVGNEILSVQDRNITANVVPAMRKIVNSLRAHGIHNIKVGTP  120

Query  519  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            LAMD L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  121  LAMDSLRSTFPPSNSTFREDIALPLMLPLLKFLNGTNSYFFINLQPYF  168



>ref|XP_008364550.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
 ref|XP_008364558.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14 [Malus domestica]
Length=465

 Score =   169 bits (428),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 122/182 (67%), Gaps = 1/182 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + TVGI YG++ +NLP P +   L+      +VK+YD +  +L AL NS + V V +PNE
Sbjct  25   TGTVGINYGRIADNLPPPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPNE  84

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + +SD + AD+WV++N+  ++ +T+I  + VGNE+  +P NTT F LVPAM+ I+ S
Sbjct  85   LLSSAASDPSFADKWVQSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAMKNIQSS  143

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            + K+ L  IK+ +P+A+  L +SYPPS+GAF  DL   V KP L+FL +T+S+   + YP
Sbjct  144  LVKYNLSSIKLSSPIALSALNSSYPPSAGAFNPDLIEPVIKPFLEFLTQTSSYLMINAYP  203

Query  657  YF  662
            +F
Sbjct  204  FF  205



>gb|EAZ07710.1| hypothetical protein OsI_29967 [Oryza sativa Indica Group]
Length=1020

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 123/183 (67%), Gaps = 4/183 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG + ++LPT +RS EL+    A  V+IYDAN  ILRAL  + V VSV VPN+ IP
Sbjct  33   LGVNYGTVADDLPTAARSVELLRAAGAGAVRIYDANADILRALAGTGVPVSVTVPNDAIP  92

Query  306  NISSDQALA--DRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAMRKIRR  473
            ++++  + A  D WV  N+ P     ++  LLVGNE+LS+     T W  LVPAM  +RR
Sbjct  93   SLAAAASPAAVDEWVARNLAPHIPAARVLCLLVGNEVLSDRATAGTAWPSLVPAMANLRR  152

Query  474  SVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            ++   GL ++KVGT LAMD L  SYPPS+GAFR D+ G+V +PLL+FL+ T S++F D Y
Sbjct  153  ALSARGLGRVKVGTTLAMDALGTSYPPSAGAFRDDIAGAVVRPLLEFLNATGSYYFVDAY  212

Query  654  PYF  662
            PYF
Sbjct  213  PYF  215



>ref|XP_007020717.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY12242.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=475

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 125/183 (68%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            ++++GI YG++ N+LP+P +  EL+  +  ++VK+YD +  +L AL NS + V V +PNE
Sbjct  30   ASSIGINYGRVANDLPSPDKVVELLKSIGVEKVKLYDTDATVLTALANSGISVMVALPNE  89

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+ AD WV++N+  FY  TKI  + VGNE+  +P NTT + +VPAM+ +  S
Sbjct  90   LLASAAADQSFADNWVQSNISKFYPATKIEAIAVGNEVFVDPKNTTSY-VVPAMKNVHAS  148

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + KF L   IK+ +P+A+  L+ SYP S+G+F+ DL   V KP+L FL +T+S+   + Y
Sbjct  149  LVKFNLDSNIKISSPIALSALQNSYPSSAGSFKPDLVEPVIKPMLDFLKQTDSYLMVNAY  208

Query  654  PYF  662
            P+F
Sbjct  209  PFF  211



>ref|XP_009348307.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 121/181 (67%), Gaps = 1/181 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
             TVGI YG++ +NLP P +   L       +VK+YD +  +L AL NS + V V +PNE+
Sbjct  24   GTVGINYGRIADNLPPPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNEL  83

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            + + +SD + AD+WV++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+
Sbjct  84   LSSAASDPSFADKWVQSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSL  142

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
             K+ L  IK+ +P A+  L +SYPPS+GAF+ DL   V KP L+FL +T+S+   + YP+
Sbjct  143  VKYNLSSIKLSSPFALSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINAYPF  202

Query  660  F  662
            F
Sbjct  203  F  203



>ref|XP_009361042.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Pyrus x 
bretschneideri]
Length=465

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 124/182 (68%), Gaps = 1/182 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + TVGI YG++ +NLP P +   L+      +VK+YD +  +L AL NS + V V +PN+
Sbjct  25   TGTVGINYGRIADNLPPPEKVVALLKSQGINKVKLYDTDATVLTALANSGISVVVALPND  84

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + +SD + AD+WV++N+  ++ +T+I  + VGNE+  +P NTT F LVPA++ I+ S
Sbjct  85   LLSSAASDPSFADKWVQSNISHYHPKTQIEAIAVGNEVFVDPNNTTQF-LVPAIKNIQSS  143

Query  477  VKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            + K+ L  IK+ +P+A+  L +SYPPS+GAF+ DL   V KPLL+FL +T+S+   + YP
Sbjct  144  LVKYNLSSIKLSSPIALSSLNSSYPPSAGAFKPDLIEPVIKPLLEFLTQTSSYLMINAYP  203

Query  657  YF  662
            +F
Sbjct  204  FF  205



>ref|XP_009334153.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=463

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 121/181 (67%), Gaps = 1/181 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
             TVGI YG++ +NLP P +   L       +VK+YD +  +L AL NS + V V +PNE+
Sbjct  24   GTVGINYGRIADNLPPPEKVVALFKSQGINKVKLYDTDAAVLTALANSGIGVVVAIPNEL  83

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            + + +SD + AD+WV++N+  ++ +T+I  + VGNE+ ++P NTT F LVPA++ I+ S+
Sbjct  84   LSSAASDPSFADKWVQSNISQYHPKTQIEAIAVGNEVFADPNNTTQF-LVPAIKNIQSSL  142

Query  480  KKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPY  659
             K+ L  IK+ +P A+  L +SYPPS+GAF+ DL   V KP L+FL +T+S+   + YP+
Sbjct  143  VKYNLSSIKLSSPFALSALNSSYPPSAGAFKPDLIEPVIKPFLEFLTQTSSYLMINAYPF  202

Query  660  F  662
            F
Sbjct  203  F  203



>gb|EEC76519.1| hypothetical protein OsI_14305 [Oryza sativa Indica Group]
Length=474

