BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033I08

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598660.1|  PREDICTED: FAD synthase-like                       301   5e-96   Nicotiana tomentosiformis
ref|XP_009760625.1|  PREDICTED: FAD synthase-like                       300   2e-95   Nicotiana sylvestris
ref|XP_006354376.1|  PREDICTED: uncharacterized protein LOC102579...    298   6e-95   Solanum tuberosum [potatoes]
ref|XP_002269812.1|  PREDICTED: FAD synthase                            298   1e-94   Vitis vinifera
ref|XP_004246616.1|  PREDICTED: FAD synthase                            296   4e-94   Solanum lycopersicum
ref|XP_006339085.1|  PREDICTED: uncharacterized protein LOC102587...    294   4e-93   Solanum tuberosum [potatoes]
ref|XP_004249480.1|  PREDICTED: FAD synthase-like                       293   6e-93   Solanum lycopersicum
emb|CDP06784.1|  unnamed protein product                                291   3e-92   Coffea canephora [robusta coffee]
ref|XP_009596064.1|  PREDICTED: FAD synthase-like                       290   2e-91   Nicotiana tomentosiformis
gb|KDO51696.1|  hypothetical protein CISIN_1g030189mg                   277   5e-91   Citrus sinensis [apfelsine]
ref|XP_009795878.1|  PREDICTED: FAD synthase-like                       288   6e-91   Nicotiana sylvestris
dbj|BAF00583.1|  hypothetical protein                                   283   5e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018779.1|  PREDICTED: FAD synthase isoform X2                 283   1e-89   Populus euphratica
gb|KDP30682.1|  hypothetical protein JCGZ_15557                         285   1e-89   Jatropha curcas
ref|XP_010558181.1|  PREDICTED: FAD synthase isoform X1                 283   4e-89   
ref|XP_011018772.1|  PREDICTED: FAD synthase isoform X1                 283   5e-89   Populus euphratica
ref|XP_010553000.1|  PREDICTED: FAD synthase-like                       283   5e-89   Tarenaya hassleriana [spider flower]
gb|AAK62461.1|AF387016_1  putative protein                              283   5e-89   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568117.1|  phosphoadenosine phosphosulfate (PAPS) reductas...    283   5e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010558183.1|  PREDICTED: FAD synthase isoform X3                 283   5e-89   
gb|ACJ85260.1|  unknown                                                 276   6e-89   Medicago truncatula
ref|XP_006287585.1|  hypothetical protein CARUB_v10000795mg             283   7e-89   Capsella rubella
ref|XP_002873090.1|  phosphoadenosine phosphosulfate reductase fa...    282   7e-89   
gb|KJB62376.1|  hypothetical protein B456_009G414300                    280   9e-89   Gossypium raimondii
gb|EYU38565.1|  hypothetical protein MIMGU_mgv1a004967mg                282   9e-89   Erythranthe guttata [common monkey flower]
ref|XP_008387538.1|  PREDICTED: FAD synthase                            283   1e-88   
ref|XP_011077314.1|  PREDICTED: FAD synthase isoform X2                 282   1e-88   Sesamum indicum [beniseed]
ref|XP_010490820.1|  PREDICTED: FAD synthase-like isoform X2            281   1e-88   Camelina sativa [gold-of-pleasure]
gb|KJB62375.1|  hypothetical protein B456_009G414300                    280   2e-88   Gossypium raimondii
ref|XP_011077312.1|  PREDICTED: FAD synthase isoform X1                 281   2e-88   Sesamum indicum [beniseed]
ref|XP_002519482.1|  molybdopterin-binding, putative                    281   3e-88   
ref|XP_010490819.1|  PREDICTED: FAD synthase-like isoform X1            280   5e-88   Camelina sativa [gold-of-pleasure]
ref|XP_007027436.1|  Phosphoadenosine phosphosulfate (PAPS) reduc...    280   6e-88   
ref|XP_006398792.1|  hypothetical protein EUTSA_v10013303mg             280   7e-88   Eutrema salsugineum [saltwater cress]
ref|XP_009362100.1|  PREDICTED: FAD synthase-like                       280   8e-88   Pyrus x bretschneideri [bai li]
gb|KJB62378.1|  hypothetical protein B456_009G414300                    280   8e-88   Gossypium raimondii
gb|KJB62379.1|  hypothetical protein B456_009G414300                    279   9e-88   Gossypium raimondii
gb|KJB62374.1|  hypothetical protein B456_009G414300                    280   1e-87   Gossypium raimondii
gb|AFK39867.1|  unknown                                                 277   1e-87   Medicago truncatula
ref|XP_010423717.1|  PREDICTED: FAD synthase-like isoform X1            280   1e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010243269.1|  PREDICTED: probable FAD synthase                   273   1e-87   Nelumbo nucifera [Indian lotus]
ref|XP_008241395.1|  PREDICTED: FAD synthase                            280   1e-87   Prunus mume [ume]
ref|XP_007204563.1|  hypothetical protein PRUPE_ppa004416mg             280   2e-87   Prunus persica
ref|XP_006428353.1|  hypothetical protein CICLE_v10011527mg             279   2e-87   
ref|XP_006491700.1|  PREDICTED: uncharacterized protein LOC102612...    280   2e-87   
ref|XP_006491694.1|  PREDICTED: uncharacterized protein LOC102612...    279   2e-87   
ref|XP_003554393.1|  PREDICTED: uncharacterized protein LOC100816619    278   3e-87   Glycine max [soybeans]
ref|XP_003625689.1|  FAD synthetase                                     277   9e-87   Medicago truncatula
ref|XP_009377023.1|  PREDICTED: FAD synthase-like                       278   9e-87   Pyrus x bretschneideri [bai li]
ref|XP_003521410.1|  PREDICTED: uncharacterized protein LOC100795114    277   1e-86   Glycine max [soybeans]
emb|CDY04882.1|  BnaAnng00640D                                          276   2e-86   
