BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033J17

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770473.1|  PREDICTED: WD repeat-containing protein 44-like    131   1e-31   Nicotiana sylvestris
ref|XP_009625118.1|  PREDICTED: WD repeat-containing protein 44-like    130   4e-31   Nicotiana tomentosiformis
ref|XP_009622362.1|  PREDICTED: WD repeat-containing protein 44-like    125   2e-30   Nicotiana tomentosiformis
ref|XP_004244644.1|  PREDICTED: uncharacterized WD repeat-contain...    120   9e-28   Solanum lycopersicum
ref|XP_004244645.1|  PREDICTED: uncharacterized WD repeat-contain...    120   1e-27   Solanum lycopersicum
ref|XP_011101012.1|  PREDICTED: protein tipD-like                       119   2e-27   Sesamum indicum [beniseed]
ref|XP_006352232.1|  PREDICTED: uncharacterized protein LOC102579...    119   2e-27   Solanum tuberosum [potatoes]
ref|XP_009764325.1|  PREDICTED: WD repeat-containing protein 44-like    116   3e-26   Nicotiana sylvestris
ref|XP_006343802.1|  PREDICTED: WD repeat-containing protein 44-like    111   2e-24   Solanum tuberosum [potatoes]
ref|XP_004245475.1|  PREDICTED: uncharacterized protein LOC101244103    110   2e-24   Solanum lycopersicum
ref|XP_010252806.1|  PREDICTED: WD repeat-containing protein 44         104   5e-22   Nelumbo nucifera [Indian lotus]
gb|KHG15203.1|  wdr44                                                 90.1    4e-17   Gossypium arboreum [tree cotton]
gb|KHG15202.1|  wdr44                                                 89.7    5e-17   Gossypium arboreum [tree cotton]
ref|XP_010267520.1|  PREDICTED: 2-deoxy-glucose resistant protein 2   88.6    1e-16   Nelumbo nucifera [Indian lotus]
ref|XP_010659824.1|  PREDICTED: uncharacterized protein LOC100249640  88.6    1e-16   Vitis vinifera
ref|XP_007210339.1|  hypothetical protein PRUPE_ppa001944mg           87.8    2e-16   Prunus persica
gb|KJB09622.1|  hypothetical protein B456_001G153400                  87.8    2e-16   Gossypium raimondii
gb|KJB09623.1|  hypothetical protein B456_001G153400                  87.8    2e-16   Gossypium raimondii
ref|XP_007051501.1|  Transducin/WD40 repeat superfamily protein i...  87.4    3e-16   
ref|XP_007051502.1|  Transducin/WD40 repeat superfamily protein i...  87.4    3e-16   
ref|XP_011026824.1|  PREDICTED: uncharacterized protein LOC105127282  87.4    3e-16   Populus euphratica
ref|XP_002264456.1|  PREDICTED: WD repeat-containing protein YMR1...  87.4    3e-16   
gb|KHG23616.1|  WD repeat-containing 44                               87.0    4e-16   Gossypium arboreum [tree cotton]
ref|XP_008239197.1|  PREDICTED: uncharacterized protein LOC103337808  86.7    5e-16   
ref|XP_002297958.2|  hypothetical protein POPTR_0001s11110g           85.1    2e-15   
ref|XP_006368793.1|  hypothetical protein POPTR_0001s11110g           85.1    2e-15   
emb|CDP12205.1|  unnamed protein product                              83.2    6e-15   Coffea canephora [robusta coffee]
ref|XP_002304571.2|  hypothetical protein POPTR_0003s14440g           82.4    1e-14   
ref|XP_011022443.1|  PREDICTED: WD repeat-containing protein 44-like  81.6    2e-14   Populus euphratica
gb|KJB41586.1|  hypothetical protein B456_007G110600                  81.3    3e-14   Gossypium raimondii
ref|XP_009344051.1|  PREDICTED: uncharacterized WD repeat-contain...  81.6    3e-14   
gb|KJB41582.1|  hypothetical protein B456_007G110600                  81.3    3e-14   Gossypium raimondii
gb|KJB41583.1|  hypothetical protein B456_007G110600                  81.3    3e-14   Gossypium raimondii
ref|XP_009359575.1|  PREDICTED: uncharacterized WD repeat-contain...  80.9    5e-14   
ref|XP_008390309.1|  PREDICTED: uncharacterized protein LOC103452581  80.5    5e-14   
ref|XP_006584780.1|  PREDICTED: WD repeat-containing protein 44-like  80.5    7e-14   Glycine max [soybeans]
ref|XP_003525326.1|  PREDICTED: WD repeat-containing protein 44-like  76.6    1e-12   Glycine max [soybeans]
ref|XP_009358663.1|  PREDICTED: uncharacterized protein LOC103949...  76.3    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_009358661.1|  PREDICTED: vegetative incompatibility protei...  76.3    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_008388376.1|  PREDICTED: uncharacterized protein LOC103450778  74.7    5e-12   
ref|XP_002518879.1|  WD-repeat protein, putative                      73.2    2e-11   Ricinus communis
ref|XP_006857843.1|  hypothetical protein AMTR_s00069p00055450        72.4    3e-11   Amborella trichopoda
ref|XP_011023150.1|  PREDICTED: F-box-like/WD repeat-containing p...  71.6    5e-11   Populus euphratica
ref|XP_002302646.2|  hypothetical protein POPTR_0002s17470g           71.6    5e-11   
ref|XP_004143851.1|  PREDICTED: uncharacterized protein LOC101204856  71.2    6e-11   Cucumis sativus [cucumbers]
gb|EYU45248.1|  hypothetical protein MIMGU_mgv1a002075mg              70.9    7e-11   Erythranthe guttata [common monkey flower]
gb|EYU45249.1|  hypothetical protein MIMGU_mgv1a002075mg              70.9    9e-11   Erythranthe guttata [common monkey flower]
ref|XP_010694812.1|  PREDICTED: WD repeat-containing protein 44-like  70.9    9e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010100708.1|  WD repeat-containing protein 44                  70.1    2e-10   Morus notabilis
ref|XP_008437430.1|  PREDICTED: uncharacterized protein LOC103482847  69.7    2e-10   Cucumis melo [Oriental melon]
ref|XP_010106343.1|  WD repeat-containing protein 44                  66.2    2e-09   Morus notabilis
emb|CBI34556.3|  unnamed protein product                              66.2    3e-09   Vitis vinifera
ref|XP_007160204.1|  hypothetical protein PHAVU_002G301700g           65.9    4e-09   Phaseolus vulgaris [French bean]
gb|KDP28461.1|  hypothetical protein JCGZ_14232                       65.5    5e-09   Jatropha curcas
ref|XP_004300485.1|  PREDICTED: WD repeat-containing protein 3        65.5    5e-09   Fragaria vesca subsp. vesca
ref|XP_004503569.1|  PREDICTED: uncharacterized protein LOC101510067  64.3    1e-08   Cicer arietinum [garbanzo]
ref|XP_007039450.1|  Transducin/WD40 repeat-like superfamily prot...  61.2    1e-07   
ref|XP_007039448.1|  Transducin/WD40 repeat-like superfamily prot...  61.2    1e-07   
ref|XP_007039449.1|  Transducin/WD40 repeat-like superfamily prot...  61.2    1e-07   
ref|XP_010544856.1|  PREDICTED: uncharacterized protein LOC104817380  61.2    1e-07   Tarenaya hassleriana [spider flower]
gb|KEH21291.1|  transducin/WD40 repeat protein                        60.5    1e-07   Medicago truncatula
gb|KDP25243.1|  hypothetical protein JCGZ_20399                       60.5    2e-07   Jatropha curcas
gb|KEH21290.1|  transducin/WD40 repeat protein                        60.5    2e-07   Medicago truncatula
emb|CAN69136.1|  hypothetical protein VITISV_019124                   58.2    1e-06   Vitis vinifera
ref|XP_002523310.1|  conserved hypothetical protein                   53.9    2e-06   
ref|XP_008790515.1|  PREDICTED: uncharacterized protein LOC103707703  57.0    3e-06   Phoenix dactylifera
ref|XP_009401778.1|  PREDICTED: uncharacterized protein LOC103985...  55.5    8e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053091.1|  PREDICTED: WD repeat-containing protein 44-like  55.5    8e-06   Eucalyptus grandis [rose gum]
ref|XP_009401780.1|  PREDICTED: uncharacterized protein LOC103985...  55.5    9e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO76655.1|  hypothetical protein CISIN_1g004410mg                 54.3    2e-05   Citrus sinensis [apfelsine]
gb|KDO76657.1|  hypothetical protein CISIN_1g004410mg                 54.3    2e-05   Citrus sinensis [apfelsine]
gb|KDO76659.1|  hypothetical protein CISIN_1g004410mg                 53.9    2e-05   Citrus sinensis [apfelsine]
ref|XP_009379832.1|  PREDICTED: 2-deoxy-glucose resistant protein...  53.9    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006476326.1|  PREDICTED: WD repeat-containing protein YMR1...  53.9    3e-05   Citrus sinensis [apfelsine]
gb|KDO76652.1|  hypothetical protein CISIN_1g004410mg                 53.9    3e-05   Citrus sinensis [apfelsine]
ref|XP_011084533.1|  PREDICTED: WD repeat-containing protein 44       53.5    4e-05   Sesamum indicum [beniseed]
ref|XP_009119955.1|  PREDICTED: WD repeat-containing protein 44       52.8    6e-05   Brassica rapa
ref|XP_011075952.1|  PREDICTED: WD repeat-containing protein 44       52.8    7e-05   Sesamum indicum [beniseed]
ref|XP_002271917.2|  PREDICTED: WD repeat-containing protein YMR102C  52.8    7e-05   Vitis vinifera
ref|XP_008234700.1|  PREDICTED: uncharacterized protein LOC103333609  52.8    7e-05   Prunus mume [ume]
ref|XP_007220614.1|  hypothetical protein PRUPE_ppa002072mg           52.4    9e-05   
emb|CDY43837.1|  BnaC03g14700D                                        52.4    9e-05   Brassica napus [oilseed rape]
ref|XP_010109232.1|  WD repeat-containing protein 44                  52.4    1e-04   Morus notabilis
emb|CBI23039.3|  unnamed protein product                              52.4    1e-04   Vitis vinifera
emb|CBI40579.3|  unnamed protein product                              51.2    2e-04   Vitis vinifera
gb|KDP23830.1|  hypothetical protein JCGZ_00073                       50.8    3e-04   Jatropha curcas
ref|XP_011044680.1|  PREDICTED: WD repeat-containing protein 44       50.8    3e-04   Populus euphratica
ref|XP_010933843.1|  PREDICTED: WD repeat-containing protein 44 i...  50.4    4e-04   Elaeis guineensis
ref|XP_010933844.1|  PREDICTED: WD repeat-containing protein 44 i...  50.4    4e-04   Elaeis guineensis
ref|XP_002866029.1|  WD-40 repeat family protein                      50.1    5e-04   
ref|XP_009132448.1|  PREDICTED: WD repeat-containing protein 44-like  50.1    6e-04   Brassica rapa
ref|XP_009397845.1|  PREDICTED: uncharacterized protein LOC103982598  50.1    6e-04   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY43049.1|  BnaA03g11960D                                        49.7    6e-04   Brassica napus [oilseed rape]



>ref|XP_009770473.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
 ref|XP_009770474.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
 ref|XP_009770475.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=719

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 111/185 (60%), Gaps = 32/185 (17%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFY----TSSGSLGYEFWAKNLESVSERRTRLLKWM  320
            MG+  E  ED FFD  DEISSLSD        +  +LGYE W ++ ESV ERR R LKWM
Sbjct  1    MGTYCETEEDSFFDIHDEISSLSDLGSDGSEIAKCALGYEVWTQDPESVDERRNRFLKWM  60

Query  321  GLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQSDE---  491
            GL+   +  N  E+ +   ++ K   D RI D  E +LANSDSE +FFSGRSSQS+E   
Sbjct  61   GLNSNRDRRNGLEMAEIYSNESKTNAD-RIRDVNETVLANSDSEGNFFSGRSSQSNEALE  119

Query  492  --NDSLEE----KIRNLDNGTEFMVDELGQDGTVSR------------------LGSSSL  599
               DS+E+    KIRNLDNG+EF+ DELGQDG +SR                  LGSS+L
Sbjct  120  LEKDSVEDPMCWKIRNLDNGSEFVADELGQDGMLSRLREVGTNRLFTIQEFQRNLGSSAL  179

Query  600  VQRLL  614
            +Q+LL
Sbjct  180  IQQLL  184



>ref|XP_009625118.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
 ref|XP_009625119.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
 ref|XP_009625120.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
Length=725

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 110/197 (56%), Gaps = 50/197 (25%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISS----------------LSDCFYTSSGSLGYEFWAKNLES  284
            MG+  E  ED FFD  DEISS                + DC      +LGYEFW ++ ES
Sbjct  1    MGTYSETEEDTFFDIRDEISSLSDLGSDSSDACTRNEIVDC------ALGYEFWTQDPES  54

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            V ERR R LKWMGL+   +  +  E+N  C D+ K   D RI D  + +LANSDSE +FF
Sbjct  55   VDERRNRFLKWMGLNSNCDRRDGLEMNGVCSDESKKNAD-RIRDGNDTVLANSDSEGNFF  113

Query  465  SGRSSQSDENDSLEE---------KIRNLDNGTEFMVDELGQDGTVSR------------  581
            SGRSSQS+E   LEE         KIRNLDNG+EF+ DELGQDG +SR            
Sbjct  114  SGRSSQSNEALELEEDAVEDPMCWKIRNLDNGSEFVADELGQDGMLSRLREVGTNRLFTI  173

Query  582  ------LGSSSLVQRLL  614
                  LGSS+L+Q+LL
Sbjct  174  EEFQRNLGSSALIQQLL  190



>ref|XP_009622362.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana tomentosiformis]
Length=384

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 112/197 (57%), Gaps = 51/197 (26%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC------FYTSSGS----LGYEFWAKNLESVSERR  299
            MMGSC +  E+ FFD+ D+I+S+SD         T  G     LGYEFW K+LESV ERR
Sbjct  1    MMGSCSDSEEECFFDSRDDITSVSDLGSDCNEACTRDGGDECVLGYEFWNKDLESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKW+G +  W+   R + +DE        D NRI D+GE +LANSDS+D  FSG SS
Sbjct  61   DRFLKWIGSNSSWD---RPDGHDE------QSDVNRIRDSGETVLANSDSKDSCFSGWSS  111