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 121/192 (63%), Gaps = 6/192 (3%)
 Frame = +3

Query  105  GADISAT---VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQV  275
            GA  S T   +G+ YG+LG++LP P R+ EL     A  V+ YD+N   L     S +  
Sbjct  17   GAAASETAHFLGVNYGRLGDDLPPPHRALELARSAGAAAVRFYDSNATFLSPAAASGLVF  76

Query  276  SVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVP  452
               VPNE+IP++++ +  AD WV   ++PF    ++RYL VGNE+LS+P   + WFQLV 
Sbjct  77   VPGVPNELIPSLAASRRAADEWVAATLLPFRRNRRLRYLFVGNEVLSDPTTKSRWFQLVS  136

Query  453  AMRKIRRSVKKFGLRKIKVGTPLAMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRT  626
            AM  + R++++ G+R++KV T L MD L+    +PPS+G FR D+  +V +PLL FL+RT
Sbjct  137  AMANLERALRRHGMRRVKVSTTLGMDALDGQNVFPPSAGVFRPDIADAVVRPLLAFLERT  196

Query  627  NSFFFFDVYPYF  662
            +S+ F D Y YF
Sbjct  197  DSYLFVDAYTYF  208



>gb|AFU52656.1| beta-1,3-glucanase 23 [Solanum tuberosum]
Length=473

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 123/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLPTPS   +L+      RVK+YD +  +L AL  S++ V+V +PNE
Sbjct  22   SGSIGINYGRIANNLPTPSEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +S Q+  D WV++N++ +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  82   QLSDAASKQSFTDSWVQSNILRYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYAS  140

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+   IKV +P+A+  L+ SYP SSG+F++DL   V KP+L FL ++ SF   ++Y
Sbjct  141  LVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNIY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>ref|XP_006661404.1| PREDICTED: LOW QUALITY PROTEIN: probable glucan endo-1,3-beta-glucosidase 
A6-like [Oryza brachyantha]
Length=521

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 127/188 (68%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            G   +  VG+ YG++ +++P P RS EL+  + A  VKIYD N  +LRAL  + ++VS+M
Sbjct  75   GRSAAHGVGVNYGRVADDIPPPRRSVELLRAVGAGSVKIYDGNSSVLRALAGTGMRVSIM  134

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQLVPAM  458
            VPNEIIP +++  A ADRWV  N+VP+Y ET+++YLLVGNE+LS+    N+TW ++VPAM
Sbjct  135  VPNEIIPGLAASAAAADRWVAENLVPYYPETRVKYLLVGNELLSDYSIANSTWPRIVPAM  194

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
              +  S+++  +  +K+ T LAMD L +   P   +      G+V +PLL+FL+ TNS++
Sbjct  195  ENLHASLRRRRISSVKISTTLAMDALSSGSFPRPPSAAGVXAGAVVRPLLRFLNGTNSYY  254

Query  639  FFDVYPYF  662
            F D YPYF
Sbjct  255  FVDAYPYF  262



>ref|XP_004251911.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
lycopersicum]
Length=480

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 123/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLPTPS   +L+      RVK+YD +  +L AL  S++ VSV +PNE
Sbjct  22   SGSIGINYGRIANNLPTPSEVVQLLKSQGIHRVKLYDTDSAVLTALSGSNISVSVALPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +S Q+  D WV++N+V +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  82   QLSDAASKQSFTDSWVQSNIVRYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYAS  140

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+   IKV +P+A+  L+ SYP S+G+F+++L   V KP+L FL ++ SF   ++Y
Sbjct  141  LVKYGVASSIKVSSPVALSALQNSYPSSAGSFKTELIEPVIKPMLSFLKQSGSFLAVNIY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>ref|XP_006344865.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=480

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLPTP    +L+      RVK+YD +  +L AL  S++ V+V +PNE
Sbjct  22   SGSIGINYGRVANNLPTPEEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +S Q+  D WV++N++ +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  82   QLSDAASKQSFTDSWVQSNIIRYYPKTNIESIAVGNEVFVDPNNTTKF-LVPAMKNVYAS  140

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+   IKV +P+A+  L+ SYP SSG+F++DL   V KP+L FL ++ SF   ++Y
Sbjct  141  LVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNIY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>ref|XP_008643986.1| PREDICTED: uncharacterized protein LOC100382447 isoform X1 [Zea 
mays]
 tpg|DAA48156.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=482

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 128/188 (68%), Gaps = 2/188 (1%)
 Frame = +3

Query  105  GADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVM  284
            GA     +GI YG + ++LP+ SRS +L+    A  VKIYDAN  ILRAL  + V VS+M
Sbjct  40   GAKGCRGLGINYGTVADDLPSASRSVQLLRAAGASAVKIYDANADILRALAGTGVPVSIM  99

Query  285  VPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP--PNTTWFQLVPAM  458
            VPN  IP+++S +A A+ WV  N+ P    T++ +LLVGNE+LSN     +TW  +VPAM
Sbjct  100  VPNSAIPSLASSRAAAEAWVAANLAPHIPATRVAHLLVGNEVLSNRAIAASTWRGVVPAM  159

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
              +RR+++  GLR +K+GT LAMD L ASYPPS+GAFR D+   V  PLL+FL+ T S++
Sbjct  160  ANLRRALRARGLRGVKLGTTLAMDALSASYPPSAGAFRGDIAEDVVLPLLRFLNATRSYY  219

Query  639  FFDVYPYF  662
            F D YPYF
Sbjct  220  FVDAYPYF  227



>gb|EYU33669.1| hypothetical protein MIMGU_mgv1a005896mg [Erythranthe guttata]
Length=466

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = +3

Query  114  ISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPN  293
            +S TVG+ YG+L +NLP P +  +L+      RVKI+D +  +L ALG S + V+V +PN
Sbjct  26   LSGTVGVNYGRLADNLPPPQQVVQLLQSQGIARVKIFDTDAAVLSALGGSGISVTVAMPN  85

Query  294  EIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRR  473
            E + + ++DQ+  D WV++N++P++  T +  + VGNE+ ++P NT +  LVPAM+ +  
Sbjct  86   EQLSSAAADQSFTDTWVQSNILPYHPNTIVDAIAVGNEVFADPANTAF--LVPAMKNVYA  143