ref|XP_009125503.1|  PREDICTED: FAD synthase-like                       276   2e-86   Brassica rapa
ref|XP_010684031.1|  PREDICTED: FAD synthase                            277   2e-86   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011468136.1|  PREDICTED: FAD synthase                            276   4e-86   Fragaria vesca subsp. vesca
ref|XP_009122699.1|  PREDICTED: FAD synthase-like isoform X2            275   4e-86   Brassica rapa
ref|XP_004494068.1|  PREDICTED: uncharacterized protein LOC101502...    275   5e-86   
ref|XP_004494067.1|  PREDICTED: uncharacterized protein LOC101502...    276   6e-86   
ref|XP_008369548.1|  PREDICTED: FAD synthase-like                       275   6e-86   Malus domestica [apple tree]
emb|CDY10380.1|  BnaCnng02810D                                          275   6e-86   Brassica napus [oilseed rape]
gb|KHN09529.1|  Putative FAD synthase                                   275   7e-86   Glycine soja [wild soybean]
emb|CDX70308.1|  BnaA10g26570D                                          275   8e-86   
emb|CDY44367.1|  BnaC02g03100D                                          275   8e-86   Brassica napus [oilseed rape]
ref|XP_004137977.1|  PREDICTED: uncharacterized protein LOC101215823    273   4e-85   Cucumis sativus [cucumbers]
ref|XP_008442712.1|  PREDICTED: FAD synthase                            273   4e-85   Cucumis melo [Oriental melon]
ref|XP_006398793.1|  hypothetical protein EUTSA_v10013303mg             273   6e-85   
ref|XP_007162778.1|  hypothetical protein PHAVU_001G179700g             272   8e-85   Phaseolus vulgaris [French bean]
gb|KDP29170.1|  hypothetical protein JCGZ_16559                         272   1e-84   Jatropha curcas
gb|KCW49387.1|  hypothetical protein EUGRSUZ_K02925                     265   5e-83   Eucalyptus grandis [rose gum]
gb|KCW49386.1|  hypothetical protein EUGRSUZ_K02925                     266   7e-83   Eucalyptus grandis [rose gum]
ref|XP_010456377.1|  PREDICTED: FAD synthase-like                       266   8e-83   
ref|XP_010098792.1|  FAD synthase                                       267   1e-82   
gb|KCW49385.1|  hypothetical protein EUGRSUZ_K02925                     266   2e-82   Eucalyptus grandis [rose gum]
ref|XP_010267372.1|  PREDICTED: uncharacterized protein LOC104604633    271   2e-82   
emb|CDX80868.1|  BnaC03g01220D                                          265   4e-82   
ref|XP_010037643.1|  PREDICTED: FAD synthase                            265   7e-82   Eucalyptus grandis [rose gum]
emb|CDY11253.1|  BnaA03g00890D                                          264   9e-82   Brassica napus [oilseed rape]
ref|XP_009130755.1|  PREDICTED: FAD synthase-like                       263   2e-81   Brassica rapa
ref|XP_010936065.1|  PREDICTED: probable FAD synthase isoform X6        261   3e-81   
ref|XP_010936066.1|  PREDICTED: probable FAD synthase isoform X7        261   3e-81   Elaeis guineensis
ref|XP_010936063.1|  PREDICTED: FAD synthase-like isoform X4            261   7e-81   Elaeis guineensis
ref|XP_010936064.1|  PREDICTED: FAD synthase-like isoform X5            261   8e-81   Elaeis guineensis
ref|XP_010936062.1|  PREDICTED: FAD synthase-like isoform X3            261   8e-81   Elaeis guineensis
ref|XP_010936059.1|  PREDICTED: FAD synthase-like isoform X1            261   2e-80   
ref|XP_010936061.1|  PREDICTED: FAD synthase-like isoform X2            261   2e-80   Elaeis guineensis
ref|XP_008796395.1|  PREDICTED: FAD synthase-like isoform X2            261   3e-80   Phoenix dactylifera
ref|XP_008796393.1|  PREDICTED: FAD synthase-like isoform X1            261   6e-80   Phoenix dactylifera
gb|KHN02312.1|  Putative FAD synthase                                   258   8e-79   Glycine soja [wild soybean]
ref|XP_009420445.1|  PREDICTED: FAD synthase-like                       253   2e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789470.1|  PREDICTED: FAD synthase-like isoform X1            253   2e-77   Phoenix dactylifera
ref|XP_010940691.1|  PREDICTED: FAD synthase-like isoform X2            250   5e-77   Elaeis guineensis
ref|XP_009384127.1|  PREDICTED: FAD synthase-like                       251   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940690.1|  PREDICTED: FAD synthase-like isoform X1            250   3e-76   Elaeis guineensis
ref|XP_006840651.1|  hypothetical protein AMTR_s00211p00019770          248   2e-75   Amborella trichopoda
gb|AFW79647.1|  hypothetical protein ZEAMMB73_828913                    241   3e-74   
gb|EEC70347.1|  hypothetical protein OsI_01253                          244   7e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_008654383.1|  PREDICTED: uncharacterized protein LOC100193...    242   5e-73   Zea mays [maize]
gb|AFW79649.1|  hypothetical protein ZEAMMB73_828913                    241   5e-73   
ref|XP_002457596.1|  hypothetical protein SORBIDRAFT_03g009960          238   1e-71   Sorghum bicolor [broomcorn]
ref|XP_006644015.1|  PREDICTED: uncharacterized protein LOC102722152    237   2e-71   Oryza brachyantha
ref|XP_004967807.1|  PREDICTED: uncharacterized protein LOC101755558    237   4e-71   Setaria italica
ref|XP_010230726.1|  PREDICTED: FAD synthase                            236   1e-70   Brachypodium distachyon [annual false brome]
ref|XP_010558184.1|  PREDICTED: FAD synthase isoform X4                 234   2e-70   
ref|XP_006645730.1|  PREDICTED: probable FAD synthase-like              226   8e-70   Oryza brachyantha
emb|CDM82643.1|  unnamed protein product                                231   9e-69   Triticum aestivum [Canadian hard winter wheat]