Query  480  QS----------DENDS----LEEKIRNLDNGTEFMVDELGQDGTVSR------------  581
            QS          D++D+    L  KIRNLDNG EF+VDE G+DG +S+            
Sbjct  112  QSFQFNEALELEDDDDATKARLHCKIRNLDNGVEFVVDEFGRDGILSQVREVGSNRLFTA  171

Query  582  ------LGSSSLVQRLL  614
                  LGSS LVQ+LL
Sbjct  172  EEFQRTLGSSPLVQKLL  188



>ref|XP_004244644.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Solanum lycopersicum]
 ref|XP_010324650.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Solanum lycopersicum]
 ref|XP_010324651.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X1 [Solanum lycopersicum]
Length=733

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 106/195 (54%), Gaps = 48/195 (25%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD--------CFY--TSSGSLGYEFWAKNLESVSERR  299
            MMG+  E  ED FFD   E  SLSD        C     S  +LGYEFW ++ ESV ERR
Sbjct  1    MMGTYSETEEDSFFDICAETGSLSDLGSDGSDACTRNEISERALGYEFWTQDPESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKWMGL       N +    +C D+ K   D RI D+ E +LA+SD+E +FFSGRSS
Sbjct  61   DRFLKWMGL-------NSNCDRSDCSDERKTSTD-RIRDDNETVLASSDAEGNFFSGRSS  112

Query  480  QSDEN------------DSLEEKIRNLDNGTEFMVDELGQDGTVSR--------------  581
            QS E+            D +  KIRNLDNG+EF+ D+LG+DG +SR              
Sbjct  113  QSFESNEALELEEDAVEDPMYWKIRNLDNGSEFVADKLGKDGMLSRLREVGTNKIFTIEE  172

Query  582  ----LGSSSLVQRLL  614
                LGSSSLVQ+ L
Sbjct  173  FTRTLGSSSLVQQFL  187



>ref|XP_004244645.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X2 [Solanum lycopersicum]
 ref|XP_010324652.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c 
isoform X2 [Solanum lycopersicum]
Length=710

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 106/195 (54%), Gaps = 48/195 (25%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD--------CFY--TSSGSLGYEFWAKNLESVSERR  299
            MMG+  E  ED FFD   E  SLSD        C     S  +LGYEFW ++ ESV ERR
Sbjct  1    MMGTYSETEEDSFFDICAETGSLSDLGSDGSDACTRNEISERALGYEFWTQDPESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKWMGL       N +    +C D+ K   D RI D+ E +LA+SD+E +FFSGRSS
Sbjct  61   DRFLKWMGL-------NSNCDRSDCSDERKTSTD-RIRDDNETVLASSDAEGNFFSGRSS  112

Query  480  QSDEN------------DSLEEKIRNLDNGTEFMVDELGQDGTVSR--------------  581
            QS E+            D +  KIRNLDNG+EF+ D+LG+DG +SR              
Sbjct  113  QSFESNEALELEEDAVEDPMYWKIRNLDNGSEFVADKLGKDGMLSRLREVGTNKIFTIEE  172

Query  582  ----LGSSSLVQRLL  614
                LGSSSLVQ+ L
Sbjct  173  FTRTLGSSSLVQQFL  187



>ref|XP_011101012.1| PREDICTED: protein tipD-like [Sesamum indicum]
Length=730

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 106/195 (54%), Gaps = 42/195 (22%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDC-------FYTSS---GSLGYEFWAKNLESVSERRT  302
            M +  E  EDQFFDT ++ISS+SD        F +     G+LGYEFW K  E V ERR 
Sbjct  1    MDAYSETEEDQFFDTREDISSVSDLDSDCSEGFLSPGLGDGALGYEFWTKKPEGVDERRN  60

Query  303  RLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQ  482
            + LKWMGL  +    +RD+  D C +  K G D R+ D+ EA+LAN DSE  FFS RS  
Sbjct  61   KFLKWMGLCSDCHKTDRDKEEDLCHEDMKRGID-RLKDDEEAVLANLDSEPKFFSSRSLP  119

Query  483  S-------------DENDSLEEKIRNLDNGTEFMVDELGQDGTVS---------------  578
            S                + L  KI+NLDNGTEF++DE+ +DGT++               
Sbjct  120  SFLSHETVDLMEDGAAEEKLAWKIKNLDNGTEFIMDEVAEDGTLTTLREVGSDRMISLDE  179

Query  579  ---RLGSSSLVQRLL  614
                LGSS+LV++LL
Sbjct  180  FQRTLGSSALVRQLL  194



>ref|XP_006352232.1| PREDICTED: uncharacterized protein LOC102579447 isoform X1 [Solanum 
tuberosum]
 ref|XP_006352233.1| PREDICTED: uncharacterized protein LOC102579447 isoform X2 [Solanum 
tuberosum]
Length=711

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/195 (43%), Positives = 105/195 (54%), Gaps = 48/195 (25%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDCFY----------TSSGSLGYEFWAKNLESVSERR  299
            MMG+  E  ED FFD   E  SLSD              S  +LGYEFW ++ ESV ERR
Sbjct  1    MMGTYSETEEDSFFDIRAETGSLSDLGLDGSDACTRNEISERALGYEFWTQDPESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKWMGL       N +    +C D+ K   D RI D+ E +LA+SD+E +FFSGRSS
Sbjct  61   HRFLKWMGL-------NSNCDRSDCSDERKTSTD-RIRDDNETVLASSDAEGNFFSGRSS  112

Query  480  QSDEN------------DSLEEKIRNLDNGTEFMVDELGQDGTVSR--------------  581
            QS E+            D +  KIRNLD+G+EF+ DELG+DG +SR              
Sbjct  113  QSFESNEALELEEDAVEDPMYWKIRNLDSGSEFVADELGKDGMLSRLREVGTNKIFTIEE  172

Query  582  ----LGSSSLVQRLL  614
                LGSS+LVQ+L 
Sbjct  173  FTRTLGSSALVQQLF  187



>ref|XP_009764325.1| PREDICTED: WD repeat-containing protein 44-like [Nicotiana sylvestris]
Length=719

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/196 (43%), Positives = 105/196 (54%), Gaps = 51/196 (26%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC------FYTSSGS----LGYEFWAKNLESVSERR  299
            MMGS  +  E+ FFD+ D+I+S+SD         T  G     LGYEFW K+LESV ERR
Sbjct  1    MMGSYSDSEEECFFDSRDDITSVSDLGSDCNEACTRDGGEECVLGYEFWNKDLESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKW+G +  W   +  E ND            RI D+GE +LANSDS +  F GRSS
Sbjct  61   DRFLKWLGSNSSWVRPDGHEQNDV----------KRIRDSGETVLANSDSRNSCFLGRSS  110

Query  480  QSDE-NDSLEE------------KIRNLDNGTEFMVDELGQDGTVSR-------------  581
            QS + N++LE             KIRNLDNG EF+VD  GQDG +S+             
Sbjct  111  QSSQSNEALELEDEDAAEAGLHCKIRNLDNGVEFVVDGFGQDGMLSQVREVGSNRLFSAE  170

Query  582  -----LGSSSLVQRLL  614
                 LGSS LVQ+LL
Sbjct  171  EFQRTLGSSPLVQKLL  186



>ref|XP_006343802.1| PREDICTED: WD repeat-containing protein 44-like [Solanum tuberosum]
Length=728

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 105/196 (54%), Gaps = 42/196 (21%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLG------YEFWAKNLESVSERR  299
            MMG+  E  E+ FFD+ +EISS+SD    C  T   +LG      Y+FW K+ ESV ERR
Sbjct  1    MMGNYSEFEEECFFDSREEISSVSDLGSDCNETCVRNLGDECVLGYDFWNKDPESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKW+G S  W+  +  E        ++    +RI D GE +LANSDS++  FSGRSS
Sbjct  61   DRFLKWIGSSSSWDSPDGKE-QGGVTTHYRKMSVDRIRDGGETVLANSDSQESCFSGRSS  119

Query  480  QS-DENDSLEE------------KIRNLDNGTEFMVDELGQDGTVSR-------------  581
            QS   N++LE             KIRNLDNG EF+VDE  Q+G +S+             
Sbjct  120  QSFHSNEALELDEDGAAEVRLHWKIRNLDNGVEFLVDEFSQEGMLSQVREVGSNKLFTAE  179

Query  582  -----LGSSSLVQRLL  614
                 LG S LVQ+ L
Sbjct  180  EFHRTLGPSPLVQKYL  195



>ref|XP_004245475.1| PREDICTED: uncharacterized protein LOC101244103 [Solanum lycopersicum]
Length=729

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 105/196 (54%), Gaps = 42/196 (21%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLG------YEFWAKNLESVSERR  299
            MMGS  E  E+ FFD+ +EI+S+SD    C  T   SLG      Y+ W K+ ESV ERR
Sbjct  1    MMGSYSEFEEECFFDSREEITSVSDLGSDCNETCVRSLGDECVLGYDLWNKDPESVDERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
             R LKW+GLS  W+  +  E        ++    +RI D GE +LANSDS++  FSGRSS
Sbjct  61   DRFLKWIGLSSSWDGPDGKE-KGGITTHYRKMSVDRIRDVGETVLANSDSQESCFSGRSS  119

Query  480  QS-DENDSLEE------------KIRNLDNGTEFMVDELGQDGTVSR-------------  581
            QS   N++LE             KIRNLDNG EF++DE  Q+G +S+             
Sbjct  120  QSFHSNEALELDEDGAAEVRLHWKIRNLDNGVEFVLDEFSQEGMLSQVREVGSNKLFTAE  179

Query  582  -----LGSSSLVQRLL  614
                 LG S LVQ+ L
Sbjct  180  EFHRTLGPSPLVQKYL  195



>ref|XP_010252806.1| PREDICTED: WD repeat-containing protein 44 [Nelumbo nucifera]
Length=757

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 107/181 (59%), Gaps = 33/181 (18%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC-------FYTSSGSLG-------YEFWAKNLESV  287
            MMGSC E  ED+FFD+ ++++ LSD          ++SG LG       YE W KN  S+
Sbjct  1    MMGSCSEEEEDRFFDSREDLTPLSDSGSDCPENIDSNSGLLGWASGGFLYEVWIKNPLSI  60

Query  288  SERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFS  467
             ERR + LKWMGLS +  V  RD+      D+ +   D RI++N  A+L +SDSED F S
Sbjct  61   HERRDKFLKWMGLSLDRTV--RDDSKHPLTDEIEVELD-RITENSGAVLRHSDSEDGFSS  117

Query  468  GRSSQS---------DENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL---GSSSL  599
             RSS S          E+  LEE    +I+NLD+GTEF+VDELGQDG +SRL   GS+ L
Sbjct  118  SRSSISCWSNDAPDLPEDVVLEENFVCRIKNLDDGTEFIVDELGQDGMLSRLREVGSNRL  177

Query  600  V  602
            V
Sbjct  178  V  178



>gb|KHG15203.1| wdr44 [Gossypium arboreum]
Length=787

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 98/181 (54%), Gaps = 32/181 (18%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----C-----------FYTSSGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD    C             +   ++G+E W KNL S
Sbjct  1    MMGSLSE-EEDQFFDTREDITSVSDSGSDCPEDSDSEHATSINSVPSNVGFEIWVKNLSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS +   M  +  ++ CCD+ +   D  +  +G A+ ++S ++    
Sbjct  60   IRERRDKFLKWMGLSIDQTTM--EGASNVCCDEIEVETDRILEKSGAALGSSSYNDGCSS  117

Query  465  SGRSSQSDENDS-----------LEEKIRNLDNGTEFMVDELGQDGTVSRL---GSSSLV  602
            S  S     +D+           L  +I+NLD+GTEF+VDEL QDG   +L   GS+ L+
Sbjct  118  SQSSVSCSSSDARELLDRALDDNLVRRIKNLDDGTEFIVDELSQDGKFRKLREVGSNHLL  177

Query  603  Q  605
            +
Sbjct  178  K  178



>gb|KHG15202.1| wdr44 [Gossypium arboreum]
Length=797

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 98/181 (54%), Gaps = 32/181 (18%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----C-----------FYTSSGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD    C             +   ++G+E W KNL S
Sbjct  1    MMGSLSE-EEDQFFDTREDITSVSDSGSDCPEDSDSEHATSINSVPSNVGFEIWVKNLSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS +   M  +  ++ CCD+ +   D  +  +G A+ ++S ++    
Sbjct  60   IRERRDKFLKWMGLSIDQTTM--EGASNVCCDEIEVETDRILEKSGAALGSSSYNDGCSS  117

Query  465  SGRSSQSDENDS-----------LEEKIRNLDNGTEFMVDELGQDGTVSRL---GSSSLV  602
            S  S     +D+           L  +I+NLD+GTEF+VDEL QDG   +L   GS+ L+
Sbjct  118  SQSSVSCSSSDARELLDRALDDNLVRRIKNLDDGTEFIVDELSQDGKFRKLREVGSNHLL  177

Query  603  Q  605
            +
Sbjct  178  K  178



>ref|XP_010267520.1| PREDICTED: 2-deoxy-glucose resistant protein 2 [Nelumbo nucifera]
 ref|XP_010267521.1| PREDICTED: 2-deoxy-glucose resistant protein 2 [Nelumbo nucifera]
Length=747

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 103/193 (53%), Gaps = 43/193 (22%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSL---SDC----------FYTSSGSLGYEFWAKNLESVS  290
            MMGSC E  ED+FFD+ ++++S    S+C             +SGS  Y  W +N  S+ 
Sbjct  1    MMGSCSEEEEDRFFDSREDLTSSDSGSNCQENFDSNPGFLGLASGSFLYHVWIQNPGSIH  60

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDD---NRISDNGEAMLANSDSEDHF  461
            ERR + LKWMGLS +  VM      ++C     +  +   +RI++N  A+L  S  ED F
Sbjct  61   ERRKKFLKWMGLSSDRTVM------EDCGHPSTSNIEVEMDRITENSGAVLRYSGFEDRF  114

Query  462  FSGRSSQSDENDSLEE-------------KIRNLDNGTEFMVDELGQDGTVSRL---GSS  593
             S RSS S  ++   E             +I+NLD GTEF+VDELG+DG +SRL   GS+
Sbjct  115  SSSRSSISCWSNEASELSEDGVSEANLICRIKNLDAGTEFIVDELGRDGMLSRLNEMGSN  174

Query  594  SLV-----QRLLG  617
             +V     QR LG
Sbjct  175  QVVAVKEFQRDLG  187



>ref|XP_010659824.1| PREDICTED: uncharacterized protein LOC100249640 [Vitis vinifera]
Length=727