Query  474  SVKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDV  650
            S+ K+ +   IKV +P+AM  L++SYPPSSG+F  DL   V KP+L+FL +T SFF  +V
Sbjct  144  SLVKYDVASTIKVSSPVAMGALQSSYPPSSGSFEPDLVEPVMKPMLEFLQQTGSFFMANV  203

Query  651  YPYF  662
            YP+F
Sbjct  204  YPFF  207



>ref|XP_003519593.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=471

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 121/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + +VGI YG++ N+LPTP++  EL+      RVK+YD +  +L A  NS ++V V +PNE
Sbjct  28   AGSVGINYGRVANDLPTPAKVVELLKAQGLNRVKLYDTDATVLTAFANSGIKVVVAMPNE  87

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ N ++DQ+  D WV+ N+  +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  88   LLANAAADQSFTDAWVQANISTYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHAS  146

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L K IK+ +P+A+  L+ S+P SSG+F+++L   V KP+L  L +T S+   + Y
Sbjct  147  LTKYNLDKNIKISSPIALSALQNSFPASSGSFKTELVEPVIKPMLDLLRQTGSYLMVNAY  206

Query  654  PYF  662
            P+F
Sbjct  207  PFF  209



>ref|XP_001759996.1| predicted protein [Physcomitrella patens]
 gb|EDQ75121.1| predicted protein, partial [Physcomitrella patens]
Length=341

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 118/183 (64%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S T+GI YG LG+NLPTPS +   I  +K  RVKI++ N  IL AL NS ++  V +PN+
Sbjct  4    SRTIGINYGTLGDNLPTPSAAVAAIKSMKIGRVKIFNPNAGILAALANSGLEAVVAIPND  63

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             I  I ++ A+A+ W+  NV  +Y  T I  +LVGNE+ S+  +  W QLVPAM+ +  S
Sbjct  64   QIGGIGTNAAMAEAWIAQNVGAYYPATNIVTILVGNEVFSD-GSLPWTQLVPAMQNLHNS  122

Query  477  VKKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            +   G   KIKV T +A D+L +SYPPS+G+FR D+   V  PLL+FL  T S+FF ++Y
Sbjct  123  LSARGWSDKIKVSTAVAADVLSSSYPPSTGSFRPDIAVPVILPLLKFLSTTRSYFFVNLY  182

Query  654  PYF  662
            P+ 
Sbjct  183  PFL  185



>ref|XP_002971087.1| hypothetical protein SELMODRAFT_95153, partial [Selaginella moellendorffii]
 gb|EFJ27685.1| hypothetical protein SELMODRAFT_95153, partial [Selaginella moellendorffii]
Length=319

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 113/180 (63%), Gaps = 3/180 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YGQLGNNLPTP R  EL+      +VKIYD N  I+ A  N+ ++ +VMV NE I 
Sbjct  2    IGINYGQLGNNLPTPQRVRELVQSTTITKVKIYDTNAAIIEAFANTGIEFTVMVKNEQIH  61

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
            ++    A A +WV  NV  +   T+IR +LVGNEIL N      + +VP M+ I  ++  
Sbjct  62   SLLDTHA-AQKWVNENVACYLPATQIRTILVGNEILGNDDQINGW-IVPVMQNIHSALVT  119

Query  486  FGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
              +  ++KV TP ++ +L +SYPPSSGAFR+DL   V KP+LQFL +T S F  + YPYF
Sbjct  120  LRIDNQVKVSTPHSLSVLSSSYPPSSGAFRTDLVSHVIKPMLQFLSQTGSPFMVNTYPYF  179



>gb|ADU15553.1| GLU [Gossypium hirsutum]
Length=469

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S +VGI YG++ NNLP+P +  EL+      +VK+YD +  +L AL +S + V V +PNE
Sbjct  24   SGSVGINYGRVANNLPSPEKVVELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNE  83

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+ AD WVE N+  FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S
Sbjct  84   LLSSTAADQSFADNWVEANITKFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHAS  142

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K  L   IK+ +P+A   L+ SYP S+G+F+ +L   V KP+L FL +T S+   + Y
Sbjct  143  LVKSKLDSAIKISSPIAFSALKTSYPSSAGSFKPELIEPVIKPMLDFLKQTGSYLMVNAY  202

Query  654  PYF  662
            P+F
Sbjct  203  PFF  205



>ref|XP_004294409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Fragaria 
vesca subsp. vesca]
Length=464

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 121/180 (67%), Gaps = 2/180 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YG++ NNLP P++  +L+       VK+YD +  +L AL +S++ V V +PNE++ 
Sbjct  28   IGINYGRIANNLPAPTKVVDLLKSQGITNVKLYDTDAAVLTALADSNISVIVCLPNELLS  87

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
            + + DQ+ AD+WV+ N+  +Y +T+I  + VGNE+L +  N T F LVPAM+ I  S+KK
Sbjct  88   SAAKDQSFADKWVQANISHYYPKTQIEAIAVGNEVLDDKNNATDF-LVPAMKNIHASLKK  146

Query  486  FGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            + L   IK+ +P+++  L++SYPPS+G+F+ DL   V KPLL FL +T S+   + YP+F
Sbjct  147  YNLDSSIKLSSPISLTALQSSYPPSAGSFKPDLVQPVIKPLLDFLQQTGSYLMVNAYPFF  206



>ref|XP_006344866.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Solanum 
tuberosum]
Length=518

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++G+ YG++ NNLPTP    +L+      RVK+YD +  +L AL  S++ V+V +PNE
Sbjct  66   SGSIGVNYGRIANNLPTPEEVVQLLKSQGINRVKLYDTDSAVLTALSGSNISVTVALPNE  125

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +S Q+  D WV++N++ +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  126  QLSDAASKQSFTDSWVQSNIIRYYPKTNIESIAVGNEVFVDPKNTTKF-LVPAMKNVYAS  184

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+   IKV +P+A+  L+ SYP SSG+F++DL   V KP+L FL ++ SF   ++Y
Sbjct  185  LVKYGVASSIKVSSPVALSALQNSYPSSSGSFKTDLIEPVIKPMLSFLKQSGSFLAVNIY  244