gb|ADE76044.1|  unknown                                                 229   3e-68   Picea sitchensis
ref|XP_006645728.1|  PREDICTED: probable FAD synthase-like              221   1e-67   Oryza brachyantha
gb|EPS72355.1|  hypothetical protein M569_02401                         216   1e-67   Genlisea aurea
ref|XP_003565609.1|  PREDICTED: probable FAD synthase                   218   1e-66   Brachypodium distachyon [annual false brome]
ref|XP_010558185.1|  PREDICTED: FAD synthase isoform X5                 224   1e-66   
ref|XP_008675798.1|  PREDICTED: probable FAD synthase                   216   7e-66   Zea mays [maize]
ref|XP_006381393.1|  hypothetical protein POPTR_0006s12490g             221   3e-65   
ref|XP_008673877.1|  PREDICTED: probable FAD synthase                   211   3e-64   Zea mays [maize]
ref|XP_009122698.1|  PREDICTED: FAD synthase-like isoform X1            217   6e-64   
ref|XP_006645729.1|  PREDICTED: probable FAD synthase-like              210   1e-63   Oryza brachyantha
tpg|DAA54007.1|  TPA: hypothetical protein ZEAMMB73_776808              214   2e-63   
ref|XP_002976522.1|  hypothetical protein SELMODRAFT_54778              213   6e-63   
ref|XP_002973384.1|  hypothetical protein SELMODRAFT_54760              210   9e-62   
gb|EEE54271.1|  hypothetical protein OsJ_01171                          204   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010558189.1|  PREDICTED: FAD synthase isoform X7                 185   7e-52   
ref|XP_010558187.1|  PREDICTED: FAD synthase isoform X6                 185   8e-52   
ref|XP_010423718.1|  PREDICTED: FAD synthase-like isoform X2            171   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_005843031.1|  hypothetical protein CHLNCDRAFT_28612              163   2e-44   Chlorella variabilis
ref|XP_011400676.1|  FAD synthase                                       161   1e-42   Auxenochlorella protothecoides
ref|XP_005646168.1|  hypothetical protein COCSUDRAFT_17414              157   4e-41   Coccomyxa subellipsoidea C-169
gb|KHG16140.1|  FAD synthase                                            149   2e-38   Gossypium arboreum [tree cotton]
gb|EYU29880.1|  hypothetical protein MIMGU_mgv1a0051982mg               128   3e-31   Erythranthe guttata [common monkey flower]
ref|XP_002958238.1|  hypothetical protein VOLCADRAFT_99481              128   2e-30   Volvox carteri f. nagariensis
ref|XP_001693086.1|  FAD synthetase                                     123   7e-29   Chlamydomonas reinhardtii
ref|XP_006339086.1|  PREDICTED: uncharacterized protein LOC102587...    122   9e-29   
ref|XP_002907427.1|  FAD synthetase, putative                           117   8e-28   Phytophthora infestans T30-4
ref|XP_009517847.1|  hypothetical protein PHYSODRAFT_477086             117   1e-27   Phytophthora sojae
ref|XP_008897008.1|  hypothetical protein PPTG_05248                    117   1e-27   Phytophthora parasitica INRA-310
ref|XP_003286734.1|  hypothetical protein DICPUDRAFT_31417              114   2e-26   Dictyostelium purpureum
gb|EFA77806.1|  hypothetical protein PPL_09304                          110   1e-25   Heterostelium album PN500
gb|KDO34763.1|  hypothetical protein SPRG_00824                         110   2e-25   Saprolegnia parasitica CBS 223.65
ref|WP_028830572.1|  hypothetical protein                               109   4e-25   
ref|XP_008605218.1|  hypothetical protein SDRG_01471                    108   2e-24   Saprolegnia diclina VS20
gb|KDO17861.1|  hypothetical protein SPRG_16733                         107   2e-24   Saprolegnia parasitica CBS 223.65
ref|XP_639278.1|  hypothetical protein DDB_G0282955                     108   2e-24   Dictyostelium discoideum AX4
ref|XP_005411594.1|  PREDICTED: FAD synthase isoform X1                 108   9e-24   Chinchilla lanigera
ref|NP_001103608.1|  FAD synthase                                       106   4e-23   Rattus norvegicus [brown rat]
ref|XP_003040037.1|  predicted protein                                  102   5e-23   [Nectria] haematococca mpVI 77-13-4
gb|EDM00631.1|  rCG62600, isoform CRA_a                                 106   6e-23   Rattus norvegicus [brown rat]
ref|XP_004629853.1|  PREDICTED: FAD synthase                            105   6e-23   Octodon degus
ref|XP_010593100.1|  PREDICTED: FAD synthase isoform X2                 105   7e-23   Loxodonta africana [African bush elephant]
ref|XP_003415157.2|  PREDICTED: FAD synthase isoform X1                 105   7e-23   Loxodonta africana [African bush elephant]
dbj|BAE73079.1|  hypothetical protein                                   103   8e-23   Macaca fascicularis [crab eating macaque]
ref|XP_006153487.1|  PREDICTED: FAD synthase isoform X1                 105   9e-23   Tupaia chinensis
ref|XP_008262585.1|  PREDICTED: FAD synthase isoform X1                 105   9e-23   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005703934.1|  FAD synthetase                                     105   1e-22   Galdieria sulphuraria
ref|XP_004667290.1|  PREDICTED: FAD synthase                            105   1e-22   Jaculus jaculus
ref|XP_007946707.1|  PREDICTED: FAD synthase                            105   2e-22   Orycteropus afer afer
ref|NP_796015.2|  FAD synthase                                          104   2e-22   Mus musculus [mouse]
dbj|BAC31952.1|  unnamed protein product                                104   2e-22   Mus musculus [mouse]
ref|XP_004388605.1|  PREDICTED: FAD synthase                            104   3e-22   