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 101/195 (52%), Gaps = 46/195 (24%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEIS-SLSDC---FYTSSG-------SLGYEFWAKNLESVSERR  299
            MGS  E   D+FFDT +E S S SD    F +S+G       S GY  W KN +SV+ERR
Sbjct  1    MGSSSEEEGDRFFDTREEFSDSASDGSVDFRSSNGVVDGDSDSFGYGLWIKNPQSVNERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELN---------DECCDKFKAGDDNRISDNGEAMLANSDSE  452
             + LKWM L      M+++ +          D CCDK K   D R ++N  A+L NS SE
Sbjct  61   DKFLKWMNLD-----MDQNRITSEESESESGDVCCDKIKIETD-RATENSGAVLRNSVSE  114

Query  453  DHFFSGRSSQS------------DENDSLEEKIRNLDNGTEFMVDELGQDGTVSR---LG  587
            D   S + S S               D+L  KI+NLD+GTEF+VD+LG +G   +   +G
Sbjct  115  DRVSSIQCSMSFRSNGEELLEGGIRKDNLPCKIKNLDDGTEFVVDKLGGNGMHGKPREVG  174

Query  588  SSSLV-----QRLLG  617
            S+ +V     QR +G
Sbjct  175  SNRVVSMEEFQRTIG  189



>ref|XP_007210339.1| hypothetical protein PRUPE_ppa001944mg [Prunus persica]
 gb|EMJ11538.1| hypothetical protein PRUPE_ppa001944mg [Prunus persica]
Length=738

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 95/173 (55%), Gaps = 23/173 (13%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERRTR  305
            MGS  E  EDQF+DT +++SS+SD     C   SS + G+    E WAKNL+SV ERR +
Sbjct  1    MGSYSEEREDQFYDTREDLSSVSDWGSDGCDEFSSSTSGFLRYDEVWAKNLDSVHERRHK  60

Query  306  LLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQS  485
             L+WMGL  +  ++  +E  D+C +K +   D RI ++   +L  S  E+   S +S+ S
Sbjct  61   FLQWMGLDLDRNLIMEEEAGDDCAEKIEMSID-RIKEDSCVVLRTSGLEEASCSSQSTAS  119

Query  486  D---------ENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQ  605
                       N +L+E     +R L+   + +V+ELGQDG + RLG   L Q
Sbjct  120  ALSNEARESLGNGALDENFGCAVRTLNQRMDIIVNELGQDGRLCRLGQVGLNQ  172



>gb|KJB09622.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
 gb|KJB09625.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
Length=753

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 34/181 (19%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC-----------FYTSSGSL----GYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD               S+ S+    G+E W KNL S
Sbjct  1    MMGSLSEE-EDQFFDTREDITSVSDLGSDCPDNSDSELVASTNSMPANFGFEVWIKNLSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR++ LKWM L+ +     R+  ++ CCD+ +   D RI +   A+L +S  +D F 
Sbjct  60   IRERRSKFLKWMDLNVDQTA--RESPSNMCCDEIEVETD-RIMEESGAVLGSSTFDDDFS  116

Query  465  SGRSSQSDENDSLEE------------KIRNLDNGTEFMVDELGQDGTVSRL---GSSSL  599
            S +SS S  ++ + E            +I+NLD+GTEF+VDEL QDG +  L   GS++L
Sbjct  117  SSQSSMSCWSNDVRELLDGAFDDNFVCRIKNLDDGTEFIVDELSQDGMLKGLREVGSNNL  176

Query  600  V  602
            +
Sbjct  177  L  177



>gb|KJB09623.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
 gb|KJB09624.1| hypothetical protein B456_001G153400 [Gossypium raimondii]
Length=774

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 102/181 (56%), Gaps = 34/181 (19%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC-----------FYTSSGSL----GYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD               S+ S+    G+E W KNL S
Sbjct  1    MMGSLSEE-EDQFFDTREDITSVSDLGSDCPDNSDSELVASTNSMPANFGFEVWIKNLSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR++ LKWM L+ +     R+  ++ CCD+ +   D RI +   A+L +S  +D F 
Sbjct  60   IRERRSKFLKWMDLNVDQTA--RESPSNMCCDEIEVETD-RIMEESGAVLGSSTFDDDFS  116

Query  465  SGRSSQSDENDSLEE------------KIRNLDNGTEFMVDELGQDGTVSRL---GSSSL  599
            S +SS S  ++ + E            +I+NLD+GTEF+VDEL QDG +  L   GS++L
Sbjct  117  SSQSSMSCWSNDVRELLDGAFDDNFVCRIKNLDDGTEFIVDELSQDGMLKGLREVGSNNL  176

Query  600  V  602
            +
Sbjct  177  L  177



>ref|XP_007051501.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007051503.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95658.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX95660.1| Transducin/WD40 repeat superfamily protein isoform 1 [Theobroma 
cacao]
Length=753

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 93/172 (54%), Gaps = 31/172 (18%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTS-----------SGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD    C   S             + G+E W KNL S
Sbjct  1    MMGSLSEE-EDQFFDTREDITSVSDSGSDCPENSDSECAASVNSMPANFGFEIWIKNLSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS    V  R+  ++ CCD+ +   D RI +   A+L +S  +D F 
Sbjct  60   IRERRDKFLKWMGLSVGQAV--REGPSNMCCDEIEVETD-RIMETSGAVLGSSSFDDGFS  116

Query  465  SGRS------------SQSDENDSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
            S +S            S    ND+   +I+NLD+GTEF+VDEL QDG   RL
Sbjct  117  SSQSSMSCWSSDARELSDGALNDNFTCRIKNLDDGTEFIVDELSQDGMFRRL  168



>ref|XP_007051502.1| Transducin/WD40 repeat superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX95659.1| Transducin/WD40 repeat superfamily protein isoform 2 [Theobroma 
cacao]
Length=754

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 93/172 (54%), Gaps = 31/172 (18%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTS-----------SGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD    C   S             + G+E W KNL S
Sbjct  1    MMGSLSEE-EDQFFDTREDITSVSDSGSDCPENSDSECAASVNSMPANFGFEIWIKNLSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS    V  R+  ++ CCD+ +   D RI +   A+L +S  +D F 
Sbjct  60   IRERRDKFLKWMGLSVGQAV--REGPSNMCCDEIEVETD-RIMETSGAVLGSSSFDDGFS  116

Query  465  SGRS------------SQSDENDSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
            S +S            S    ND+   +I+NLD+GTEF+VDEL QDG   RL
Sbjct  117  SSQSSMSCWSSDARELSDGALNDNFTCRIKNLDDGTEFIVDELSQDGMFRRL  168



>ref|XP_011026824.1| PREDICTED: uncharacterized protein LOC105127282 [Populus euphratica]
Length=740

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 87/160 (54%), Gaps = 21/160 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD-------CFYTSSGSLGYEFWAKNLESVSERRTRLLKWMGL  326
            E  E  FFDT +EIS +SD       C  +   S  Y+ W +N ESV +RR R LKWMGL
Sbjct  11   EEQEPNFFDTLEEISPVSDWSSDGGDCSPSVFNSFSYDDWTRNPESVQDRRRRFLKWMGL  70

Query  327  SPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS---------  479
            S +      +E  D+  D+ +    +R  DN  A+L  S  ED F S +SS         
Sbjct  71   SLDRNDGFEEEFGDDFKDEIQWVGVDRPGDNSGAVLGTSSIEDDFLSTQSSMSSESSEVW  130

Query  480  -QSDENDSLE----EKIRNLDNGTEFMVDELGQDGTVSRL  584
             QS EN +L+     +I+NLD+GTEF+VDEL  DG +SRL
Sbjct  131  RQSFENGTLDGNTVYRIKNLDDGTEFLVDELDGDGMLSRL  170



>ref|XP_002264456.1| PREDICTED: WD repeat-containing protein YMR102C-like [Vitis vinifera]
 ref|XP_010661969.1| PREDICTED: WD repeat-containing protein YMR102C-like [Vitis vinifera]
Length=753

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 98/170 (58%), Gaps = 29/170 (17%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYT----------SSGSLGYEFWAKNLESV  287
            MMGS  E  EDQFFDT ++I+S+SD    C              SGS G E W KN ES+
Sbjct  1    MMGSLSE-EEDQFFDTREDITSVSDSGSDCQENLDSEWRNTDFVSGSFGCEVWIKNPESI  59

Query  288  SERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFS  467
             ERRT+ LKWMGL  +  V    E+ +E       G+ +RI++N  A+L  S S+D F S
Sbjct  60   RERRTKFLKWMGLGVDHVV---REVPEELVSGELKGEIDRITENSGAVLGMSSSDDGFSS  116

Query  468  GRSS---QSDEND----SLEE----KIRNLDNGTEFMVDELGQDGTVSRL  584
             +SS    SD  D    SLEE    +IR+LD+G EF+VDELGQ G +SRL
Sbjct  117  SQSSMCWPSDAQDFLGGSLEENLFCRIRSLDDGREFIVDELGQYGMLSRL  166



>gb|KHG23616.1| WD repeat-containing 44 [Gossypium arboreum]
Length=752

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 101/180 (56%), Gaps = 34/180 (19%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDC-----------FYTSSGSL----GYEFWAKNLESV  287
            MGS  E  EDQFFDT ++I+S+SD               S+ S+    G+E W KNL S+
Sbjct  1    MGSLSEE-EDQFFDTREDITSVSDLGSDCPDNSDSELVASTNSMPANFGFEVWIKNLSSI  59

Query  288  SERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFS  467
             ERR++ LKWM L+ +     R+  ++ CCD+ +   D RI +   A+L +S  +D F S
Sbjct  60   RERRSKFLKWMDLNVDQTA--RESPSNMCCDEIEVETD-RIMEESGAVLGSSTFDDDFSS  116

Query  468  GRSSQSDENDSLEE------------KIRNLDNGTEFMVDELGQDGTVSRL---GSSSLV  602
             +SS S  ++ + E            KI+NLD+GTEF+VDEL QDG +  L   GS++L+
Sbjct  117  SQSSMSCWSNDVRELLDGAFDDNFVCKIKNLDDGTEFIVDELSQDGMLKGLREVGSNNLL  176



>ref|XP_008239197.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
 ref|XP_008239198.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
 ref|XP_008239199.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
 ref|XP_008239200.1| PREDICTED: uncharacterized protein LOC103337808 [Prunus mume]
Length=738

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 64/173 (37%), Positives = 94/173 (54%), Gaps = 23/173 (13%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERRTR  305
            MGS  E  EDQF+DT +++SS+SD     C   SS + G+    E WAKNL+SV ERR +
Sbjct  1    MGSYSEEREDQFYDTREDLSSVSDWGSDGCDEFSSSTSGFLRYDEVWAKNLDSVHERRHK  60

Query  306  LLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQS  485
             L+WMGL  +  ++  +E  D+C +K +   D RI +    +L  S  E+   S +S+ S
Sbjct  61   FLQWMGLDLDRNLIMEEEAGDDCAEKIEMSID-RIKEYSCVVLRTSGLEEVSCSSQSTAS  119

Query  486  D---------ENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQ  605
                       N +L+E     +R L+   + +V+ELGQDG + RLG   L Q
Sbjct  120  ALSNEARESLGNGALDENFGCAVRTLNQRMDIIVNELGQDGRLCRLGQVGLNQ  172



>ref|XP_002297958.2| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
 gb|EEE82763.2| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
Length=716

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 88/160 (55%), Gaps = 21/160 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD-------CFYTSSGSLGYEFWAKNLESVSERRTRLLKWMGL  326
            E  E  FFDT +EISS+SD       C  +   S  Y+ W +N ESV +RR R LKWMGL
Sbjct  11   EEQEPSFFDTREEISSVSDWSSDCGDCSPSVFNSFSYDDWTRNPESVQDRRRRFLKWMGL  70

Query  327  SPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS---------  479
            S +      ++  D+  ++ +    +R  DN  A+L  S  ED F S +SS         
Sbjct  71   SLDRNDGFEEKFGDDFKNEIQWVGVDRTEDNSGAVLRTSSIEDDFLSTQSSMSSESNEVW  130

Query  480  -QSDENDSLE----EKIRNLDNGTEFMVDELGQDGTVSRL  584
             QS EN +L+     +I+NLD+GTEF+VDEL  DG +SRL
Sbjct  131  RQSFENGTLDGNIVYRIKNLDDGTEFLVDELDGDGMLSRL  170



>ref|XP_006368793.1| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
 gb|ERP65362.1| hypothetical protein POPTR_0001s11110g [Populus trichocarpa]
Length=746

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 88/160 (55%), Gaps = 21/160 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD-------CFYTSSGSLGYEFWAKNLESVSERRTRLLKWMGL  326
            E  E  FFDT +EISS+SD       C  +   S  Y+ W +N ESV +RR R LKWMGL
Sbjct  11   EEQEPSFFDTREEISSVSDWSSDCGDCSPSVFNSFSYDDWTRNPESVQDRRRRFLKWMGL  70

Query  327  SPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS---------  479
            S +      ++  D+  ++ +    +R  DN  A+L  S  ED F S +SS         
Sbjct  71   SLDRNDGFEEKFGDDFKNEIQWVGVDRTEDNSGAVLRTSSIEDDFLSTQSSMSSESNEVW  130

Query  480  -QSDENDSLE----EKIRNLDNGTEFMVDELGQDGTVSRL  584
             QS EN +L+     +I+NLD+GTEF+VDEL  DG +SRL
Sbjct  131  RQSFENGTLDGNIVYRIKNLDDGTEFLVDELDGDGMLSRL  170



>emb|CDP12205.1| unnamed protein product [Coffea canephora]
Length=663

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 72/125 (58%), Gaps = 9/125 (7%)
 Frame = +3

Query  249  LGYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEA  428
             GYEFW +  ESV  RRT+ LKWMG+  +W    R+E+ D   D F  G   R+ DN EA
Sbjct  38   FGYEFWNRIPESVIGRRTQFLKWMGVELDWSKGIREEVEDAIGDDFVEG-LGRLRDNSEA  96

Query  429  MLANSDSEDHFFSGR---SSQSDENDSLEEKIRNLDNGTEFMVDELGQDGTVSRLGSSSL  599
            +LANSDSED F S +   S QS+E+D +   +R + +     ++EL +       GSSSL
Sbjct  97   VLANSDSEDGFSSAQSFLSFQSNESDGMLSLLREVGSNKTITIEELQRS-----FGSSSL  151

Query  600  VQRLL  614
            VQ+  
Sbjct  152  VQQYF  156



>ref|XP_002304571.2| hypothetical protein POPTR_0003s14440g [Populus trichocarpa]
 gb|EEE79550.2| hypothetical protein POPTR_0003s14440g [Populus trichocarpa]
Length=713