Query  654  PYF  662
            P+F
Sbjct  245  PFF  247



>gb|KHG04965.1| hypothetical protein F383_30444 [Gossypium arboreum]
 gb|KHG22638.1| hypothetical protein F383_01203 [Gossypium arboreum]
Length=469

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S +VGI YG++ NNLP+P +  EL+      +VK+YD +  +L AL +S + V V +PNE
Sbjct  24   SGSVGINYGRVANNLPSPEKVVELLKSQGINKVKLYDTDATVLTALADSGITVVVALPNE  83

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+ AD WVE N+  FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S
Sbjct  84   LLSSTAADQSFADNWVEANITKFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHAS  142

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K  L   IK+ +P+A   L+ SYP S+G+F+ +L   V KP+L FL +T S+   + Y
Sbjct  143  LVKSKLDSAIKISSPIAFSALKTSYPSSAGSFKPELIEPVIKPMLDFLKQTGSYLMVNAY  202

Query  654  PYF  662
            P+F
Sbjct  203  PFF  205



>ref|XP_004497650.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Cicer arietinum]
 gb|AIR93907.1| glucanase [Cicer arietinum]
Length=468

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + +VGI YG++ NNLPTP++  EL+      RVK+YD +  +L AL NS + V+V +PNE
Sbjct  22   AGSVGINYGRVANNLPTPTKVVELLKSQGINRVKLYDTDATVLTALANSGINVTVAMPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++   ++DQ+  D W++ N++ +Y  T+I  + VGNE+  +P NTT + LVPAM+ +  S
Sbjct  82   LLSAAAADQSFTDTWLQANIIKYYPSTQIEAIAVGNEVFVDPQNTTNY-LVPAMKNVHAS  140

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K  L   IK+ +P+A+  L++SYP SSG+F+ +L   V KP+L+FL +T S+   + Y
Sbjct  141  LVKQNLDNAIKISSPIALSALQSSYPTSSGSFKPELIEPVIKPMLEFLRQTGSYLMVNAY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>ref|XP_007215327.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
 gb|EMJ16526.1| hypothetical protein PRUPE_ppa005206mg [Prunus persica]
Length=472

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 126/183 (69%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            +A+VG+ YG++ +NLP+  R  +L+     +RVK++D++P +LRAL  S+++V+V VPNE
Sbjct  22   AASVGVNYGRIADNLPSAYRVMQLLKSQGLERVKVFDSDPAVLRALAGSNIKVTVDVPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ +++  Q+ A  WV+ NVV ++  T+I  + VGNE+  +  NTT F L+PAM+ I  +
Sbjct  82   LLSSVAKSQSFATNWVQRNVVAYHPNTQIEAIAVGNEVFVDTHNTTKF-LIPAMKNIHTA  140

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            +  F +   IKV +P+A+  L+ SYP S+G+FR +L  +VFKP+L+FL +T S+   + Y
Sbjct  141  LIHFDIHSAIKVSSPIALSALQNSYPASAGSFRPELVETVFKPMLEFLRQTGSYLMVNAY  200

Query  654  PYF  662
            PYF
Sbjct  201  PYF  203



>gb|KEH41871.1| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=494

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + ++GI YG++ +NLPTPS+  EL+      RVK+YD +  +L AL NS ++V+V +PNE
Sbjct  35   AGSIGINYGRIADNLPTPSKVVELLKAQGFNRVKLYDTDATVLTALANSGIKVTVAMPNE  94

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+  D W+++N++  Y  T+I  + VGNE+  +P NTT + LVPAM+ +  S
Sbjct  95   LLSSAAADQSYTDTWIQSNILNHYPATEIEAIAVGNEVFVDPKNTTNY-LVPAMKNVHAS  153

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            ++K  L ++I + +P+A+  L++SYP S+G+F+++L   V KP+L+FL +T S+   + Y
Sbjct  154  LQKQNLDKQILISSPIALSALQSSYPTSTGSFKTELVEPVIKPMLEFLSQTGSYLMVNAY  213

Query  654  PYF  662
            P+F
Sbjct  214  PFF  216



>dbj|BAG16359.1| tapetum-specific protein A6 family protein [Brassica oleracea 
var. italica]
Length=399

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 117/168 (70%), Gaps = 0/168 (0%)
 Frame = +3

Query  159  LPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIPNISSDQALADR  338
            LP+P +S   I  +KA  VK+YDA+P+ L  L  +++ V++ VP   I ++S++Q  A+ 
Sbjct  1    LPSPYQSINFIKLIKAGHVKLYDADPESLTLLSQTNLYVTIAVPTHQITSLSANQTTAED  60

Query  339  WVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTP  518
            WV+TN++P+Y +T+IR++LVGNEILS         +VPAMRKI  S++  G+  IKVGTP
Sbjct  61   WVKTNILPYYPQTQIRFVLVGNEILSVKDRNITGNVVPAMRKIVNSLRAHGIHNIKVGTP  120

Query  519  LAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            LAMD L +++PPS+  FR D+   +  PLL+FL+ TNS+FF ++ PYF
Sbjct  121  LAMDSLRSTFPPSNSTFRGDIALPLMLPLLKFLNGTNSYFFINLQPYF  168



>ref|XP_002961999.1| hypothetical protein SELMODRAFT_76182, partial [Selaginella moellendorffii]
 gb|EFJ37259.1| hypothetical protein SELMODRAFT_76182, partial [Selaginella moellendorffii]
Length=321

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 113/180 (63%), Gaps = 2/180 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +GI YGQLGNNLPTP R  EL+      +VKIYD N  I+ A  N+ ++ +VMV NE I 
Sbjct  1    IGINYGQLGNNLPTPQRVRELVQSTTITKVKIYDTNAAIIEAFANTGIEFTVMVKNEQIH  60

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
            ++    A A +WV  NV  +   T+IR +LVGNEIL+   +     +VP M+ I  ++  
Sbjct  61   SLLDAHA-AQKWVNENVACYLPATQIRTILVGNEILAGNDDQINGWIVPVMQNIHSALVT  119