gb|EDL15199.1|  RFad1, flavin adenine dinucleotide synthetase, ho...    104   3e-22   Mus musculus [mouse]
ref|XP_005898727.1|  PREDICTED: FAD synthase isoform X2                 103   3e-22   Bos mutus
ref|XP_006060993.1|  PREDICTED: FAD synthase isoform X4                 103   3e-22   
ref|XP_005245560.1|  PREDICTED: FAD synthase isoform X3                 102   4e-22   
ref|XP_003795368.1|  PREDICTED: FAD synthase isoform 1                  103   4e-22   
ref|XP_008046782.1|  PREDICTED: FAD synthase                            103   5e-22   Carlito syrichta
gb|AAH20253.1|  FLAD1 protein                                           102   5e-22   Homo sapiens [man]
ref|XP_002810135.1|  PREDICTED: FAD synthase isoform X1                 103   5e-22   Pongo abelii [orang utan]
ref|XP_009241813.1|  PREDICTED: FAD synthase isoform X3                 103   5e-22   Pongo abelii [orang utan]
ref|XP_005677471.1|  PREDICTED: FAD synthase isoform X1                 103   5e-22   Capra hircus [domestic goat]
ref|XP_005898726.1|  PREDICTED: FAD synthase isoform X1                 103   5e-22   
ref|NP_001030211.2|  FAD synthase                                       103   5e-22   Bos taurus [bovine]
ref|XP_004026883.1|  PREDICTED: FAD synthase isoform 1                  103   5e-22   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004988732.1|  hypothetical protein PTSG_10768                    102   5e-22   Salpingoeca rosetta
ref|XP_005541697.1|  PREDICTED: FAD synthase isoform X4                 102   5e-22   Macaca fascicularis [crab eating macaque]
dbj|BAE36639.1|  unnamed protein product                                103   5e-22   Mus musculus [mouse]
ref|XP_006060990.1|  PREDICTED: FAD synthase isoform X1                 103   5e-22   
ref|XP_855063.1|  PREDICTED: FAD synthase isoform X2                    103   6e-22   Canis lupus familiaris [dogs]
ref|XP_009241807.1|  PREDICTED: FAD synthase isoform X2                 103   6e-22   Pongo abelii [orang utan]
ref|XP_003259418.1|  PREDICTED: FAD synthase isoform 1                  103   7e-22   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_008521339.1|  PREDICTED: FAD synthase isoform X1                 103   7e-22   Equus przewalskii [Przewalski horse]
sp|Q5RCH4.1|FAD1_PONAB  RecName: Full=FAD synthase; AltName: Full...    103   7e-22   Pongo abelii [orang utan]
ref|XP_005245559.1|  PREDICTED: FAD synthase isoform X2                 102   7e-22   
ref|XP_008521340.1|  PREDICTED: FAD synthase isoform X2                 102   8e-22   Equus przewalskii [Przewalski horse]
ref|XP_001497976.1|  PREDICTED: FAD synthase isoform X1                 102   8e-22   
ref|XP_005367238.1|  PREDICTED: FAD synthase                            102   8e-22   Microtus ochrogaster [prairie voles]
ref|XP_005663396.1|  PREDICTED: FAD synthase isoform X3                 102   9e-22   
gb|ELR54237.1|  FAD synthase                                            103   9e-22   Bos mutus
gb|AAB50199.1|  unknown                                                 102   1e-21   Homo sapiens [man]
ref|NP_001171820.1|  FAD synthase isoform 3                             102   1e-21   Homo sapiens [man]
ref|XP_005975126.1|  PREDICTED: FAD synthase isoform X1                 102   1e-21   Pantholops hodgsonii [Tibetan antelope]
gb|EWM21421.1|  fad synthetase                                          103   1e-21   Nannochloropsis gaditana
ref|XP_004002615.1|  PREDICTED: FAD synthase isoform 1                  102   1e-21   
ref|XP_001114732.1|  PREDICTED: FAD synthase-like isoform 2             102   1e-21   
ref|XP_008590919.1|  PREDICTED: FAD synthase isoform X1                 101   1e-21   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007178527.1|  PREDICTED: FAD synthase isoform X1                 102   1e-21   Balaenoptera acutorostrata scammoni
ref|XP_006976381.1|  PREDICTED: FAD synthase isoform X1                 102   1e-21   Peromyscus maniculatus bairdii
ref|XP_001929410.3|  PREDICTED: FAD synthase isoformX1                  102   1e-21   Sus scrofa [pigs]
ref|XP_007975099.1|  PREDICTED: FAD synthase isoform X1                 102   1e-21   Chlorocebus sabaeus
ref|XP_004330633.1|  PREDICTED: FAD synthase isoform 2                  102   1e-21   
ref|XP_004284690.1|  PREDICTED: FAD synthase isoform 2                  102   1e-21   Orcinus orca [Orca]
ref|NP_958800.1|  FAD synthase isoform 2                                102   1e-21   Homo sapiens [man]
ref|XP_007640443.1|  PREDICTED: FAD synthase                            102   1e-21   Cricetulus griseus [Chinese hamsters]
gb|ABM81905.1|  FAD1 flavin adenine dinucleotide synthetase homol...    102   1e-21   synthetic construct
ref|XP_003475639.2|  PREDICTED: FAD synthase                            102   1e-21   Cavia porcellus [guinea pig]
ref|XP_007108960.1|  PREDICTED: FAD synthase isoform X2                 102   2e-21   Physeter catodon
ref|XP_005855287.1|  FAD synthetase                                     103   2e-21   Nannochloropsis gaditana CCMP526
ref|XP_008590926.1|  PREDICTED: FAD synthase isoform X2                 102   2e-21   Galeopterus variegatus [Malayan flying lemur]
gb|EHK45271.1|  hypothetical protein TRIATDRAFT_38099                 99.8    2e-21   Trichoderma atroviride IMI 206040
ref|XP_005331372.1|  PREDICTED: FAD synthase                            102   2e-21   Ictidomys tridecemlineatus
ref|XP_007458039.1|  PREDICTED: FAD synthase isoform X2                 102   2e-21   Lipotes vexillifer [baiji]
dbj|GAA97164.1|  hypothetical protein E5Q_03840                         103   2e-21   Mixia osmundae IAM 14324