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 90/161 (56%), Gaps = 22/161 (14%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD----CFYTSSG---SLGYEFWAKNLESVSERRTRLLK-WMG  323
            E  +  FFDT +EISS+SD    C   S     SL Y+ W K+ ESV +RR R LK WMG
Sbjct  11   EEQDSNFFDTREEISSVSDWSSDCEDGSPSVFNSLTYDDWTKSPESVQDRRQRFLKCWMG  70

Query  324  LSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS--------  479
            LS +      +E  ++  +K + G  +R+ DN  A+L  S  ED F S +SS        
Sbjct  71   LSLDGNERVEEEFGNDSLNKIQLGVVDRMVDNSGAVLRTSSFEDGFLSAQSSMSSGSSEA  130

Query  480  --QSDENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL  584
              QS EN  L+     KI+NLD+G EF+VDEL +DG +SRL
Sbjct  131  WRQSFENGVLDGNFVCKIKNLDDGMEFLVDELDEDGMLSRL  171



>ref|XP_011022443.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011022444.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011022445.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
 ref|XP_011022446.1| PREDICTED: WD repeat-containing protein 44-like [Populus euphratica]
Length=745

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 89/161 (55%), Gaps = 22/161 (14%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD----CFYTSSG---SLGYEFWAKNLESVSERRTRLLK-WMG  323
            E  +  FFDT +EISS+SD    C   S     SL Y+ W K+ ESV +RR R LK WMG
Sbjct  11   EEQDSNFFDTREEISSVSDWSSDCGDGSPSVFNSLTYDDWTKSPESVQDRRQRFLKCWMG  70

Query  324  LSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS--------  479
            LS +      +E  ++  +K + G  +R+ DN  A+L  S  ED F S +SS        
Sbjct  71   LSLDGNERVEEEFGNDSLNKIQLGVVDRMVDNSGAVLRTSSFEDGFLSAQSSMSSGSSEA  130

Query  480  --QSDENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL  584
              QS EN  L      KI+NLD+G EF+VDEL +DG +SRL
Sbjct  131  WRQSFENGVLGGNFVCKIKNLDDGMEFLVDELDEDGMLSRL  171



>gb|KJB41586.1| hypothetical protein B456_007G110600 [Gossypium raimondii]
Length=609

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 90/171 (53%), Gaps = 29/171 (17%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC---------------FYTSSGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD                  +   ++G+E W KN  S
Sbjct  1    MMGSLTEE-EDQFFDTREDITSVSDSGSDCPENSDSEHATSINSVPSNVGFEIWVKNPSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS +   + R+  ++  CD+ +   D  +  +G A+ ++S ++    
Sbjct  60   IRERRDKFLKWMGLSIDQ--IAREGASNVWCDEIEVETDRILEKSGAALGSSSFNDGCSS  117

Query  465  SGRSSQSDENDSLEE-----------KIRNLDNGTEFMVDELGQDGTVSRL  584
            S  S     +D+ E            +I+NLD+GTEF+VDEL QDG   +L
Sbjct  118  SQSSVSCSSSDARELLDRALDDNLVCRIKNLDDGTEFIVDELSQDGKFRKL  168



>ref|XP_009344051.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Pyrus x bretschneideri]
 ref|XP_009344052.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Pyrus x bretschneideri]
Length=730

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 64/179 (36%), Positives = 94/179 (53%), Gaps = 25/179 (14%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERRT  302
            +MGS GE  EDQF+DT +++SS+SD     C   SSG+ G+    E WA NLESV ERR 
Sbjct  8    LMGSYGEEREDQFYDTREDLSSVSDWGSDCCEEFSSGTPGFLRYEEVWANNLESVHERRH  67

Query  303  RLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED---------  455
            + L+WMG+  +   M  ++  D   D+ K  D  RI ++   +L     E+         
Sbjct  68   KFLQWMGVDLDSNSMTTEDSEDVFVDRIKIID--RIREDSGVVLRTWGLEEASCSSQSTV  125

Query  456  HFFSGRSSQSDENDSLEE-----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQRLLG  617
               S  + +S  N +L++      +RNL+ G   +V EL QDG + RLG + L Q + G
Sbjct  126  SSLSTEARESLGNGALDDTHSTRAMRNLNGGMTVIVSELVQDGRLGRLGQAGLNQLVNG  184



>gb|KJB41582.1| hypothetical protein B456_007G110600 [Gossypium raimondii]
Length=726

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 90/171 (53%), Gaps = 29/171 (17%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC---------------FYTSSGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD                  +   ++G+E W KN  S
Sbjct  1    MMGSLTEE-EDQFFDTREDITSVSDSGSDCPENSDSEHATSINSVPSNVGFEIWVKNPSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS   + + R+  ++  CD+ +   D  +  +G A+ ++S ++    
Sbjct  60   IRERRDKFLKWMGLSI--DQIAREGASNVWCDEIEVETDRILEKSGAALGSSSFNDGCSS  117

Query  465  SGRSSQSDENDSLEE-----------KIRNLDNGTEFMVDELGQDGTVSRL  584
            S  S     +D+ E            +I+NLD+GTEF+VDEL QDG   +L
Sbjct  118  SQSSVSCSSSDARELLDRALDDNLVCRIKNLDDGTEFIVDELSQDGKFRKL  168



>gb|KJB41583.1| hypothetical protein B456_007G110600 [Gossypium raimondii]
 gb|KJB41584.1| hypothetical protein B456_007G110600 [Gossypium raimondii]
 gb|KJB41585.1| hypothetical protein B456_007G110600 [Gossypium raimondii]
Length=754

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 90/171 (53%), Gaps = 29/171 (17%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDC---------------FYTSSGSLGYEFWAKNLES  284
            MMGS  E  EDQFFDT ++I+S+SD                  +   ++G+E W KN  S
Sbjct  1    MMGSLTEE-EDQFFDTREDITSVSDSGSDCPENSDSEHATSINSVPSNVGFEIWVKNPSS  59

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            + ERR + LKWMGLS   + + R+  ++  CD+ +   D  +  +G A+ ++S ++    
Sbjct  60   IRERRDKFLKWMGLSI--DQIAREGASNVWCDEIEVETDRILEKSGAALGSSSFNDGCSS  117

Query  465  SGRSSQSDENDSLEE-----------KIRNLDNGTEFMVDELGQDGTVSRL  584
            S  S     +D+ E            +I+NLD+GTEF+VDEL QDG   +L
Sbjct  118  SQSSVSCSSSDARELLDRALDDNLVCRIKNLDDGTEFIVDELSQDGKFRKL  168



>ref|XP_009359575.1| PREDICTED: uncharacterized WD repeat-containing protein C3H5.08c-like 
[Pyrus x bretschneideri]
Length=722

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 92/178 (52%), Gaps = 25/178 (14%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERRTR  305
            MGS GE  EDQF+DT +++SS+SD     C   SSG+ G+    E WA NLESV ERR +
Sbjct  1    MGSYGEEREDQFYDTREDLSSVSDWGSDCCEEFSSGTPGFLRYEEVWANNLESVHERRHK  60

Query  306  LLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED---------H  458
             L+WMG+  +   M  ++  D   D+ K  D  RI ++   +L     E           
Sbjct  61   FLQWMGVDLDSNSMTTEDSEDVFVDRIKIID--RIKEDSGVLLRTWGLEQASCSSQSTVS  118

Query  459  FFSGRSSQSDENDSLEE-----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQRLLG  617
              S  + +S  N +L++      +RNL+ G   +V EL QDG + RLG + L Q + G
Sbjct  119  SLSTEARESLGNGALDDTHSTRAMRNLNGGMTVIVSELVQDGRLGRLGQAGLNQLVNG  176



>ref|XP_008390309.1| PREDICTED: uncharacterized protein LOC103452581 [Malus domestica]
 ref|XP_008390310.1| PREDICTED: uncharacterized protein LOC103452581 [Malus domestica]
Length=724

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 93/178 (52%), Gaps = 25/178 (14%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERRTR  305
            MGS GE  EDQF+DT +++SS+SD     C   SSG+ G+    E WA NLESV ERR +
Sbjct  1    MGSYGEEREDQFYDTREDLSSVSDWGSDCCEEFSSGTPGFLRYEEVWANNLESVHERRHK  60

Query  306  LLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED---------H  458
             L+WMG+      M  ++  D   D+ K  D  RI ++   ML +   E+          
Sbjct  61   FLQWMGVDLVSNSMMTEDSEDVFVDRIKIID--RIREDSGVMLRSWGLEEASCSSQSTVS  118

Query  459  FFSGRSSQSDENDSLEE-----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQRLLG  617
              S  + +S  N +L++      +RNL+ G   +V EL QDG + RLG + L Q + G
Sbjct  119  SLSTEARESLGNGALDDTRSTRAMRNLNGGMTVIVSELVQDGRLGRLGQAGLNQLVNG  176



>ref|XP_006584780.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
 gb|KHN16710.1| Putative WD repeat-containing protein C3H5.08c [Glycine soja]
Length=720

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 96/167 (57%), Gaps = 22/167 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD-------CFYTSSGSLG----YEFWAKNLESVSERRTRLLK  314
            E  EDQF++T +E+ S+SD          +SSG+ G    Y+ WA+NLESV +RR   L+
Sbjct  2    EEEEDQFYETREELCSVSDGGSDCSESDESSSGNNGHVTRYQVWAQNLESVHQRRLNFLR  61

Query  315  WMGLSPEWEV-MNRDELNDECC--DKFKA--GDDNRISDNGEAMLANSDSEDHF--FSGR  473
            WMGL  +    M  +EL D+ C  D+  A  G   R S   E  L ++ ++      S  
Sbjct  62   WMGLESDLNYSMKGEELGDQPCGIDRITATSGAVLRTSFAIEEGLPSTSNQIVLDSLSDE  121

Query  474  SSQSDEN-DSLEEKIRNLDNGTEFMVDELGQDG---TVSRLGSSSLV  602
            +S S EN ++L   IRNLD+GTE++VD+LGQDG   T+  LGS+ L+
Sbjct  122  ASGSQENRENLACMIRNLDDGTEYIVDKLGQDGAPSTLRVLGSNQLI  168



>ref|XP_003525326.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max]
 gb|KHM99868.1| WD repeat-containing protein 44 [Glycine soja]
Length=720

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 94/167 (56%), Gaps = 22/167 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSDC-------FYTSSGSLG----YEFWAKNLESVSERRTRLLK  314
            E  EDQF++T +E+ S+SD          +SSG+ G    Y+ WAK LESV +RR   L+
Sbjct  2    EEEEDQFYETREELCSVSDVGSDCSESDESSSGNNGHVTRYQVWAKKLESVHQRRLNFLR  61

Query  315  WMGLSPEWEV-MNRDELNDECC--DKFKA--GDDNRISDNGEAMLANSDSEDHF--FSGR  473
            WM L  +    M  +EL D+ C  D+  A  G   R S   E  L ++ ++      S  
Sbjct  62   WMDLESDLNYSMKGEELGDQPCGIDRITATSGAVLRTSFAVEEGLPSTSNQIVLDSLSDE  121

Query  474  SSQSDEN-DSLEEKIRNLDNGTEFMVDELGQDG---TVSRLGSSSLV  602
            +S S EN ++L   IRNLD+GT+++VD+LGQDG   T+  LGS+ L+
Sbjct  122  ASGSQENCENLACMIRNLDDGTQYIVDKLGQDGAPSTLRVLGSNQLI  168



>ref|XP_009358663.1| PREDICTED: uncharacterized protein LOC103949280 isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 91/175 (52%), Gaps = 23/175 (13%)
 Frame = +3

Query  147  GMMGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERR  299
            G +GS  E  ED F+DT +++SS+SD     C   SSG+ G+    E WAKNLESV ERR
Sbjct  2    GTLGSPSEEREDHFYDTREDLSSVSDWGSDCCEDFSSGASGFLRYEEVWAKNLESVHERR  61

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNG--------EAMLANSDSED  455
             + L+WMG+  +      ++  D   D+ K  D  R  D+G        E    +S S  
Sbjct  62   HKFLEWMGVDLDSHSTMTEDSEDIFVDRIKIIDRYR-EDSGVVLRTSGLEVASCSSQSTV  120

Query  456  HFFSGRSSQSDENDSLEE-----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQ  605
               S  + +   N +L++      +RNL+ G   +V+ELG DG + RLG ++L Q
Sbjct  121  SSLSTEAREPLGNGALDDTHSTSAMRNLNRGMNVIVNELGHDGRLGRLGQAALNQ  175



>ref|XP_009358661.1| PREDICTED: vegetative incompatibility protein HET-E-1-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009358662.1| PREDICTED: vegetative incompatibility protein HET-E-1-like isoform 
X1 [Pyrus x bretschneideri]
Length=744

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 91/175 (52%), Gaps = 23/175 (13%)
 Frame = +3

Query  147  GMMGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERR  299
            G +GS  E  ED F+DT +++SS+SD     C   SSG+ G+    E WAKNLESV ERR
Sbjct  2    GTLGSPSEEREDHFYDTREDLSSVSDWGSDCCEDFSSGASGFLRYEEVWAKNLESVHERR  61

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNG--------EAMLANSDSED  455
             + L+WMG+  +      ++  D   D+ K  D  R  D+G        E    +S S  
Sbjct  62   HKFLEWMGVDLDSHSTMTEDSEDIFVDRIKIIDRYR-EDSGVVLRTSGLEVASCSSQSTV  120

Query  456  HFFSGRSSQSDENDSLEE-----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQ  605
               S  + +   N +L++      +RNL+ G   +V+ELG DG + RLG ++L Q
Sbjct  121  SSLSTEAREPLGNGALDDTHSTSAMRNLNRGMNVIVNELGHDGRLGRLGQAALNQ  175



>ref|XP_008388376.1| PREDICTED: uncharacterized protein LOC103450778 [Malus domestica]
Length=744

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 91/179 (51%), Gaps = 23/179 (13%)
 Frame = +3

Query  147  GMMGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLGY----EFWAKNLESVSERR  299
            G +GS     ED F+DT +++SS+SD     C   SSG+ G+    E WAKNLESV ERR
Sbjct  2    GTLGSPSXEREDHFYDTREDLSSVSDWGSDCCEDFSSGASGFIRYEEVWAKNLESVHERR  61

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNG--------EAMLANSDSED  455
             + L+WMG+  +      ++  D   D+ K  D  R  D G        E    +S S  
Sbjct  62   HKFLEWMGVDLDTHSTMTEDSEDIFVDRIKVIDRFR-EDRGVVLRTSGLEVASCSSQSTV  120

Query  456  HFFSGRSSQSDENDSLEE-----KIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQRLLG  617
               S  + +   N +L++      +RNL+ G   +V+ELG DG + RLG ++L Q + G
Sbjct  121  SSLSTEAREPLGNGALDDTHSTSAMRNLNRGMNVIVNELGHDGRLGRLGQAALNQLVNG  179