Query  486  FGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
              +  ++KV TP ++ +L +SYPPSSGAFR+DL   V KP+LQFL +T S F  + YPYF
Sbjct  120  LRIDNQVKVSTPHSLSVLSSSYPPSSGAFRTDLVSHVIKPMLQFLSQTGSPFMVNTYPYF  179



>ref|XP_010433433.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=455

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 118/183 (64%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  +G+ YG++ NNLP+P     L+      R+KIYD +  +L AL NS ++V V +PNE
Sbjct  25   SGMIGVNYGRIANNLPSPKNVVSLLKSQGISRIKIYDTDKNVLAALANSGIKVIVALPNE  84

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + SS+Q+ ADRW++TNV   +  T+I  + VGNE+  +P NTT + L PAM+ I  S
Sbjct  85   LLSSASSNQSFADRWIQTNVASHFPATEIEAIAVGNEVFVDPKNTTPY-LDPAMKNIHTS  143

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K  L K IK+ +P+A+  L  SYPPSSG+F+ DL   V KP+L  L RT+S+   + Y
Sbjct  144  LVKHNLDKAIKISSPVALSALANSYPPSSGSFKPDLIEPVIKPMLDLLQRTSSYLMVNAY  203

Query  654  PYF  662
            P+F
Sbjct  204  PFF  206



>gb|KJB62900.1| hypothetical protein B456_009G442700 [Gossypium raimondii]
Length=469

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 118/183 (64%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S +VGI YG++ NNLP+P +  EL+      +VK+YD    +L AL +S + V V +PNE
Sbjct  24   SGSVGINYGRVANNLPSPEKVVELLKSQGINKVKLYDTGATVLTALADSGITVVVALPNE  83

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+ AD WVE N+  FY +TKI  + VGNE+  +P NTT + LVPAM+ I  S
Sbjct  84   LLSSTAADQSFADNWVEANITKFYPKTKIEAIAVGNEVFVDPANTTKY-LVPAMKNIHAS  142

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K  L   IK+ +P+A   L+ SYP S+G+F+ +L   V KP+L FL +T S+   + Y
Sbjct  143  LVKSKLDSAIKISSPIAFSALKTSYPSSAGSFKPELIEPVIKPMLDFLKQTGSYLMVNAY  202

Query  654  PYF  662
            P+F
Sbjct  203  PFF  205



>ref|XP_010545233.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Tarenaya hassleriana]
Length=461

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 121/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  VGI YG++ +NLPTP +  EL+      RVK+YD++  +L AL NS ++V V +PNE
Sbjct  22   SGMVGINYGRIADNLPTPDKVVELLKKQGIDRVKLYDSDKSVLTALANSGIKVVVALPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + ++DQ+ +D WVE N+  +Y  T+I  + VGNE+  +P NTT + LV AM+ +  S
Sbjct  82   LLSSAAADQSFSDNWVEANITEYYPATQIEAIAVGNEVFVDPNNTTEY-LVQAMKNVHSS  140

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L R IK+ +P+A+  L +SYPPS+G+F+ +L   V KP+L    +T+S+   + Y
Sbjct  141  LMKYNLDRSIKISSPIALSSLASSYPPSAGSFKPELVEPVIKPMLDLFRQTSSYLMVNAY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>gb|KDP30806.1| hypothetical protein JCGZ_13749 [Jatropha curcas]
Length=469

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 125/183 (68%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + ++G+ YG++ NNLP+  +  +L+     +RVK++DA+P +L+AL  S ++V+V +PNE
Sbjct  21   AGSIGVNYGRIANNLPSAVKVVQLLKSQGLQRVKVFDADPAVLKALSGSSIKVTVDLPNE  80

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + +  Q+ A  WV+ N+  +Y  T+I  + VGNE+  +P NTT F L+PAM+ I ++
Sbjct  81   LLYSAAKRQSFALSWVQRNIAAYYPSTQIEAIAVGNEVFVDPHNTTKF-LIPAMKNIHQA  139

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            ++K  L   IK+ +P+A+  L++SYP S+GAFRS+L   VFKPLL FL +T S+   + Y
Sbjct  140  LEKLNLHSDIKISSPIALSALQSSYPSSAGAFRSELIEPVFKPLLDFLRQTGSYLMVNAY  199

Query  654  PYF  662
            P+F
Sbjct  200  PFF  202



>ref|XP_002529472.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF32938.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=472

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 125/185 (68%), Gaps = 1/185 (1%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            AD S TVGI YG++ NNLP+P +  EL+      RVK+YD +  +L AL NS + V V +
Sbjct  25   ADASGTVGINYGRVANNLPSPEKVVELLKSQGINRVKLYDTDSTVLTALANSGITVVVAL  84

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKI  467
            PNE++ + ++DQ+ AD WV+ N+  ++ +T+I  + VGNE+  +P NTT + LVPAM+ +
Sbjct  85   PNELLASTAADQSFADNWVQANISQYHPKTQIEAIAVGNEVFVDPQNTTKY-LVPAMKNV  143

Query  468  RRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
              S+ KF L  IK+ +P+A+  L++SYP S+G+F+ DL   V KP+L+FL +T S+   +
Sbjct  144  YNSLVKFNLSSIKISSPIALSSLQSSYPSSAGSFKPDLIEPVMKPMLEFLRKTGSYLMVN  203

Query  648  VYPYF  662
             YP+F
Sbjct  204  AYPFF  208



>dbj|BAC53928.1| beta-1,3-glucanase-like protein [Nicotiana tabacum]
Length=358

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLP P++  +L+      RVK+YD +  +L AL  S++ V+V +PNE
Sbjct  21   SGSIGINYGRIANNLPPPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVALPNE  80

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +  Q+  D WV++N++ +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  81   QLADAAGKQSFTDSWVQSNILTYYPKTQIESIAVGNEVFVDPKNTTKF-LVPAMKNMYAS  139

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+ + IKV +P+A+  L  SYP S+G+F+ DL   V KP+L FL +T S+   ++Y
Sbjct  140  LVKYGVAQSIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVNIY  199

Query  654  PYF  662
            P+F
Sbjct  200  PFF  202



>ref|XP_003544773.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Glycine 
max]
Length=461