emb|CCF35714.1|  phosphoadenosine phosphosulfate reductase            99.0    2e-21   Colletotrichum higginsianum
ref|XP_004330632.1|  PREDICTED: FAD synthase isoform 1                  102   2e-21   
ref|XP_004284689.1|  PREDICTED: FAD synthase isoform 1                  102   2e-21   
ref|XP_010362970.1|  PREDICTED: FAD synthase isoform X2                 101   2e-21   Rhinopithecus roxellana
ref|XP_007272700.1|  FAD synthetase                                     100   2e-21   
ref|XP_007108959.1|  PREDICTED: FAD synthase isoform X1                 102   3e-21   Physeter catodon
ref|NP_079483.3|  FAD synthase isoform 1                                102   3e-21   Homo sapiens [man]
gb|KDN62794.1|  putative phosphoadenosine phosphosulfate reductase    99.0    3e-21   Colletotrichum sublineola
ref|XP_007458038.1|  PREDICTED: FAD synthase isoform X1                 102   3e-21   Lipotes vexillifer [baiji]
ref|XP_010362969.1|  PREDICTED: FAD synthase isoform X1                 100   4e-21   Rhinopithecus roxellana
ref|XP_006895890.1|  PREDICTED: FAD synthase                            100   4e-21   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004363675.1|  flavin adenine dinucleotide synthetase           99.8    4e-21   Capsaspora owczarzaki ATCC 30864
ref|XP_006861579.1|  PREDICTED: FAD synthase isoform X1                 100   5e-21   Chrysochloris asiatica
gb|EMF09340.1|  adenine nucleotide alpha hydrolases-like protein      99.0    5e-21   Sphaerulina musiva SO2202
gb|EXX67488.1|  FMN adenylyltransferase                               97.4    5e-21   Rhizophagus irregularis DAOM 197198w
ref|XP_006177299.1|  PREDICTED: FAD synthase                            100   6e-21   Camelus ferus
ref|XP_010978262.1|  PREDICTED: FAD synthase isoform X1                 100   6e-21   Camelus dromedarius [camel]
ref|XP_010978267.1|  PREDICTED: FAD synthase isoform X2                 100   6e-21   Camelus dromedarius [camel]
ref|XP_008153958.1|  PREDICTED: FAD synthase                          99.8    7e-21   
ref|XP_010952262.1|  PREDICTED: FAD synthase isoform X1                 100   7e-21   Camelus bactrianus [camel]
ref|XP_007525401.1|  PREDICTED: FAD synthase                            100   8e-21   Erinaceus europaeus [common hedgehog]
ref|XP_002180385.1|  predicted protein                                99.0    8e-21   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009843532.1|  hypothetical protein H257_16705                  97.8    8e-21   Aphanomyces astaci
gb|EXX67487.1|  FMN adenylyltransferase                               97.8    8e-21   Rhizophagus irregularis DAOM 197198w
ref|XP_010346677.1|  PREDICTED: FAD synthase isoform X1                 100   8e-21   Saimiri boliviensis boliviensis
ref|XP_003937809.1|  PREDICTED: FAD synthase isoform X2                 100   8e-21   Saimiri boliviensis boliviensis
ref|XP_008789471.1|  PREDICTED: FAD synthase-like isoform X2          99.0    8e-21   
ref|XP_007595430.1|  phosphoadenosine phosphosulfate reductase        98.2    9e-21   
gb|EPE05906.1|  fad synthetase                                        98.6    9e-21   Ophiostoma piceae UAMH 11346
ref|XP_008982748.1|  PREDICTED: FAD synthase                            100   9e-21   Callithrix jacchus [common marmoset]
ref|XP_002787733.1|  FAD synthetase, putative                         98.2    9e-21   Perkinsus marinus ATCC 50983
ref|XP_006734875.1|  PREDICTED: FAD synthase isoform X1               99.8    1e-20   Leptonychotes weddellii
ref|XP_006775723.1|  PREDICTED: FAD synthase                          99.8    1e-20   Myotis davidii
ref|XP_006214728.1|  PREDICTED: FAD synthase                          99.8    1e-20   Vicugna pacos
ref|XP_004436180.1|  PREDICTED: FAD synthase                          99.8    1e-20   
ref|XP_008852809.1|  PREDICTED: FAD synthase isoform X1                 100   1e-20   Nannospalax galili
ref|XP_008852842.1|  PREDICTED: FAD synthase isoform X4               99.8    1e-20   Nannospalax galili
ref|XP_008852832.1|  PREDICTED: FAD synthase isoform X3                 100   1e-20   Nannospalax galili
ref|XP_008852817.1|  PREDICTED: FAD synthase isoform X2               99.8    1e-20   
dbj|GAD99193.1|  hypothetical protein THITE_2171095                   97.1    2e-20   Byssochlamys spectabilis No. 5
ref|XP_004589038.1|  PREDICTED: FAD synthase                          99.4    2e-20   Ochotona princeps [southern American pika]
ref|XP_004619248.1|  PREDICTED: FAD synthase                          99.8    2e-20   
gb|EPY86603.1|  hypothetical protein CB1_000306083                      100   2e-20   Camelus ferus
ref|XP_007587625.1|  putative fad synthetase protein                  96.7    2e-20   
ref|XP_007810448.1|  FAD synthetase, putative                         96.7    3e-20   Metarhizium acridum CQMa 102
gb|KID75083.1|  Rossmann-like alpha/beta/alpha sandwich fold protein  96.7    3e-20   Metarhizium brunneum ARSEF 3297
ref|XP_006923612.1|  PREDICTED: FAD synthase isoform X1               98.6    3e-20   Pteropus alecto
ref|XP_011364733.1|  PREDICTED: FAD synthase                          98.6    3e-20   Pteropus vampyrus
ref|XP_005080240.1|  PREDICTED: FAD synthase isoform X1               98.6    3e-20   
emb|CBJ30865.1|  conserved unknown protein                            99.0    3e-20   Ectocarpus siliculosus
ref|XP_010642214.1|  PREDICTED: FAD synthase isoform X3               98.2    4e-20   Fukomys damarensis [Damara mole rat]
ref|XP_006095141.1|  PREDICTED: FAD synthase                          98.2    4e-20   Myotis lucifugus