>ref|XP_002518879.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF43412.1| WD-repeat protein, putative [Ricinus communis]
Length=743

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 93/198 (47%), Gaps = 48/198 (24%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSL----------GYEFWAKNLESVS  290
            MG+  E  E++FFD+ +E SS+SD     +   S S+           YE W K+ ESV 
Sbjct  1    MGNYSEEEEERFFDSREETSSMSDSGSNVYEDCSSSIDFDYSLLSESQYEVWIKSPESVY  60

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSG  470
            +RR R LKWM  S +  +   D +N E   K + G D R+ D   A+L  S   D   S 
Sbjct  61   DRRDRFLKWMN-SDQNTISEGDSIN-ESFTKTQLGID-RLMDTTGAVLRTSGLGDGLLST  117

Query  471  RSSQSDE-------------NDSLEEKIRNLDNGTEFMVDELGQDGTVSRL---------  584
             +  S +             +D+    IRNLD+GTEF+VDEL QDG +SRL         
Sbjct  118  ETPVSSQSSETQESLEDGSVDDNFVCTIRNLDDGTEFVVDELDQDGMLSRLRKVGSNQSL  177

Query  585  ---------GSSSLVQRL  611
                     G SSLVQR 
Sbjct  178  SFEEFQRTIGVSSLVQRF  195



>ref|XP_006857843.1| hypothetical protein AMTR_s00069p00055450 [Amborella trichopoda]
 gb|ERN19310.1| hypothetical protein AMTR_s00069p00055450 [Amborella trichopoda]
Length=768

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 88/190 (46%), Gaps = 47/190 (25%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCF--YTSS------------GSLGYEFWAKNLESVS  290
            MGSC +  ED FFDT +EI+SLSD    Y  +            G++ YE W     ++ 
Sbjct  1    MGSCSDEEEDHFFDTREEITSLSDSGSDYAEATENHSGFSELIYGNILYEVWLNKPGTIR  60

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF--  464
            ERR + L+ MGL+   E ++    N E           R+ DN  A+L +SD E +F   
Sbjct  61   ERREKFLRMMGLARNGETLDSSSENGEIPGV------ERLKDNSGAVLMSSDFESNFSSS  114

Query  465  --------SGRSSQSDENDSLEE-------------KIRNLDNGTEFMVDELGQDGTVSR  581
                    +G     D  D LEE             +IRNLDNGTEF++D    DG +SR
Sbjct  115  RSSLMSWSNGPVDSPDSRD-LEEINSIDDDRENMVCRIRNLDNGTEFVIDNPSGDGVLSR  173

Query  582  L---GSSSLV  602
            L   GS  LV
Sbjct  174  LRRVGSDRLV  183



>ref|XP_011023150.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1X [Populus 
euphratica]
 ref|XP_011023152.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1X [Populus 
euphratica]
 ref|XP_011023153.1| PREDICTED: F-box-like/WD repeat-containing protein TBL1X [Populus 
euphratica]
Length=744

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 86/162 (53%), Gaps = 29/162 (18%)
 Frame = +3

Query  177  EDQFFDTGDEISSLSD--------------CFYTSSGSLGYEFWAKNLESVSERRTRLLK  314
            EDQFFDT ++  S+SD                 +  GS+GYE W KN   + ERR + LK
Sbjct  8    EDQFFDTLEDCPSVSDPDSDSPDNLDSDFGVIGSLPGSIGYEVWIKNPGCIRERRNKFLK  67

Query  315  WMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRS------  476
            WMGL  + +   + +  +   ++ +   D RI+++ +A+L +   +D   S +S      
Sbjct  68   WMGL--DVDQAGKGDPGNTSFNEVEVETD-RITEHSDAVLRSYSLDDGLSSSQSSMSSWS  124

Query  477  --SQSDENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL  584
              +Q   + ++EE    ++RNLDNGTEF++DEL QDG   R+
Sbjct  125  NDAQELLDGAMEENFVCRVRNLDNGTEFILDELRQDGMSGRI  166



>ref|XP_002302646.2| hypothetical protein POPTR_0002s17470g [Populus trichocarpa]
 gb|EEE81919.2| hypothetical protein POPTR_0002s17470g [Populus trichocarpa]
Length=744

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 83/162 (51%), Gaps = 29/162 (18%)
 Frame = +3

Query  177  EDQFFDTGDEISSLSD--------------CFYTSSGSLGYEFWAKNLESVSERRTRLLK  314
            EDQFFDT ++  S+SD                 +  GS+GYE W KN   + ERR + LK
Sbjct  8    EDQFFDTCEDCPSVSDPGSDSPDNLDSDFGVIGSLPGSIGYEVWIKNPGCIRERRNKFLK  67

Query  315  WMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQSDEN  494
            WMGL  +     + +  +   ++ +   D RI ++ +A+L +   +D   S +SS S  +
Sbjct  68   WMGL--DVNQAGKGDPGNTSSNEVEVETD-RIMEHSDAVLRSYSLDDGLSSSQSSMSSWS  124

Query  495  DSLEE------------KIRNLDNGTEFMVDELGQDGTVSRL  584
            +  +E            +IRNLDNGTEF++DEL QDG   R+
Sbjct  125  NDAQELLDGAMEENFLCRIRNLDNGTEFILDELRQDGMSGRI  166



>ref|XP_004143851.1| PREDICTED: uncharacterized protein LOC101204856 [Cucumis sativus]
 ref|XP_004161452.1| PREDICTED: uncharacterized LOC101204856 [Cucumis sativus]
 gb|KGN49996.1| hypothetical protein Csa_5G148670 [Cucumis sativus]
Length=743

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 86/188 (46%), Gaps = 46/188 (24%)
 Frame = +3

Query  180  DQFFDTGDEISSLSD----CFYTSSGSLG----------YEFWAKNLESVSERRTRLLKW  317
            ++F+DT +EISS+SD    C    S S G          Y  W +NLESV ERR +  KW
Sbjct  12   ERFYDTREEISSVSDWGSDCSENCSTSFGDDGDIPENLRYVGWIRNLESVYERRNKFFKW  71

Query  318  MGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAM-------LANSDSEDHFFSGRS  476
            MGL  +    N D  ++E  D +K   D  I D G  +         +S       S  +
Sbjct  72   MGLDLD---QNFDNTDEEEGDSWKVYRDRIIEDCGTVLRLSGSEGELSSSLTISSMSNEA  128

Query  477  SQSDENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL------------------GS  590
             +S  N ++EE     IRNLDNGTEF+VD   QDG ++ L                  G 
Sbjct  129  PESSGNVAVEENHACTIRNLDNGTEFIVDSFRQDGMLNMLREVGSNRSFSFDEFERNIGQ  188

Query  591  SSLVQRLL  614
            S LVQ+L 
Sbjct  189  SPLVQQLF  196



>gb|EYU45248.1| hypothetical protein MIMGU_mgv1a002075mg [Erythranthe guttata]
Length=513

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 78/155 (50%), Gaps = 39/155 (25%)
 Frame = +3

Query  246  SLGYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGE  425
            +L YEFW +  +SV ERR + LKWMGL+  W      E ++   +  K  D +++    E
Sbjct  42   ALDYEFWTEEPDSVDERRDKFLKWMGLTSNWH-----EEDESSREDLKRDDVDQLRVLEE  96

Query  426  AMLANSDSED-HFFSGRSSQS----------------DENDSLEEKIRNLDNGTEF----  542
              LAN DSE+  FFS  S QS                DEN  L  KI+NLDNGTE+    
Sbjct  97   DPLANFDSEESEFFSTCSFQSFRSYESTNFLEDCSKFDEN--LMWKIKNLDNGTEYELAE  154

Query  543  -----MVDELGQDGTVS------RLGSSSLVQRLL  614
                 M+ ELG +  +S       LGSSSLVQ LL
Sbjct  155  EGCCTMLHELGSNKMISLDEFHKTLGSSSLVQHLL  189



>gb|EYU45249.1| hypothetical protein MIMGU_mgv1a002075mg [Erythranthe guttata]
Length=718

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 78/155 (50%), Gaps = 39/155 (25%)
 Frame = +3

Query  246  SLGYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGE  425
            +L YEFW +  +SV ERR + LKWMGL+  W     DE + E     K  D +++    E
Sbjct  42   ALDYEFWTEEPDSVDERRDKFLKWMGLTSNWH--EEDESSRE---DLKRDDVDQLRVLEE  96

Query  426  AMLANSDSED-HFFSGRSSQS----------------DENDSLEEKIRNLDNGTEF----  542
              LAN DSE+  FFS  S QS                DEN  L  KI+NLDNGTE+    
Sbjct  97   DPLANFDSEESEFFSTCSFQSFRSYESTNFLEDCSKFDEN--LMWKIKNLDNGTEYELAE  154

Query  543  -----MVDELGQDGTVS------RLGSSSLVQRLL  614
                 M+ ELG +  +S       LGSSSLVQ LL
Sbjct  155  EGCCTMLHELGSNKMISLDEFHKTLGSSSLVQHLL  189



>ref|XP_010694812.1| PREDICTED: WD repeat-containing protein 44-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010694873.1| PREDICTED: WD repeat-containing protein 44-like [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 97/204 (48%), Gaps = 59/204 (29%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCF------YTSSGSL--------GYEFWAKNLESVS  290
            MGS  E +E QFFD+ D I+ +SD        Y S   L        GYE W ++   +S
Sbjct  1    MGSLSEEDE-QFFDSKDSITPVSDSGSEGVENYDSDSRLAEDVVHNFGYEVWIQSPGIIS  59

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFK--AGDDNRISDNGEAMLANSDSEDHFF  464
            ERR +LLK MGL+P   V   +E + +   +F+    D  RI +N   +L +S     F 
Sbjct  60   ERRRKLLKLMGLAPNQVV---EEGDGDSSSRFEGEVVDRARILENSGTVLRSS-----FR  111

Query  465  SGRS-SQS-------DENDSLE--------EKIRNLDNGTEFMVDELGQDGTVSR-----  581
              RS SQS       D  DSL+         +IRNLD+G+EF+VDE+GQDG   +     
Sbjct  112  DVRSESQSSLSCCSNDTQDSLDVALEENLVRRIRNLDDGSEFIVDEVGQDGLFRKIRELR  171

Query  582  -------------LGSSSLVQRLL  614
                         LG S LVQR +
Sbjct  172  SNRSLRWEEFEKTLGLSPLVQRAM  195



>ref|XP_010100708.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXB83870.1| WD repeat-containing protein 44 [Morus notabilis]
Length=734

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 33/151 (22%)
 Frame = +3

Query  252  GYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAM  431
            GY+ W  +  S+ ERR + L+WMGLS     +    +    CD F+   D RI+ + +A+
Sbjct  48   GYDVWISDQMSIHERRDKFLRWMGLSERKMTIQHPGITS--CDGFEVETD-RITKSSDAV  104

Query  432  LANSDSED-HFFSGRSSQSDENDSLEE-----------KIRNLDNGTEFMVDELGQDGTV  575
            L +S +++    S  S     ND+ E            +IRNLD+GTEF+VDELGQDG  
Sbjct  105  LGSSSTDNVPSSSQFSMSCSSNDARELVDGTREESFSFRIRNLDDGTEFVVDELGQDGMP  164

Query  576  SR------------------LGSSSLVQRLL  614
             R                  LG S LVQRL+
Sbjct  165  RRLRKVGSSRLLTVEEFDRSLGMSPLVQRLM  195



>ref|XP_008437430.1| PREDICTED: uncharacterized protein LOC103482847 [Cucumis melo]
Length=743

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 86/188 (46%), Gaps = 46/188 (24%)
 Frame = +3

Query  180  DQFFDTGDEISSLSD----CFYTSSGSLG----------YEFWAKNLESVSERRTRLLKW  317
            ++F+DT +EISS+SD    C    S S G          Y  W +NLESV ERR +  KW
Sbjct  12   ERFYDTREEISSVSDWGSDCSENCSTSFGDDGDIPENLRYVGWIRNLESVYERRNKFFKW  71

Query  318  MGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAM-------LANSDSEDHFFSGRS  476
            MGL  +    N D  ++E  D ++   D  + D G  +         +S       S  +
Sbjct  72   MGLDLD---QNFDNTDEEEGDSWRVYRDRILEDCGTVLRLSGSEGELSSSLTISSMSNEA  128

Query  477  SQSDENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL------------------GS  590
             +S  N ++EE     IRNLDNGTEF+VD   QDG ++ L                  G 
Sbjct  129  PESSGNVAVEENHACTIRNLDNGTEFIVDSFSQDGMLNMLREVGSNRSFSFDEFERNIGQ  188

Query  591  SSLVQRLL  614
            S LVQ+L 
Sbjct  189  SPLVQQLF  196



>ref|XP_010106343.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXC52360.1| WD repeat-containing protein 44 [Morus notabilis]
Length=734

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 85/170 (50%), Gaps = 26/170 (15%)
 Frame = +3

Query  150  MMGS--CGERNEDQFFDTGDEISSLS--------DCFYTSSGSLGYEFWAKNLESVSERR  299
            MMGS    +  EDQF+D  +++SS+S        DC  + S  L YE WA+ L SV ERR
Sbjct  1    MMGSFILSDEREDQFYDAREDLSSVSEWDSDCSEDCKSSVSSRLRYEVWAEKLGSVMERR  60

Query  300  TRLLKWMGLS-PEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRS  476
             + L+WMGL   E  + N D+     CD+ +  D +R+ +N   +L  S  ++      S
Sbjct  61   RKFLRWMGLDLTEDFIANEDKRRGLSCDEIEL-DVDRVKENSGTVLRLSVFKEVISLSES  119

Query  477  SQSD----------ENDSLEE----KIRNLDNGTEFMVDELGQDGTVSRL  584
            S             EN +L+E    K+ N ++G EF+ +E G D  V RL
Sbjct  120  SSVSSSSNEASDSMENGALQENFSCKVGNSNDGPEFLKEEFGLDRMVGRL  169



>emb|CBI34556.3| unnamed protein product [Vitis vinifera]
Length=665

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 87/174 (50%), Gaps = 32/174 (18%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEIS-SLSDC---FYTSSG-------SLGYEFWAKNLESVSERR  299
            MGS  E   D+FFDT +E S S SD    F +S+G       S GY  W KN +SV+ERR
Sbjct  1    MGSSSEEEGDRFFDTREEFSDSASDGSVDFRSSNGVVDGDSDSFGYGLWIKNPQSVNERR  60