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + ++GI YG++ N+LPTP++  EL+      RVK+YD +  +L A  NS ++V V +PNE
Sbjct  22   AGSIGINYGRIANDLPTPAKVVELLKSQGLNRVKLYDTDATVLTAFANSGMKVVVAMPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ N +++Q+  D WV+ N+  +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  82   LLANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHAS  140

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L K IK+ +P+A+  L+ S+P SSG+F+++L   V KP+L FL +T S+   + Y
Sbjct  141  LVKYSLDKNIKISSPIALSALQNSFPASSGSFKTELLEPVIKPMLDFLRQTGSYLMVNAY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>gb|KHN23902.1| Glucan endo-1,3-beta-glucosidase 12 [Glycine soja]
Length=458

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + ++GI YG++ N+LPTP++  EL+      RVK+YD +  +L A  NS ++V V +PNE
Sbjct  22   AGSIGINYGRIANDLPTPAKVVELLKSQGLNRVKLYDTDATVLTAFANSGMKVVVAMPNE  81

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ N +++Q+  D WV+ N+  +Y  T+I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  82   LLANAAAEQSFTDAWVQANISSYYPATQIEAIAVGNEVFVDPNNTTKF-LVPAMKNVHAS  140

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L K IK+ +P+A+  L+ S+P SSG+F+++L   V KP+L FL +T S+   + Y
Sbjct  141  LVKYSLDKNIKISSPIALSALQNSFPASSGSFKTELLEPVIKPMLDFLRQTGSYLMVNAY  200

Query  654  PYF  662
            P+F
Sbjct  201  PFF  203



>ref|XP_002463526.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
 gb|EER90524.1| hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Length=483

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 3/182 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG LG+NLP P R  EL     A  V+ YDAN  +L A   S ++    VPNE+IP
Sbjct  38   LGVNYGTLGDNLPLPQRGLELARSAGASAVRFYDANATMLAAAAASGLEFVPSVPNELIP  97

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNP-PNTTWFQLVPAMRKIRRSVK  482
            ++++ Q  AD WV T ++PF G  ++RYL VGNE+LS+P   + W +LVPAM  + R++ 
Sbjct  98   SLAASQRAADAWVATTLLPFRGNPRLRYLFVGNEVLSDPTARSRWPRLVPAMANVHRALH  157

Query  483  KFGLRKIKVGTPLAMDMLEAS--YPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            + GL  +KV T  +M  LE    +PPS+GAFR D+ G+V +PLL FLDRT S  F D Y 
Sbjct  158  RHGLGSVKVSTTFSMHELEGQNVFPPSAGAFRPDIAGAVVRPLLAFLDRTGSPLFVDAYT  217

Query  657  YF  662
            YF
Sbjct  218  YF  219



>ref|XP_010448205.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like [Camelina 
sativa]
Length=457

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 119/183 (65%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S  +G+ YG++ NNLP+P     L+      R+KIYD + K+L AL N+ ++V V +PNE
Sbjct  25   SGMIGVNYGRIANNLPSPKNVVSLLKSQGINRIKIYDTDKKVLTALANTGIKVIVALPNE  84

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + SS+Q+ AD W++TNV   +  T+I  + VGNE+  +P NTT + LVPAM+ I  S
Sbjct  85   LLSSASSNQSFADHWIQTNVASHFPATEIEAIAVGNEVFVDPKNTTPY-LVPAMKNIHTS  143

Query  477  VKKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K  L K IK+ +P+A+  L  SYPPSSG+F+ +L   V KP+L  L RT+S+   + Y
Sbjct  144  LVKRNLDKAIKISSPVALSALANSYPPSSGSFKPELIEPVIKPMLDLLQRTSSYLMVNAY  203

Query  654  PYF  662
            P+F
Sbjct  204  PFF  206



>ref|XP_008226995.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Prunus mume]
Length=472

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 122/185 (66%), Gaps = 2/185 (1%)
 Frame = +3

Query  111  DISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVP  290
            + + T+GI YG++ NNLPTP +   L+      +VK+YD +  +L AL NS + V V +P
Sbjct  29   NTTGTIGINYGRIANNLPTPEKVVALLKSQGINKVKLYDTDAAVLTALANSGINVVVALP  88

Query  291  NEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIR  470
            NE++ + ++D + AD+WV+ N+  ++ +T+I  + VGNE+ ++P NTT F LVPA+  ++
Sbjct  89   NELLSSAANDPSFADKWVQANISQYHPQTQIEAIAVGNEVFADPNNTTKF-LVPAINNLQ  147

Query  471  RSVKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFD  647
             ++ K  L   IK+ +P+A+  L+ SYPPSSG+F+ DL     KPLL FL +T+S+   +
Sbjct  148  SALVKHNLSSSIKLSSPIALSALQNSYPPSSGSFKPDLIEPAIKPLLDFLSKTSSYLMIN  207

Query  648  VYPYF  662
             YP+F
Sbjct  208  AYPFF  212



>emb|CBI39414.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +3

Query  249  ALGNSDVQVSVMVPNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILS---N  419
            A   + +QVS+MVPN+ I NISS+Q LAD+WV  NV+ +Y +T IR+++VGNE+LS   +
Sbjct  25   AFTRTKIQVSIMVPNQEISNISSNQTLADQWVRDNVLSYYPQTMIRFIVVGNEVLSYYSD  84

Query  420  PPNTTWFQLVPAMRKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFK  599
                TW  LVPAMR+I++S++   +  IKVGT +AMD++E+S+PPSSG FRSD+  +V  
Sbjct  85   RDRETWSNLVPAMRRIKKSLQANNIPNIKVGTSVAMDVMESSFPPSSGMFRSDILDTVMV  144

Query  600  PLLQFLDRTNSFFFFDVYPYF  662
            PLL+FL  TNSFFF DVYPY 
Sbjct  145  PLLEFLSGTNSFFFLDVYPYL  165



>ref|XP_009771279.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12-like, partial 
[Nicotiana sylvestris]
Length=455