ref|XP_010642213.1|  PREDICTED: FAD synthase isoform X2               98.2    4e-20   Fukomys damarensis [Damara mole rat]
gb|KFG82710.1|  putative FAD synthetase                               96.3    4e-20   Metarhizium anisopliae
ref|XP_005867571.1|  PREDICTED: FAD synthase                          98.2    4e-20   Myotis brandtii
ref|XP_010642210.1|  PREDICTED: FAD synthase isoform X1               98.2    4e-20   Fukomys damarensis [Damara mole rat]
ref|XP_008876271.1|  hypothetical protein H310_11381                  95.5    5e-20   Aphanomyces invadans
ref|XP_011227302.1|  PREDICTED: LOW QUALITY PROTEIN: FAD synthase     97.4    5e-20   
gb|KID87437.1|  Rossmann-like alpha/beta/alpha sandwich fold protein  95.9    6e-20   Metarhizium guizhouense ARSEF 977
gb|EMS26186.1|  FAD synthetase                                        96.3    6e-20   Rhodotorula toruloides NP11
ref|XP_005781262.1|  hypothetical protein EMIHUDRAFT_418514           95.5    6e-20   Emiliania huxleyi CCMP1516
ref|XP_004821576.1|  PREDICTED: FAD synthase isoform X2               97.1    7e-20   
ref|XP_003230185.2|  PREDICTED: FAD synthase                          97.8    7e-20   Anolis carolinensis [Carolina anole]
ref|XP_004693836.1|  PREDICTED: FAD synthase                          97.4    8e-20   Condylura cristata
ref|XP_008694815.1|  PREDICTED: FAD synthase isoform X2               97.4    8e-20   Ursus maritimus [white bear]
ref|XP_008694814.1|  PREDICTED: FAD synthase isoform X1               97.4    8e-20   Ursus maritimus [white bear]
ref|XP_004778668.1|  PREDICTED: FAD synthase isoform X2               97.4    8e-20   
ref|XP_008968524.1|  PREDICTED: FAD synthase isoform X4               97.1    8e-20   Pan paniscus [bonobo]
gb|ENH82874.1|  FAD synthetase                                        95.1    1e-19   
ref|XP_004778667.1|  PREDICTED: FAD synthase isoform X1               97.4    1e-19   
ref|XP_003308466.1|  PREDICTED: FAD synthase isoform X3               97.1    1e-19   Pan troglodytes
gb|EKG13467.1|  Phosphoadenosine phosphosulfate reductase             95.1    1e-19   Macrophomina phaseolina MS6
gb|EXU97299.1|  phosphoadenosine phosphosulfate reductase             95.1    1e-19   
ref|XP_004778669.1|  PREDICTED: FAD synthase isoform X3               97.1    1e-19   
gb|KID97695.1|  Rossmann-like alpha/beta/alpha sandwich fold protein  94.7    1e-19   
ref|XP_004871379.1|  PREDICTED: FAD synthase isoform X3               95.9    2e-19   
ref|XP_008968523.1|  PREDICTED: FAD synthase isoform X2               96.7    2e-19   
emb|CDW79159.1|  fad synthase                                         94.0    2e-19   
ref|XP_008968522.1|  PREDICTED: FAD synthase isoform X1               97.1    2e-19   
ref|XP_011319384.1|  hypothetical protein FGSG_10410                  93.2    2e-19   
gb|KID64943.1|  NADH-ubiquinone oxidoreductase, 20 Kd subunit         95.5    3e-19   
ref|XP_003327205.2|  hypothetical protein PGTG_08982                  93.6    3e-19   
ref|XP_003331923.2|  hypothetical protein PGTG_13875                  93.6    3e-19   
ref|XP_004871377.1|  PREDICTED: FAD synthase isoform X1               95.5    3e-19   
ref|XP_004403036.1|  PREDICTED: FAD synthase isoform 1                95.5    3e-19   
ref|XP_007680837.1|  hypothetical protein BAUCODRAFT_27841            93.6    3e-19   
gb|EHB07303.1|  FAD synthetase                                        95.9    4e-19   
gb|KIL96650.1|  hypothetical protein FAVG1_01394                      93.2    4e-19   
ref|XP_010940692.1|  PREDICTED: FAD synthase-like isoform X3          94.4    4e-19   
ref|XP_004714709.1|  PREDICTED: FAD synthase                          95.1    5e-19   
ref|XP_009258815.1|  hypothetical protein FPSE_07422                  92.8    5e-19   
gb|EYB31358.1|  hypothetical protein FG05_10410                       92.8    5e-19   
emb|CEJ90829.1|  hypothetical protein VHEMI06583                      92.8    5e-19   
emb|CDS11489.1|  hypothetical protein LRAMOSA03752                    92.4    6e-19   
gb|EHK26432.1|  hypothetical protein TRIVIDRAFT_143207                92.8    7e-19   
gb|KHN97633.1|  Rossmann-like alpha/beta/alpha sandwich fold protein  92.8    7e-19   
ref|XP_004891507.1|  PREDICTED: LOW QUALITY PROTEIN: FAD synthase     95.5    7e-19   
ref|XP_002286161.1|  predicted protein                                93.2    7e-19   
gb|EYU29881.1|  hypothetical protein MIMGU_mgv1a0051981mg             88.2    1e-18   
gb|KFA76860.1|  hypothetical protein S40288_10758                     92.0    1e-18   
gb|KEY66857.1|  hypothetical protein S7711_05211                      91.7    1e-18   
ref|XP_002088599.1|  GE18655                                          91.7    1e-18   
gb|KFA62990.1|  hypothetical protein S40285_06850                     91.7    2e-18   
ref|XP_004455902.1|  PREDICTED: FAD synthase                          93.6    2e-18   
gb|EUB59066.1|  FAD synthetase                                        93.6    2e-18   
ref|XP_007825119.2|  NADH-ubiquinone oxidoreductase, 20 Kd subunit    94.4    2e-18   
ref|XP_006966261.1|  predicted protein                                90.9    2e-18   
gb|KFH46291.1|  FAD synthase-like protein                             91.3    2e-18   
gb|KFH64586.1|  hypothetical protein MVEG_09319                       93.6    2e-18   
ref|XP_003999778.1|  PREDICTED: FAD synthase isoform X1               93.2    3e-18   
gb|KIN04089.1|  hypothetical protein OIDMADRAFT_159249                90.9    3e-18   
ref|XP_797921.3|  PREDICTED: FAD synthase-like                        93.6    3e-18   