Query  300  TRLLKWMGLSPEWEVMNRDELN---------DECCDKFKAGDDNRISDNGEAMLANSDSE  452
             + LKWM L      M+++ +          D CCDK K   D R ++N  A+L NS SE
Sbjct  61   DKFLKWMNLD-----MDQNRITSEESESESGDVCCDKIKIETD-RATENSGAVLRNSVSE  114

Query  453  DHFFSGRSSQSDENDSLEEKIRNLDNGTEFMVDELGQDGTVSRLGSSSLVQRLL  614
            D   S + S S  ++  EE +  + +     ++E  +      +G S LVQ+ L
Sbjct  115  DRVSSIQCSMSFRSNG-EELLEGVGSNRVVSMEEFQRT-----IGLSPLVQQHL  162



>ref|XP_007160204.1| hypothetical protein PHAVU_002G301700g [Phaseolus vulgaris]
 gb|ESW32198.1| hypothetical protein PHAVU_002G301700g [Phaseolus vulgaris]
Length=719

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 85/158 (54%), Gaps = 19/158 (12%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSDCFYTSSGSLG-----------YEFWAKNLESVSERRTRLLK  314
            E  EDQF+DT +E+ S SD     S S             ++ W K+LESV++RR   L+
Sbjct  2    EGGEDQFYDTREELCSSSDGGSDCSESDESSSGINRHVTRHKVWVKDLESVNQRRLNFLR  61

Query  315  WMGLSPEWEVMNRDE-LNDECC--DKFKA--GDDNRISDNGEAMLANSDSEDHF--FSGR  473
            WM L  +     ++E   D+ C  D+  A  G   R S   E  L ++ ++      SG 
Sbjct  62   WMDLESDLNYSPKEEEFEDQPCGIDRITATSGAVLRTSLAVEEGLPSTSNQIVLDSLSGE  121

Query  474  SSQSDEN-DSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
            +  S EN ++L   IRNLD+GT+++VD+LGQDGT+S L
Sbjct  122  APGSRENRENLACMIRNLDDGTQYIVDKLGQDGTLSTL  159



>gb|KDP28461.1| hypothetical protein JCGZ_14232 [Jatropha curcas]
Length=747

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 88/178 (49%), Gaps = 31/178 (17%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFYTSSGSL--------------GYEFWAKNLESVS  290
            MGS    +ED FF+  ++ISS+SD       +L               YE W KNL+S+ 
Sbjct  1    MGSLSS-DEDLFFEAREDISSVSDSSPDCPENLESDHGVVVSSPSVFSYEVWIKNLDSIH  59

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSG  470
            ERR + LK MG + + E +  D +N  C  + +   D     +G  + ++S  +    S 
Sbjct  60   ERRNKFLKLMGFNVD-ETVAHDPVN-ACSQEGEVETDRMTEHSGSVLRSSSFDDRFSSSH  117

Query  471  RSSQSDENDSLEE-----------KIRNLDNGTEFMVDELGQD---GTVSRLGSSSLV  602
             S     +++LE            +IRNLDNG+EF+VDELGQD   G +  +GS+ L+
Sbjct  118  SSMSCWSSNTLELLDGALEENFECRIRNLDNGSEFIVDELGQDVMSGRIREVGSNRLL  175



>ref|XP_004300485.1| PREDICTED: WD repeat-containing protein 3 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465363.1| PREDICTED: WD repeat-containing protein 3 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465364.1| PREDICTED: WD repeat-containing protein 3 [Fragaria vesca subsp. 
vesca]
Length=746

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 85/167 (51%), Gaps = 26/167 (16%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-----CFYTSSGSLG---YEFWAKNLESVSERRTRL  308
            MGS  E  EDQF+DT +++SS+SD     C   S  +L    YE W+KN ESV ERR R 
Sbjct  1    MGSYSEECEDQFYDTREDLSSVSDWGADCCEDCSPIALVFSRYECWSKNPESVHERRHRF  60

Query  309  LKWMGLSPEWEVMNRDELNDE-CCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQS  485
            LKWMGL  +  +   +E +D    D+ + G D    D+G  +L +S  E+   S + + S
Sbjct  61   LKWMGLDIDRNLSMTEESDDGFFVDRSRTGIDRMKEDSG-VVLRSSGFEEGCCSNQCTLS  119

Query  486  --------------DENDSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
                          DEN   E   R L++  +F+VDEL  DG + + 
Sbjct  120  SLSSEVRVSLGNALDEN--FEFPTRKLNDRRDFVVDELRGDGILRKF  164



>ref|XP_004503569.1| PREDICTED: uncharacterized protein LOC101510067 [Cicer arietinum]
Length=706

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 89/173 (51%), Gaps = 39/173 (23%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD------------------CFYTSSGSLGYEFWAKNLESVSE  293
            E ++DQF+DT ++  S+SD                   F T      +  W KNLESV  
Sbjct  2    ELDDDQFYDTHEDFCSVSDKGSDYCSESCSSNNNYNNEFVTR-----FHVWTKNLESVHH  56

Query  294  RRTRLLKWMGLSPEWEVMNRDELNDEC---CDKF--KAGDDNRISDNGEAMLANSDSEDH  458
            RR   L+WMGL  + + +  DEL  +     D+F   +GD   +    E ++ +S S   
Sbjct  57   RRFNFLRWMGLEYDVDSIEGDELGGDSSGGVDRFFETSGD---VLGTIEGLVLDSLSN--  111

Query  459  FFSGRSSQS--DENDSLEEKIRNLDNGTEFMVDELGQDGTVSR---LGSSSLV  602
             ++ RS ++  D  + L   I+NLD+GT+++VD+L QDGT++    LGS+ L+
Sbjct  112  -YASRSLENCVDGTEDLACMIKNLDDGTQYVVDKLDQDGTLNTLRVLGSNQLI  163



>ref|XP_007039450.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
3 [Theobroma cacao]
 gb|EOY23951.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
3 [Theobroma cacao]
Length=678

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 82/174 (47%), Gaps = 31/174 (18%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFYTSSGSLG-----------------YEFWAKNLE  281
            MGS  E  EDQFFDT +EISS+SD     S   G                 Y+FW+   E
Sbjct  1    MGSYFEEEEDQFFDTREEISSVSDSSSVCSEECGSGPGFGLVNGFWDSFDQYKFWSMFPE  60

Query  282  SVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED--  455
            SV +RR R  KWMGLS +W  + +++      D+ + G D RIS +  A+L  S  ED  
Sbjct  61   SVDKRRHRFRKWMGLSLDWNSITKEDPGGSYSDEIELGID-RISQDSGAVLRTSGLEDGV  119

Query  456  ----HFFSGRSSQSDEN-------DSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
                 F S RS+ + E        D    + +NLD   E +  +  Q+GT S L
Sbjct  120  SSNRSFVSFRSNDAQEPAENCSKGDCFAHQAKNLDGHVELLAVDQVQNGTNSCL  173



>ref|XP_007039448.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY23949.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=750

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 82/174 (47%), Gaps = 31/174 (18%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFYTSSGSLG-----------------YEFWAKNLE  281
            MGS  E  EDQFFDT +EISS+SD     S   G                 Y+FW+   E
Sbjct  1    MGSYFEEEEDQFFDTREEISSVSDSSSVCSEECGSGPGFGLVNGFWDSFDQYKFWSMFPE  60

Query  282  SVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED--  455
            SV +RR R  KWMGLS +W  + +++      D+ + G D RIS +  A+L  S  ED  
Sbjct  61   SVDKRRHRFRKWMGLSLDWNSITKEDPGGSYSDEIELGID-RISQDSGAVLRTSGLEDGV  119

Query  456  ----HFFSGRSSQSDEN-------DSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
                 F S RS+ + E        D    + +NLD   E +  +  Q+GT S L
Sbjct  120  SSNRSFVSFRSNDAQEPAENCSKGDCFAHQAKNLDGHVELLAVDQVQNGTNSCL  173



>ref|XP_007039449.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY23950.1| Transducin/WD40 repeat-like superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=751

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 82/174 (47%), Gaps = 31/174 (18%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFYTSSGSLG-----------------YEFWAKNLE  281
            MGS  E  EDQFFDT +EISS+SD     S   G                 Y+FW+   E
Sbjct  1    MGSYFEEEEDQFFDTREEISSVSDSSSVCSEECGSGPGFGLVNGFWDSFDQYKFWSMFPE  60

Query  282  SVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED--  455
            SV +RR R  KWMGLS +W  + +++      D+ + G D RIS +  A+L  S  ED  
Sbjct  61   SVDKRRHRFRKWMGLSLDWNSITKEDPGGSYSDEIELGID-RISQDSGAVLRTSGLEDGV  119

Query  456  ----HFFSGRSSQSDEN-------DSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
                 F S RS+ + E        D    + +NLD   E +  +  Q+GT S L
Sbjct  120  SSNRSFVSFRSNDAQEPAENCSKGDCFAHQAKNLDGHVELLAVDQVQNGTNSCL  173



>ref|XP_010544856.1| PREDICTED: uncharacterized protein LOC104817380 [Tarenaya hassleriana]
 ref|XP_010544857.1| PREDICTED: uncharacterized protein LOC104817380 [Tarenaya hassleriana]
Length=707

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 86/172 (50%), Gaps = 46/172 (27%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFY-----------TSSGSLGYEFWAKNLESVSERR  299
            MGS  E  EDQFFDT ++I+S+SD              + S  LG++ W +N  S+ ERR
Sbjct  1    MGSLSE-EEDQFFDTREDITSVSDSGSEDLDLENEIRDSFSSVLGFDIWIRNPLSIHERR  59

Query  300  TRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDD---NRISDNGEAMLANSDSEDHFFSG  470
             + L  MGLS     ++  E  D        GD+   +R++D    +LA+S      FS 
Sbjct  60   NKFLNSMGLS-----LDGREEEDH-------GDNPSYDRMTDRSGTLLASS-----CFSE  102

Query  471  RSSQSDEN--------------DSLEEKIRNLDNGTEFMVDELGQDGTVSRL  584
            R S S  +              D+L  +I+NLD+GTEF+VD + QDG+  +L
Sbjct  103  RLSTSQSSLTSDSRESMDRAMEDNLVLRIKNLDDGTEFIVDGICQDGSFRKL  154



>gb|KEH21291.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=500

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 22/167 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD-----CFYTSSGS---------LGYEFWAKNLESVSERRTR  305
            E  EDQF+DT +++ S+SD     C  + SG            +  W  NL+SV  RR  
Sbjct  4    EVVEDQFYDTREDLCSVSDDGFDYCLESCSGGNIINNNEHVTRFNVWINNLDSVHRRRFN  63

Query  306  LLKWMGLSPEWEVMNRDEL-NDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS-  479
             L+WMGL  +   +  DE  +D  C   +       +  G    +N    D   +  SS 
Sbjct  64   FLRWMGLEYDENSVEGDEFGDDPSCGVDRISRTMFRTVEGFPSTSNQIVLDSLSNEASSL  123

Query  480  ---QSDENDSLEEKIRNLDNGTEFMVDELGQDG---TVSRLGSSSLV  602
               + D  ++L   I+NLD+GTE++VD+L Q+G   T+  LGS+ L+
Sbjct  124  LENRDDGTENLTCMIKNLDDGTEYVVDKLDQEGKLDTLRVLGSNQLI  170



>gb|KDP25243.1| hypothetical protein JCGZ_20399 [Jatropha curcas]
Length=742

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 75/153 (49%), Gaps = 42/153 (27%)
 Frame = +3

Query  255  YEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDD---NRISDNGE  425
            Y  W    ESV +RR+R LKWMGLS +   +++    +E CDKF    +   +R+ D G 
Sbjct  52   YNVWINTPESVHDRRSRFLKWMGLSLDQNTIDK----EESCDKFLTETELGVDRMIDTGG  107

Query  426  AMLANSDSEDHF------FSGRSSQSDEN------DSLEEKIRNLDNGTEFMVDELGQDG  569
            A+L  S  ED         S RS ++ E+      D+L  KIR+LD+ T     E+G++G
Sbjct  108  AVLRTSGFEDGLSRTQSQVSSRSIETRESVEGRVEDNLVCKIRDLDDRT-----EVGEEG  162

Query  570  TVSRL------------------GSSSLVQRLL  614
            T S L                  G+S L+QRLL
Sbjct  163  TRSGLLEVGSNRSLSFEEFQRGTGASPLIQRLL  195



>gb|KEH21290.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=714

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 81/167 (49%), Gaps = 22/167 (13%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSD-----CFYTSSGS---------LGYEFWAKNLESVSERRTR  305
            E  EDQF+DT +++ S+SD     C  + SG            +  W  NL+SV  RR  
Sbjct  4    EVVEDQFYDTREDLCSVSDDGFDYCLESCSGGNIINNNEHVTRFNVWINNLDSVHRRRFN  63

Query  306  LLKWMGLSPEWEVMNRDEL-NDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS-  479
             L+WMGL  +   +  DE  +D  C   +       +  G    +N    D   +  SS 
Sbjct  64   FLRWMGLEYDENSVEGDEFGDDPSCGVDRISRTMFRTVEGFPSTSNQIVLDSLSNEASSL  123

Query  480  ---QSDENDSLEEKIRNLDNGTEFMVDELGQDG---TVSRLGSSSLV  602
               + D  ++L   I+NLD+GTE++VD+L Q+G   T+  LGS+ L+
Sbjct  124  LENRDDGTENLTCMIKNLDDGTEYVVDKLDQEGKLDTLRVLGSNQLI  170



>emb|CAN69136.1| hypothetical protein VITISV_019124 [Vitis vinifera]
Length=717

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 58/113 (51%), Gaps = 28/113 (25%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDCFYTSSGS-------------------LGYEFWAKN  275
            MGS  E  EDQFFDT ++I+S+SD     SGS                    G E W KN
Sbjct  1    MGSLSEE-EDQFFDTREDITSVSD-----SGSDCQENLDSEWRNTDFVXXSFGCEVWIKN  54

Query  276  LESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAML  434
             ES+ ERRT+ LKWMGL  +  V    E+ +E       G+ +RI++N  A+L
Sbjct  55   PESIRERRTKFLKWMGLGVDHVV---REVPEELVSXELKGEIDRITENSGAVL  104



>ref|XP_002523310.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39026.1| conserved hypothetical protein [Ricinus communis]
Length=105

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 39/75 (52%), Gaps = 20/75 (27%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDC-----------------FYTSSGSLGYEFWAKNLE  281
            MGS     EDQFF+  ++I+SLSD                  F+   GS  YE W KNLE
Sbjct  1    MGSSSA-EEDQFFEAREDITSLSDSSSDGAEKLDSDDRGAVGFF--PGSFSYEVWTKNLE  57