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 121/182 (66%), Gaps = 2/182 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
             ++G+ YG++ NNLP+  ++  L+     +RVK+YD +P +L+AL  S + V+V +PNE+
Sbjct  8    GSIGVNYGRVANNLPSAVKAVALLKFQGVERVKVYDTDPAVLKALSGSGIMVTVNLPNEL  67

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            + N +  Q+ A  WV+ NVV +Y  T+I  + VGNE+  +P NTT F LVPAM+ I  ++
Sbjct  68   LYNAAKRQSFAYSWVQRNVVAYYPSTQIESIAVGNEVFVDPHNTTRF-LVPAMKNIHEAL  126

Query  480  KKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
             K+ +  KIKV +P+A+  L+ SYP S+G+FRS+L   V KP+L FL +T SF   + YP
Sbjct  127  LKYNIHDKIKVSSPVALSALQNSYPSSAGSFRSELVEPVIKPMLDFLRQTGSFLMVNCYP  186

Query  657  YF  662
            +F
Sbjct  187  FF  188



>ref|XP_002274828.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Vitis vinifera]
Length=471

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 125/183 (68%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            + ++G+ YG++ NNLP+  +  +L+     +RVK++D +P +L+ALG S ++V+V +PNE
Sbjct  21   AGSIGVNYGRIANNLPSAVKVVQLLKSQGIERVKVFDTDPAVLKALGESGIKVTVDLPNE  80

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
            ++ + +  Q+ A+ WV+ NV  ++  TKI  + VGNE+  +P NTT   LVPA++ I ++
Sbjct  81   LLISAAKRQSFANTWVQKNVADYFPATKIEAIAVGNEVFVDPHNTT-LSLVPALKNIHKA  139

Query  477  VKKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+ L   IKV +P+A+  L++SYP S+G+FR +L   VFKP+L+FL +T S+   + Y
Sbjct  140  LVKYNLHSHIKVSSPVALSALQSSYPSSAGSFRQELIEPVFKPMLEFLRQTGSYLMVNAY  199

Query  654  PYF  662
            P+F
Sbjct  200  PFF  202



>ref|XP_006283767.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
 gb|EOA16665.1| hypothetical protein CARUB_v10004853mg [Capsella rubella]
Length=432

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 118/180 (66%), Gaps = 2/180 (1%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG++ NNLP+P     L+      R+KIYD +  +L AL NS ++V V +PNE++ 
Sbjct  2    IGVNYGRIANNLPSPKNVVNLVKSQGISRIKIYDTDKNVLTALANSGIKVIVALPNELLF  61

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSVKK  485
            + +S+Q+ AD WV+TNV  ++  T+I  + VGNE+  +P NTT + LVPAM+ I  S+ K
Sbjct  62   SAASNQSFADYWVQTNVTSYFPATEIEAIAVGNEVFVDPKNTTPY-LVPAMKNIHTSLVK  120

Query  486  FGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYPYF  662
            + L K IK+ +P+A+  L  SYPPSSG+F+ DL   V +P+L  L  T+S+   + YP+F
Sbjct  121  YNLDKAIKISSPVALSALANSYPPSSGSFKPDLIEPVIRPMLDLLQHTSSYLMVNAYPFF  180



>gb|KJB37880.1| hypothetical protein B456_006G224700 [Gossypium raimondii]
Length=462

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = +3

Query  108  ADISATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMV  287
            A++S  +G+ YG+ G+NLP+P  S +++  +K  ++K+ D+NP+IL  L  + + V+V V
Sbjct  17   AEMSGKIGVNYGREGDNLPSPYESIQIMKSIKVGQIKLNDSNPEILTLLSGTKIHVAVTV  76

Query  288  PNEIIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSN--PPNTTWFQ-LVPAM  458
            PN+ I  I S+ ++A++WV  N++P Y +T IR++LVG+ ++++    N T  Q LVPAM
Sbjct  77   PNDDIIQIGSNDSMAEQWVRNNILPHYPDTMIRFVLVGDRVVNSNMDVNGTMEQSLVPAM  136

Query  459  RKIRRSVKKFGLRKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFF  638
            R I+ ++   G++ +KV T L MD+++  +PPS+  F+SD++ SV   LL+F++ T S  
Sbjct  137  RGIKSALTAHGVKNVKVSTTLGMDVVQTRFPPSNSTFQSDISDSVMPKLLKFVNGTKSVV  196

Query  639  FFDVYPYF  662
            F DVYPYF
Sbjct  197  FVDVYPYF  204



>ref|XP_009794437.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
sylvestris]
Length=475

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLP P++  +L+      RVK+YD +  +L AL  S++ V+V +PNE
Sbjct  21   SGSIGINYGRIANNLPPPAQVVQLLKTQGVNRVKLYDTDSNVLTALSGSNISVTVALPNE  80

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +  Q+  D WV++N++ +Y +T+I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  81   QLADAAGKQSFTDSWVQSNILTYYPKTQIESIAVGNEVFVDPKNTTKF-LVPAMKNMYAS  139

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+ + IKV +P+A+  L  SYP S+G+F+ DL   V KP+L FL +T S+   ++Y
Sbjct  140  LVKYGVAQSIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVNIY  199

Query  654  PYF  662
            P+F
Sbjct  200  PFF  202



>ref|XP_009628415.1| PREDICTED: glucan endo-1,3-beta-glucosidase 12 [Nicotiana tomentosiformis]
Length=471

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 120/182 (66%), Gaps = 2/182 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
             ++G+ YG++ NNLP+  ++  L+     +RVK+YD +P +L+AL  S ++V+V +PNE+
Sbjct  24   GSIGVNYGRVANNLPSAVKAVALLKSQGVERVKVYDTDPAVLKALSGSGIKVTVNLPNEL  83

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            + N +  Q+ A  WV+ NV  +Y  T+I  + VGNE+  +P NTT F LVPAM+ I  ++
Sbjct  84   LYNAAKRQSFAYSWVQRNVAAYYPSTQIESIAVGNEVFVDPHNTTRF-LVPAMKNIHEAL  142

Query  480  KKFGLR-KIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
             K+    KIKV +P+A+  L+ SYP S+G+FRS+L   V KP++ FL +T S+   + YP
Sbjct  143  LKYNFHDKIKVSSPVALSALQNSYPSSAGSFRSELIEPVIKPMMDFLRQTGSYLMVNCYP  202