ref|XP_002427095.1|  molybdopterin- binding protein, putative         92.8    3e-18   
gb|EJK51691.1|  hypothetical protein THAOC_29118                      93.6    3e-18   
ref|XP_007087981.1|  PREDICTED: FAD synthase isoform X1               92.8    3e-18   
gb|KIJ40347.1|  hypothetical protein M422DRAFT_209949                 90.9    3e-18   
ref|XP_503279.1|  YALI0D25564p                                        90.1    4e-18   
gb|KHJ30928.1|  putative fad synthetase                               90.5    4e-18   
gb|AAI61933.1|  Flad1 protein                                         92.4    4e-18   
ref|XP_004337184.1|  phosphoadenosine phosphosulfate reductase fa...  90.1    4e-18   
dbj|GAA53108.1|  FAD synthase                                         90.9    5e-18   
ref|XP_006670420.1|  FAD synthetase, putative                         90.1    5e-18   
ref|XP_001635528.1|  predicted protein                                92.0    6e-18   
ref|XP_006960258.1|  adenine nucleotide alpha hydrolases-like pro...  89.0    6e-18   
ref|XP_003655978.1|  hypothetical protein THITE_2171095               89.7    7e-18   
ref|XP_009060375.1|  hypothetical protein LOTGIDRAFT_106425           91.7    7e-18   
ref|XP_011212026.1|  PREDICTED: FAD synthase-like                     89.7    8e-18   
gb|EFX83311.1|  hypothetical protein DAPPUDRAFT_301931                91.7    9e-18   
gb|KFY61814.1|  hypothetical protein V496_04872                       89.4    9e-18   
gb|KFY68073.1|  hypothetical protein V497_00013                       89.4    9e-18   
emb|CEP16641.1|  hypothetical protein                                 92.4    1e-17   
emb|CDS20212.1|  fad synthase                                         91.7    1e-17   
emb|CDI98557.1|  fad synthase                                         91.7    1e-17   
ref|XP_005538852.1|  flavin adenine dinucleotide synthetase           91.3    1e-17   
emb|CCT69337.1|  related to FAD1-flavin adenine dinucleotide (FAD...  88.6    1e-17   
dbj|GAN07597.1|  hypothetical protein MAM1_0168d07097                 89.0    1e-17   
gb|EJK63709.1|  hypothetical protein THAOC_15618                      91.7    1e-17   
gb|KFZ15353.1|  hypothetical protein V502_05659                       89.0    1e-17   
ref|XP_002601565.1|  hypothetical protein BRAFLDRAFT_255975           90.9    1e-17   
gb|EWG40912.1|  FAD synthetase                                        87.8    1e-17   
gb|KFM74835.1|  FAD synthase                                          90.9    2e-17   
emb|CEG77376.1|  hypothetical protein RMATCC62417_12139               88.6    2e-17   
ref|XP_001728858.1|  hypothetical protein MGL_4025                    88.6    2e-17   
gb|EXA44358.1|  hypothetical protein FOVG_05818                       87.8    2e-17   
gb|EWY90167.1|  hypothetical protein FOYG_07776                       87.8    2e-17   
ref|XP_009014372.1|  hypothetical protein HELRODRAFT_76281            90.5    2e-17   
gb|EWG40911.1|  FAD synthetase                                        87.8    2e-17   
ref|XP_003304102.1|  hypothetical protein PTT_16539                   88.2    2e-17   
ref|XP_002027602.1|  GL22960                                          88.2    2e-17   
gb|EQB50311.1|  phosphoadenosine phosphosulfate reductase             88.6    2e-17   
emb|CEG73031.1|  hypothetical protein RMATCC62417_08493               88.2    2e-17   
gb|KFY72700.1|  hypothetical protein V499_07198                       91.7    2e-17   
ref|XP_001354441.2|  GA18164                                          88.2    2e-17   
emb|CEI93012.1|  hypothetical protein RMCBS344292_07257               87.8    2e-17   
gb|KFZ05534.1|  hypothetical protein V501_08272                       91.7    3e-17   
ref|NP_001280383.1|  uncharacterized protein LOC100163204             88.2    3e-17   
ref|XP_008184112.1|  PREDICTED: FAD synthase-like                     88.2    3e-17   
ref|XP_011483592.1|  PREDICTED: FAD synthase isoform X2               90.1    3e-17   
emb|CEG73030.1|  hypothetical protein RMATCC62417_08493               87.8    3e-17   
ref|XP_004077941.1|  PREDICTED: FAD synthase isoform X1               90.1    3e-17   
gb|KFY90472.1|  hypothetical protein V500_05171                       87.8    3e-17   
gb|EWG40909.1|  FAD synthetase                                        87.8    3e-17   
ref|XP_005187687.1|  PREDICTED: FAD synthase                          87.8    3e-17   
gb|EMT63179.1|  Putative FAD synthase                                 87.8    3e-17   
ref|XP_003699740.1|  PREDICTED: FAD synthase-like                     89.7    3e-17   
gb|ENH67550.1|  Putative FAD synthase                                 87.8    3e-17   
gb|ELR07260.1|  hypothetical protein GMDG_08331                       87.8    3e-17   
ref|XP_002173169.1|  FAD synthetase                                   87.4    4e-17   
ref|XP_003768106.1|  PREDICTED: FAD synthase                          89.7    4e-17   
gb|KFY32382.1|  hypothetical protein V493_00250                       87.4    4e-17   
emb|CAG11870.1|  unnamed protein product                              89.7    5e-17   
emb|CEI99840.1|  hypothetical protein RMCBS344292_13920               87.0    5e-17   
ref|XP_009174968.1|  hypothetical protein T265_15126                  90.1    5e-17   
ref|XP_459899.2|  DEHA2E13662p                                        87.0    5e-17   
ref|XP_005140476.1|  PREDICTED: FAD synthase-like                     86.3    6e-17   
gb|KFY37542.1|  hypothetical protein V494_04707                       87.0    6e-17   