Query  282  SVSERRTRLLKWMGL  326
            S  ERR + LKWMGL
Sbjct  58   SPRERRNKFLKWMGL  72



>ref|XP_008790515.1| PREDICTED: uncharacterized protein LOC103707703 [Phoenix dactylifera]
Length=755

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 70/137 (51%), Gaps = 28/137 (20%)
 Frame = +3

Query  255  YEFWAKNLESVSERRTRLLKWMGL----SPEWEVMNRDELNDECCDKFKAGDD-----NR  407
            Y+ W KN +S+ ERR R ++WMGL    SP  +  +  +       + K G +     +R
Sbjct  54   YQVWIKNPDSIQERRDRFMRWMGLDLVHSPRRDSADHGQ-------ELKVGSEVMPEVDR  106

Query  408  ISDNGEAMLANSDSE-------DHFFSGRSSQSD--ENDSLEEKIRNLDNGTEFMVDELG  560
            I+  G A+L  S SE            G S+  D    +  + +I+NLD+G  F+VDELG
Sbjct  107  ITLGGGAVLRCSGSEYESSSVPSWSSEGPSASHDGTSEEKSKYRIKNLDDGMMFVVDELG  166

Query  561  QDGTVSRL---GSSSLV  602
            +DG++  L   GS+ +V
Sbjct  167  KDGSLRSLREVGSNRIV  183



>ref|XP_009401778.1| PREDICTED: uncharacterized protein LOC103985710 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=759

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 82/173 (47%), Gaps = 39/173 (23%)
 Frame = +3

Query  150  MMGSC--GERNEDQFFDTGDEISSLSDCFYTSSG---SLG--------YEFWAKNLESVS  290
            M  SC   E  ED FFD+ +++SS+ D    S     SL         +EFW K+   V 
Sbjct  1    MAESCVFQEEEEDLFFDSREDVSSVFDSCPGSPAKNDSLPEEQFTGPQFEFWLKSPHGVR  60

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHF---  461
            ERR + ++WMG         +D +N  C     +G D ++  + + +   + S  +    
Sbjct  61   ERRDKFMRWMG---------KDLMN--CSLPSSSGLDGQVQIDDDILPGTNRSTSNCCDA  109

Query  462  --------FSGRSSQSDENDSLEEK----IRNLDNGTEFMVDELGQDGTVSRL  584
                    +S + + +  N++LEEK    I+NLD+G    VDELG+DG++  L
Sbjct  110  GNKCPMCSWSSQDASTSCNEALEEKMVYRIKNLDDGAVITVDELGKDGSLRSL  162



>ref|XP_010053091.1| PREDICTED: WD repeat-containing protein 44-like [Eucalyptus grandis]
 gb|KCW77336.1| hypothetical protein EUGRSUZ_D01697 [Eucalyptus grandis]
Length=747

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 79/171 (46%), Gaps = 28/171 (16%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-------CFYTSSG-------SLGYEFWAKNLESVS  290
            MG+ GE +EDQ+FD  +E SS+SD       C  + SG       SLG+EFW K  ESV 
Sbjct  1    MGNYGEEDEDQYFDALEETSSVSDRGSNCSDCCSSGSGLDENVLDSLGFEFWTKFPESVR  60

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSG  470
             RR R L   GL  E   +++++     C++ +        D+G A+  + DS +     
Sbjct  61   ARRNRFLMLTGLEIEANSVDKEDAFPLSCNEIEVYTCKVTRDDG-AVQRSLDSYNCISLL  119

Query  471  RSSQSDENDSLEEKIRN-------------LDNGTEFMVDELGQDGTVSRL  584
             SS S +++   E +R               D+ TEF+VD   Q     RL
Sbjct  120  PSSTSIQSNQEVESLRGGLLLSSFRGRSKESDDLTEFVVDGFVQSQREMRL  170



>ref|XP_009401780.1| PREDICTED: uncharacterized protein LOC103985710 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=755

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 79/165 (48%), Gaps = 37/165 (22%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSDCFYTSSG---SLG--------YEFWAKNLESVSERRTRLLK  314
            E  ED FFD+ +++SS+ D    S     SL         +EFW K+   V ERR + ++
Sbjct  5    EEEEDLFFDSREDVSSVFDSCPGSPAKNDSLPEEQFTGPQFEFWLKSPHGVRERRDKFMR  64

Query  315  WMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHF-----------  461
            WMG         +D +N  C     +G D ++  + + +   + S  +            
Sbjct  65   WMG---------KDLMN--CSLPSSSGLDGQVQIDDDILPGTNRSTSNCCDAGNKCPMCS  113

Query  462  FSGRSSQSDENDSLEEK----IRNLDNGTEFMVDELGQDGTVSRL  584
            +S + + +  N++LEEK    I+NLD+G    VDELG+DG++  L
Sbjct  114  WSSQDASTSCNEALEEKMVYRIKNLDDGAVITVDELGKDGSLRSL  158



>gb|KDO76655.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
 gb|KDO76656.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
Length=531

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 16/127 (13%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLGY-----------EFWAKNLES  284
            M G   E  E+QFFDT +EIS +SD    C    S S+ +           E W    +S
Sbjct  1    MAGVSNEEEEEQFFDTCEEISYVSDRDSDCSEGCSSSVEHLADSVLCYSQSEIWTGYPQS  60

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            V+ERR++ LK MG   +  +MN ++L DE   + +  D +RI++N  A+L  S   D   
Sbjct  61   VNERRSKFLKLMGFILDQSLMNAEDLEDESRVRTQL-DVDRITENSGAVLRTSGFGDDIH  119

Query  465  SGRSSQS  485
              +SS S
Sbjct  120  FSQSSIS  126



>gb|KDO76657.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
 gb|KDO76658.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
Length=519

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 16/127 (13%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLGY-----------EFWAKNLES  284
            M G   E  E+QFFDT +EIS +SD    C    S S+ +           E W    +S
Sbjct  1    MAGVSNEEEEEQFFDTCEEISYVSDRDSDCSEGCSSSVEHLADSVLCYSQSEIWTGYPQS  60

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            V+ERR++ LK MG   +  +MN ++L DE   + +  D +RI++N  A+L  S   D   
Sbjct  61   VNERRSKFLKLMGFILDQSLMNAEDLEDESRVRTQL-DVDRITENSGAVLRTSGFGDDIH  119

Query  465  SGRSSQS  485
              +SS S
Sbjct  120  FSQSSIS  126



>gb|KDO76659.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
Length=493

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 64/127 (50%), Gaps = 16/127 (13%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLGY-----------EFWAKNLES  284
            M G   E  E+QFFDT +EIS +SD    C    S S+ +           E W    +S
Sbjct  1    MAGVSNEEEEEQFFDTCEEISYVSDRDSDCSEGCSSSVEHLADSVLCYSQSEIWTGYPQS  60

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFF  464
            V+ERR++ LK MG   +  +MN ++L DE   + +  D +RI++N  A+L  S   D   
Sbjct  61   VNERRSKFLKLMGFILDQSLMNAEDLEDESRVRTQL-DVDRITENSGAVLRTSGFGDDIH  119

Query  465  SGRSSQS  485
              +SS S
Sbjct  120  FSQSSIS  126



>ref|XP_009379832.1| PREDICTED: 2-deoxy-glucose resistant protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379833.1| PREDICTED: 2-deoxy-glucose resistant protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=704

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 78/161 (48%), Gaps = 18/161 (11%)
 Frame = +3

Query  168  ERNEDQFFDTGDEISSLSDC------FYTSS----GSLGYEFWAKNLESVSERRTRLLKW  317
            ++ ED FFD  DEI +  D       F  S      +L YE W +   SV +RR R  + 
Sbjct  5    DKGEDNFFDAYDEIRTSIDSSSSENSFVASQELELRTLEYELWTREPMSVQDRRKRFFRG  64

Query  318  MG---LSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQSD  488
            MG   ++P   V + D +    C +    D +    + E ++ +S    +  S    ++ 
Sbjct  65   MGFDEIAPSPIVCSVDSVGCSMCTEESTVDLSVNQRDMERIMESSGPVSNGMSSPDVEAS  124

Query  489  ENDSLEEKIRNLDNGTEFMVDELGQDG---TVSRLGSSSLV  602
            E DSL   IR+LD+G +F+V ELGQDG   T+  +GS  L+
Sbjct  125  E-DSLC-CIRDLDSGRKFVVHELGQDGLPSTLKEVGSGKLI  163



>ref|XP_006476326.1| PREDICTED: WD repeat-containing protein YMR102C-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476327.1| PREDICTED: WD repeat-containing protein YMR102C-like isoform 
X2 [Citrus sinensis]
Length=756

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 72/146 (49%), Gaps = 23/146 (16%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLGY-----------EFWAKNLES  284
            M G   E  E+QFFDT +EIS +SD    C    S S+ +           E W    +S
Sbjct  1    MAGVSNEEEEEQFFDTCEEISYVSDRDSDCSEGCSSSVEHLADSVLCYSQSEIWTGYPQS  60

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED--H  458
            V+ERR++ LK MG   +  +MN ++L DE   + +  D +RI++N  A+L  S   D  H
Sbjct  61   VNERRSKFLKLMGFILDQSLMNAEDLEDESRVRTQL-DVDRITENSGAVLRTSGFGDDIH  119

Query  459  FFSGRSSQSDENDSLEEKIRNLDNGT  536
            F     SQS  +  L E    L++ T
Sbjct  120  F-----SQSSISSKLCEAPEVLEHFT  140



>gb|KDO76652.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
 gb|KDO76653.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
 gb|KDO76654.1| hypothetical protein CISIN_1g004410mg [Citrus sinensis]
Length=755

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 72/146 (49%), Gaps = 23/146 (16%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSD----CFYTSSGSLGY-----------EFWAKNLES  284
            M G   E  E+QFFDT +EIS +SD    C    S S+ +           E W    +S
Sbjct  1    MAGVSNEEEEEQFFDTCEEISYVSDRDSDCSEGCSSSVEHLADSVLCYSQSEIWTGYPQS  60

Query  285  VSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSED--H  458
            V+ERR++ LK MG   +  +MN ++L DE   + +  D +RI++N  A+L  S   D  H
Sbjct  61   VNERRSKFLKLMGFILDQSLMNAEDLEDESRVRTQL-DVDRITENSGAVLRTSGFGDDIH  119

Query  459  FFSGRSSQSDENDSLEEKIRNLDNGT  536
            F     SQS  +  L E    L++ T
Sbjct  120  F-----SQSSISSKLCEAPEVLEHFT  140



>ref|XP_011084533.1| PREDICTED: WD repeat-containing protein 44 [Sesamum indicum]
Length=698

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +3

Query  177  EDQFFDTGDEISSLSDCFYTSSGSLGYEFWAKNLESVSERRTRLLKWMGLSP-EWEVMNR  353
            E QFFD  + I+   D   +SS + GY+ W    +SV ERR + + WMGLSP E+   N 
Sbjct  10   ESQFFDAQEYIAQEPDNGCSSSRNWGYDVWTHAPQSVRERRRKFIGWMGLSPGEFGGENS  69

Query  354  DELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHF  461
             ++       F  G  +RI ++  A+L  S  ED F
Sbjct  70   VDMCGSSEGCFSMGYFHRIMEDNGAVLRTSSVEDEF  105



>ref|XP_009119955.1| PREDICTED: WD repeat-containing protein 44 [Brassica rapa]
Length=810

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 63/146 (43%), Gaps = 35/146 (24%)
 Frame = +3

Query  252  GYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRIS-DNGEA  428
            G+E W    ESV+ERR RLL+ +GLS E ++  +      C   F     + +S  N   
Sbjct  66   GFELWKSEPESVTERRIRLLRGLGLSDEPDLRFKSRRKGICSSHFARSVSSDVSFSNHRG  125

Query  429  MLANSDS-------------EDHF----------FSGRSSQSDENDSLEEK---------  512
               N DS              DH           F   S +  E D +E++         
Sbjct  126  QCENVDSGKLRQYTGSVNKLNDHHKPRNDGNNVPFGFISKEPIETDIVEKQRLNGRDVQM  185

Query  513  --IRNLDNGTEFMVDELGQDGTVSRL  584
              IRNLDNG EF+V+E+ +DG + +L
Sbjct  186  CTIRNLDNGKEFVVNEVREDGVLEKL  211



>ref|XP_011075952.1| PREDICTED: WD repeat-containing protein 44 [Sesamum indicum]
Length=706

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 3/96 (3%)
 Frame = +3

Query  177  EDQFFDTGDEISSLSDCFYTSSGSLGYEFWAKNLESVSERRTRLLKWMGLSPE-WEVMNR  353
            E +F D  + I+   D    S+ +  Y+ W    +SV ERR + ++WMGLSP+  E  N 
Sbjct  10   ESRFIDVPEHIAPDPD--LVSATNWDYDVWISTPQSVRERRRKFIRWMGLSPDRLEGENS  67

Query  354  DELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHF  461
                D   D    GD +RI +N  A+L+ S  ED F
Sbjct  68   VYPCDNVEDGIFIGDIDRIMENNGAVLSTSSIEDDF  103



>ref|XP_002271917.2| PREDICTED: WD repeat-containing protein YMR102C [Vitis vinifera]
Length=732

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 82/171 (48%), Gaps = 32/171 (19%)
 Frame = +3

Query  150  MMGSCGERNED---QFFDTGDEISS---------LSDCFYTSSG-------SLGYEFWAK  272
            MM S  E NED   Q+FD  D++ +          +D   +SSG       +  Y+ WA 
Sbjct  1    MMSSLSE-NEDEQYQYFDAHDDMDAASLSDSSSDCNDNPNSSSGFNNYASRAFQYDVWAG  59

Query  273  NLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSE  452
            +  SV ERR + L WMGLS   +  + D   D C D    G D R+ ++  A+L     E
Sbjct  60   SPGSVKERRNKFLNWMGLS--LDRFSCDNSVDVCSDSLGGGVD-RVRESSGAVLRTLGFE  116

Query  453  DHF---FSGRSSQSDEND--SLEEK----IRNLDNGTEFMVDELGQDGTVS  578
            D F    S  S  S+E D   L+EK    I NLD G EF VDE+G+   VS
Sbjct  117  DEFCSSRSSMSRWSNEQDESGLQEKFVCRIGNLDVGAEFDVDEMGEGSEVS  167



>ref|XP_008234700.1| PREDICTED: uncharacterized protein LOC103333609 [Prunus mume]
Length=738