Query  657  YF  662
            +F
Sbjct  203  FF  204



>ref|XP_003581305.1| PREDICTED: probable glucan endo-1,3-beta-glucosidase A6 [Brachypodium 
distachyon]
Length=473

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 115/182 (63%), Gaps = 3/182 (2%)
 Frame = +3

Query  126  VGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEIIP  305
            +G+ YG LG++LP P  + EL     A  V+ YD+N  +L A  +S +     VPNE+IP
Sbjct  31   LGVSYGTLGDDLPPPHVALELARSAGAAAVRFYDSNATLLAAASSSGLGFVPGVPNELIP  90

Query  306  NISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTT-WFQLVPAMRKIRRSVK  482
            ++S+ +  AD WV + ++PF    ++RYL VGNE+LS+P   + W QLVPAM  + R+++
Sbjct  91   SLSASRRAADAWVASTLLPFRRNPRLRYLFVGNEVLSDPTTKSRWSQLVPAMANLHRALR  150

Query  483  KFGLRKIKVGTPLAMDML--EASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            + GL ++KV T L MD L  +  +PPS+G FR D+     +PLL FL+RT S+ F D Y 
Sbjct  151  RHGLGRVKVSTTLGMDALVGQNVFPPSAGVFRPDIVDVAVRPLLAFLERTESYLFVDTYT  210

Query  657  YF  662
            YF
Sbjct  211  YF  212



>dbj|BAB17320.1| elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum]
Length=467

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 121/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLP+P++  +L+      R+K+YD +  +L AL  S++ V+V +PNE
Sbjct  21   SGSIGINYGRIANNLPSPAQVVQLLKTQGVNRIKLYDTDSNVLTALSGSNISVTVALPNE  80

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +  Q+  D WV++N++ +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  81   QLSDAAEKQSFTDSWVQSNILTYYPKTLIESIAVGNEVFVDPKNTTKF-LVPAMKNVYAS  139

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+   IKV +P+A+  L  SYP S+G+F+ DL   V KP+L FL +T S+   ++Y
Sbjct  140  LVKYGVAESIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVNIY  199

Query  654  PYF  662
            P+F
Sbjct  200  PFF  202



>ref|XP_009595038.1| PREDICTED: glucan endo-1,3-beta-glucosidase 13-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 121/183 (66%), Gaps = 2/183 (1%)
 Frame = +3

Query  117  SATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNE  296
            S ++GI YG++ NNLP+P++  +L+      R+K+YD +  +L AL  S++ V+V +PNE
Sbjct  21   SGSIGINYGRIANNLPSPAQVVQLLKTQGVNRIKLYDTDSNVLTALSGSNISVTVALPNE  80

Query  297  IIPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRS  476
             + + +  Q+  D WV++N++ +Y +T I  + VGNE+  +P NTT F LVPAM+ +  S
Sbjct  81   QLSDAAEKQSFTDSWVQSNILTYYPKTLIESIAVGNEVFVDPKNTTKF-LVPAMKNVYAS  139

Query  477  VKKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVY  653
            + K+G+   IKV +P+A+  L  SYP S+G+F+ DL   V KP+L FL +T S+   ++Y
Sbjct  140  LVKYGVAESIKVSSPVALSALGNSYPSSAGSFKPDLVEPVIKPMLSFLKQTGSYLMVNIY  199

Query  654  PYF  662
            P+F
Sbjct  200  PFF  202



>ref|XP_007204831.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
 gb|EMJ06030.1| hypothetical protein PRUPE_ppa1027206mg [Prunus persica]
Length=497

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 123/182 (68%), Gaps = 3/182 (2%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
            +T+GICYG+  ++LPTP ++A+L+     K V+IYD+N ++L+A GN+ V++ + VPN  
Sbjct  24   STIGICYGRNADDLPTPDKAAQLVQLHNIKYVRIYDSNIQVLKAFGNTGVELMIGVPNSD  83

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            +  IS  Q+ AD W++ +++P+Y  TKI Y+ VG E+  +P N +  Q+VPAMR +  ++
Sbjct  84   LLAISQYQSNADTWLKNSILPYYPATKITYITVGAEVTESPSNFS-AQVVPAMRNVLTAL  142

Query  480  KKFGL-RKIKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
            KK GL +KIKV T  ++ +L  S+PPS+GAF S    S  KPLL+FL    S F  D+YP
Sbjct  143  KKVGLSKKIKVSTTHSLGVLSRSFPPSAGAFNSS-HASFLKPLLEFLAENQSPFMVDIYP  201

Query  657  YF  662
            Y+
Sbjct  202  YY  203



>ref|XP_007049174.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX93331.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=601

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 117/182 (64%), Gaps = 2/182 (1%)
 Frame = +3

Query  120  ATVGICYGQLGNNLPTPSRSAELIHGLKAKRVKIYDANPKILRALGNSDVQVSVMVPNEI  299
             +VG+ YG++ NNLP+ ++  EL+      RVK+YD +P +L AL  S ++V+V +PNE 
Sbjct  158  GSVGVNYGRIANNLPSATKVVELLKSHGLNRVKVYDTDPAVLHALSGSGIKVTVDLPNEQ  217

Query  300  IPNISSDQALADRWVETNVVPFYGETKIRYLLVGNEILSNPPNTTWFQLVPAMRKIRRSV  479
            +   +   + A+ WVE NV  +Y  T+I  + VGNE+  +P NTT F LVPAM+ I  ++
Sbjct  218  LFAAAKSTSFANSWVERNVAAYYPHTEIEAIAVGNEVFVDPHNTTKF-LVPAMKNIHEAL  276

Query  480  KKFGLRK-IKVGTPLAMDMLEASYPPSSGAFRSDLTGSVFKPLLQFLDRTNSFFFFDVYP  656
             KF L   IKV +P+A+  L+ SYP S+G+FR +L   VFKP+L FL +T SF   + YP
Sbjct  277  VKFNLHSDIKVSSPIALSALQNSYPSSAGSFRPELIEPVFKPMLDFLRQTGSFLMVNAYP  336

Query  657  YF  662
            +F
Sbjct  337  FF  338



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320