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 79/183 (43%), Gaps = 42/183 (23%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-------CFYTSSG-------SLGYEFWAKNLESVS  290
            MGS  E  E  FFD  ++I+S SD        F ++S        SL YE W ++  SV 
Sbjct  1    MGSFSEE-EYGFFDAQEDIASTSDASSDNIEVFDSTSSFINWVPPSLPYEVWVQSPGSVK  59

Query  291  ERRTRLLKWMGLSPEWEVMNR------------DELNDECCDKFK--AGDDNRISDNGEA  428
            ERR + L+WMGLS +  V               + + +   D F    G+  RI +   A
Sbjct  60   ERRVKFLEWMGLSSDQIVRETSLDIFSDVPGEVERIRETSLDIFSDVPGEVERIRETSGA  119

Query  429  MLANSDSEDHFFSGRSSQS-----DENDSLE------EKIRNLDNGT--EFMVDELGQDG  569
            +L  S  ED F   RSS S       N S+E         R  + G   E   DELGQDG
Sbjct  120  VLRTSRFEDEFCFSRSSMSCWRNGYSNSSIELGSKDNSACRGGNPGMILECNADELGQDG  179

Query  570  TVS  578
             VS
Sbjct  180  KVS  182



>ref|XP_007220614.1| hypothetical protein PRUPE_ppa002072mg [Prunus persica]
 gb|EMJ21813.1| hypothetical protein PRUPE_ppa002072mg [Prunus persica]
Length=720

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 77/169 (46%), Gaps = 32/169 (19%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSD-------CFYTSSG-------SLGYEFWAKNLESVS  290
            MGS  E  E  FFD  ++I+S SD        F ++S        S  YE W ++  SV 
Sbjct  1    MGSFSEE-EYGFFDAQEDIASTSDASSDNIEVFDSTSSFINWVPPSFPYEVWVQSPGSVK  59

Query  291  ERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSG  470
            ERR + L+WMGLS +  V  R+   D   D    G+  RI +   A+L  S  ED F   
Sbjct  60   ERRVKFLEWMGLSSDQIV--RETSLDISSD--VPGEVERIQETSGAVLRTSRFEDEFCFS  115

Query  471  RSSQS-----DENDSLE------EKIRNLDNGT--EFMVDELGQDGTVS  578
            +SS S       N S+E         R  + G   E   DELGQDG VS
Sbjct  116  QSSMSCWRNGYSNSSIELGSKDNSACRGGNPGMILECNADELGQDGKVS  164



>emb|CDY43837.1| BnaC03g14700D [Brassica napus]
Length=1176

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (50%), Gaps = 32/135 (24%)
 Frame = +3

Query  252  GYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDEL----------------NDECCDK  383
            G++ W    ESVSERR RLL+ +GLS E ++     L                + +C   
Sbjct  66   GFDLWKSEPESVSERRIRLLRGLGLSNEPDLAPASRLRRRKGIRSSHFARSSHHGKCVSS  125

Query  384  FKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQSDENDS-----LEEK---IRNLDNGTE  539
             ++  D  + D+G+   + +D        RS+   E ++     LEEK   I+NLDNG E
Sbjct  126  LRS--DVVVVDHGKPRCSLNDHH------RSNDPIETNNGRDVVLEEKMCTIKNLDNGKE  177

Query  540  FMVDELGQDGTVSRL  584
            F+V+E+ +DG + +L
Sbjct  178  FVVNEVREDGVLEKL  192



>ref|XP_010109232.1| WD repeat-containing protein 44 [Morus notabilis]
 gb|EXC21412.1| WD repeat-containing protein 44 [Morus notabilis]
Length=708

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 58/112 (52%), Gaps = 14/112 (13%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDC---FYTSSGSLGYEFWAKNLESVSERRTRLLKWMG  323
            MGS  E  E+ FFD  ++I+S+SD     + S+    Y+ W ++  SV ERR+  LKW G
Sbjct  1    MGSLSEDEENGFFDAQEDIASISDANSDTFDSNSRFDYDVWIRSPRSVKERRSNFLKWTG  60

Query  324  LSPEWEVMNRDELNDECCDKFKAGDDNRIS-DNGEAMLANSDSEDHFFSGRS  476
            L    ++M      D C +     +  R+  DN  A+L +S  E  F+S RS
Sbjct  61   LDSNQDLM------DSCMEI----EVVRVREDNSGAVLRSSGFESEFYSSRS  102



>emb|CBI23039.3| unnamed protein product [Vitis vinifera]
Length=674

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 59/115 (51%), Gaps = 15/115 (13%)
 Frame = +3

Query  150  MMGSCGERNED---QFFDTGDEI--SSLSDCFYTSSGSLGYEFWAKNLESVSERRTRLLK  314
            MM S  E NED   Q+FD  D++  +SLSD       +  Y+ WA +  SV ERR + L 
Sbjct  1    MMSSLSE-NEDEQYQYFDAHDDMDAASLSD------STFQYDVWAGSPGSVKERRNKFLN  53

Query  315  WMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSS  479
            WMGLS   +  + D   D C D    G D R+ ++  A+L     ED F S RSS
Sbjct  54   WMGLS--LDRFSCDNSVDVCSDSLGGGVD-RVRESSGAVLRTLGFEDEFCSSRSS  105



>emb|CBI40579.3| unnamed protein product [Vitis vinifera]
Length=617

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 57/96 (59%), Gaps = 14/96 (15%)
 Frame = +3

Query  150  MMGSCGERNEDQFFDTGDEISSLSDCFYTSSGSLGYEFWAKNLES-VSERRTRLLKWMGL  326
            MMGS  E  EDQFFDT ++I+S+SD     SGS   E    NL+S + ERRT+ LKWMGL
Sbjct  1    MMGSLSE-EEDQFFDTREDITSVSD-----SGSDCQE----NLDSDIRERRTKFLKWMGL  50

Query  327  SPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAML  434
              +  V    E+ +E       G+ +RI++N  A+L
Sbjct  51   GVDHVV---REVPEELVSGELKGEIDRITENSGAVL  83



>gb|KDP23830.1| hypothetical protein JCGZ_00073 [Jatropha curcas]
Length=712

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 67/147 (46%), Gaps = 19/147 (13%)
 Frame = +3

Query  177  EDQFFDTGDEISSLSD------------CFYTSS--GSLGYEFWAKNLESVSERRTRLLK  314
            E +FFD  ++I+S+SD            C   +S   S  YE W ++  SV ERR++ L 
Sbjct  8    ESRFFDAHEDIASISDKNSDIIETPNSPCSPDNSIPNSPLYEIWIRSPRSVEERRSKFLN  67

Query  315  WMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFSGRSSQSDEN  494
            WMG+      +++             G+ +RI ++  A+L  S  ED F S RS+ S  +
Sbjct  68   WMGIG-----LDQSANESSVAVSSMEGEIDRIRESSGAVLRKSAFEDEFCSTRSTMSCWS  122

Query  495  DSLEEKIRNLDNGTEFMVDELGQDGTV  575
            +     +  LD    F+  E   DG +
Sbjct  123  NDSSSLLEELDLRANFLCREGASDGVM  149



>ref|XP_011044680.1| PREDICTED: WD repeat-containing protein 44 [Populus euphratica]
Length=720

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 79/167 (47%), Gaps = 36/167 (22%)
 Frame = +3

Query  153  MGSCGERNEDQFFDTGDEISSLSDC------FYTSSGSL--------GYEFWAKNLESVS  290
            MGS  E  E +FFD  ++I+S+SD        + S  S          YE W K+  SV 
Sbjct  1    MGSLSEE-EYRFFDAYEDIASISDAKSDSNEIFDSHSSFDNSITRSPPYELWMKSPGSVQ  59

Query  291  ERRTRLLKWMGLSPEWE-VMNRDELNDECCDKFKAGDDNRISDNGEAMLANSDSEDHFFS  467
            ERR++   WMG+  +     N +E + E       G+ +RI ++   +L NS  ED F S
Sbjct  60   ERRSKFFDWMGVDVDQNGYSNLEEFSLE-------GESDRIRESSGTVLRNSCFEDDFCS  112

Query  468  GRSSQS----------DENDSLEEKI-RNLDNGTEFM--VDELGQDG  569
             RS  S           E  S+E  + R+  +G+  M  VDELGQDG
Sbjct  113  TRSMMSCWSNGGSNLLAELGSVENFVCRDGVSGSGMMCNVDELGQDG  159



>ref|XP_010933843.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Elaeis 
guineensis]
Length=788

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 65/124 (52%), Gaps = 17/124 (14%)
 Frame = +3

Query  255  YEFWAKNLESVSERRTRLLKWMGLSPEWEVMNR-----DELNDECCDKFKAGDDNRISDN  419
            Y+ W +N +S+ ERR R ++WMGL P   V N      D   +   D     + +RI  +
Sbjct  87   YQVWVQNPDSIQERRDRFMRWMGLDP---VHNPRRDSADHGRELKMDGEVMPEIDRIMLD  143

Query  420  GEAMLANSDSEDHFFSGR------SSQSDENDSLEE---KIRNLDNGTEFMVDELGQDGT  572
            G A+L +S SE    S        +S SD+  S E+   +++NLD+G  F+ DELG+DG+
Sbjct  144  GGAVLRSSASEYGSSSASSRYSEGASTSDDGASEEKSRYRVKNLDDGMMFVADELGKDGS  203

Query  573  VSRL  584
               L
Sbjct  204  FRSL  207



>ref|XP_010933844.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Elaeis 
guineensis]
Length=755

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 65/124 (52%), Gaps = 17/124 (14%)
 Frame = +3

Query  255  YEFWAKNLESVSERRTRLLKWMGLSPEWEVMNR-----DELNDECCDKFKAGDDNRISDN  419
            Y+ W +N +S+ ERR R ++WMGL P   V N      D   +   D     + +RI  +
Sbjct  54   YQVWVQNPDSIQERRDRFMRWMGLDP---VHNPRRDSADHGRELKMDGEVMPEIDRIMLD  110

Query  420  GEAMLANSDSEDHFFSGR------SSQSDENDSLEE---KIRNLDNGTEFMVDELGQDGT  572
            G A+L +S SE    S        +S SD+  S E+   +++NLD+G  F+ DELG+DG+
Sbjct  111  GGAVLRSSASEYGSSSASSRYSEGASTSDDGASEEKSRYRVKNLDDGMMFVADELGKDGS  170

Query  573  VSRL  584
               L
Sbjct  171  FRSL  174



>ref|XP_002866029.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42288.1| WD-40 repeat family protein [Arabidopsis lyrata subsp. lyrata]
Length=830

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 69/153 (45%), Gaps = 39/153 (25%)
 Frame = +3

Query  243  GSLGYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFK-----AGDDNR  407
            GS G+E W    ESV ERR RLL+ +GLS E ++    +L                 D  
Sbjct  78   GSSGFELWKSEPESVKERRIRLLRGLGLSNEPDLPPVSQLRSRSRRNSSHFARSVSSDVL  137

Query  408  ISD-NGEAML----ANSDSEDHFFSGRSSQSDEND-------------------------  497
            IS+ +G+ +L    A SD+ D  ++G   ++D  D                         
Sbjct  138  ISNHHGKCVLRSDVAGSDNVDREYTGSRMRNDGVDFISKEPMVRSLRDIVEKESYGNGRD  197

Query  498  -SLEEK---IRNLDNGTEFMVDELGQDGTVSRL  584
              LEE+   IRNLD G EF+V+E+ +DG + RL
Sbjct  198  VVLEEQMCTIRNLDTGREFVVNEVREDGMLERL  230



>ref|XP_009132448.1| PREDICTED: WD repeat-containing protein 44-like [Brassica rapa]
Length=787

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 62/127 (49%), Gaps = 18/127 (14%)
 Frame = +3

Query  252  GYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAM  431
            G++ W    ESVSERR RLL+ +GLS E ++     L        ++    R S NG  +
Sbjct  69   GFDLWKSEPESVSERRIRLLRGLGLSNEPDLAPSSRLRRR--KGIRSSHFARSSHNGRCV  126

Query  432  LA-NSDSEDHFFSGRSSQSDENDSL------------EEK---IRNLDNGTEFMVDELGQ  563
             +  SD        R S +D N  L            EE+   I+NLDNG EF+V+E+ +
Sbjct  127  SSLRSDVVVDNSKLRCSLNDNNVVLDFISKDPIDVVMEEQMCTIKNLDNGREFVVNEVRE  186

Query  564  DGTVSRL  584
            DG + +L
Sbjct  187  DGVLEKL  193



>ref|XP_009397845.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397846.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397847.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397848.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397849.1| PREDICTED: uncharacterized protein LOC103982598 [Musa acuminata 
subsp. malaccensis]
Length=739

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 72/146 (49%), Gaps = 31/146 (21%)
 Frame = +3

Query  255  YEFWAKNLESVSERRTRLLKW-----MGLSPEWEVMNRDELNDECCDKFKAGDDN--RIS  413
            +E W K+  SV ERR + +K      M   P+      +E+N +   K +A  D     S
Sbjct  53   FEVWIKDPVSVRERRDKFMKMFCADMMNCPPQGSDNPDEEVNVD--GKIQADADGVESCS  110

Query  414  DNGEAM-LANSDSEDHFFSGRSSQSDENDSLEEKIRNLDNGTEFMVDELGQDGTVSRL--  584
             +G  + ++   SED   +  S     ++SL  +I+NLD+GT F+V+ELG+DG++  L  
Sbjct  111  CSGNKLSVSTWSSED---TSTSCDETSDESLVSRIKNLDDGTVFVVNELGKDGSLKSLRE  167

Query  585  ----------------GSSSLVQRLL  614
                            GSSSL+QRL+
Sbjct  168  VGSDRTLTLHEFERIFGSSSLIQRLM  193



>emb|CDY43049.1| BnaA03g11960D [Brassica napus]
Length=742

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 63/127 (50%), Gaps = 18/127 (14%)
 Frame = +3

Query  252  GYEFWAKNLESVSERRTRLLKWMGLSPEWEVMNRDELNDECCDKFKAGDDNRISDNGEAM  431
            G++ W    ESVSERR RLL+ +GLS E ++     L        ++    R S NG  +
Sbjct  48   GFDLWKSEPESVSERRIRLLRGLGLSNEPDLAPASRLRRR--KGIRSSHFARSSHNGRCV  105

Query  432  -------------LANSDSEDHFFSGRSSQSDENDSLEEK---IRNLDNGTEFMVDELGQ  563
                         L  S ++++      S+   +  LEE+   I+NLDNG EF+V+E+ +
Sbjct  106  SSLRSDVVVDNSKLRCSLNDNNVVLDFISKDPIDVVLEEQMCTIKNLDNGREFVVNEVRE  165

Query  564  DGTVSRL  584
            DG + +L
Sbjct  166  DGVLEKL  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090