ref|NP_587730.1|  FAD synthetase (predicted)                          86.7    6e-17   
ref|XP_007776126.1|  hypothetical protein W97_00018                   85.9    7e-17   
ref|XP_005826392.1|  hypothetical protein GUITHDRAFT_114371           89.0    7e-17   
ref|XP_005773015.1|  hypothetical protein EMIHUDRAFT_101902           87.8    8e-17   
ref|XP_005732165.1|  PREDICTED: FAD synthase-like isoform X2          89.0    8e-17   
ref|XP_004541333.1|  PREDICTED: FAD synthase-like isoform X2          89.0    8e-17   
ref|XP_005936136.1|  PREDICTED: FAD synthase-like isoform X1          89.0    8e-17   
ref|XP_004541332.1|  PREDICTED: FAD synthase-like isoform X1          89.0    9e-17   
gb|KDD77170.1|  hypothetical protein H632_c4p0                        88.2    9e-17   
gb|EKC37260.1|  FAD synthetase                                        88.6    9e-17   
ref|XP_005732164.1|  PREDICTED: FAD synthase-like isoform X1          89.0    9e-17   
ref|XP_006804960.1|  PREDICTED: FAD synthase-like isoform X3          88.6    9e-17   
ref|XP_005732166.1|  PREDICTED: FAD synthase-like isoform X3          88.6    9e-17   
ref|XP_005169803.1|  PREDICTED: FAD synthase isoform X2               89.0    9e-17   
ref|XP_004541334.1|  PREDICTED: FAD synthase-like isoform X3          88.6    9e-17   
ref|XP_005936137.1|  PREDICTED: FAD synthase-like isoform X2          88.6    9e-17   
ref|NP_001003997.1|  FAD synthase                                     88.6    9e-17   
ref|XP_011430142.1|  PREDICTED: FAD synthase-like                     88.6    9e-17   
ref|XP_006804958.1|  PREDICTED: FAD synthase-like isoform X1          88.6    1e-16   
ref|XP_005472719.1|  PREDICTED: FAD synthase-like isoform X2          88.6    1e-16   
ref|XP_003450933.1|  PREDICTED: FAD synthase-like isoform X1          88.6    1e-16   
gb|EPB87777.1|  hypothetical protein HMPREF1544_05437                 86.3    1e-16   
ref|XP_005472720.1|  PREDICTED: FAD synthase-like isoform X3          88.2    1e-16   
ref|XP_008429946.1|  PREDICTED: FAD synthase isoform X3               88.6    1e-16   
ref|XP_005169802.1|  PREDICTED: FAD synthase isoform X1               89.0    1e-16   
ref|XP_008558280.1|  PREDICTED: probable FAD synthase isoform X2      85.5    1e-16   
ref|XP_008321355.1|  PREDICTED: FAD synthase isoform X2               88.2    1e-16   
ref|XP_011305908.1|  PREDICTED: probable FAD synthase                 85.5    1e-16   
ref|XP_008429941.1|  PREDICTED: FAD synthase isoform X1               88.2    1e-16   
ref|XP_008429945.1|  PREDICTED: FAD synthase isoform X2               88.2    1e-16   
ref|NP_727648.1|  CG4407, isoform B                                   85.9    1e-16   
ref|XP_006819165.1|  PREDICTED: FAD synthase-like                     88.2    2e-16   
ref|XP_007556163.1|  PREDICTED: FAD synthase isoform X2               87.8    2e-16   
ref|XP_008321354.1|  PREDICTED: FAD synthase isoform X1               88.2    2e-16   
ref|XP_006264424.1|  PREDICTED: FAD synthase                          87.8    2e-16   
gb|EFQ31137.1|  phosphoadenosine phosphosulfate reductase             85.9    2e-16   
ref|XP_004195058.1|  Piso0_005599                                     85.5    2e-16   
ref|XP_002079341.1|  GD23899                                          85.5    2e-16   
ref|XP_007556162.1|  PREDICTED: FAD synthase isoform X1               87.8    2e-16   
ref|XP_003966281.1|  PREDICTED: FAD synthase-like                     87.8    2e-16   
ref|XP_001258225.1|  FAD synthetase, putative                         85.9    2e-16   
ref|XP_002042177.1|  GM10510                                          85.1    2e-16   
ref|NP_572837.1|  CG4407, isoform A                                   85.9    2e-16   
gb|AAM29294.1|  AT21573p                                              85.1    2e-16   
ref|XP_002836604.1|  hypothetical protein                             85.5    2e-16   
gb|KEQ62979.1|  phosphoadenosine phosphosulfate reductase             85.1    3e-16   
gb|KFY07724.1|  hypothetical protein V492_06880                       85.1    3e-16   
ref|XP_007339853.1|  adenine nucleotide alpha hydrolases-like pro...  85.1    3e-16   
ref|XP_011496706.1|  PREDICTED: FAD synthase-like                     87.0    3e-16   
ref|XP_003849499.1|  hypothetical protein MYCGRDRAFT_62649            85.5    3e-16   
emb|CEG73032.1|  hypothetical protein RMATCC62417_08493               84.0    3e-16   
ref|XP_312180.4|  AGAP002740-PA                                       84.3    3e-16   
ref|NP_609653.1|  CG16848                                             84.7    3e-16   
gb|KDR19338.1|  FAD synthetase                                        87.0    3e-16   
ref|XP_008025122.1|  hypothetical protein SETTUDRAFT_41456            84.7    4e-16   
ref|XP_750990.1|  FAD synthetase                                      85.1    4e-16   
ref|XP_001964126.1|  GF20884                                          84.7    4e-16   
ref|XP_005809184.1|  PREDICTED: FAD synthase-like                     87.0    4e-16   
emb|CAD37142.1|  probable FAD synthetase                              84.7    4e-16   
gb|EDP49677.1|  FAD synthetase, putative                              85.1    4e-16   
ref|XP_001373580.2|  PREDICTED: FAD synthase isoform X1               86.7    4e-16   
gb|EDL15198.1|  RFad1, flavin adenine dinucleotide synthetase, ho...  86.7    4e-16   
ref|XP_006031058.1|  PREDICTED: FAD synthase                          86.7    4e-16   
ref|XP_004357327.1|  hypothetical protein DFA_02604                   84.7    4e-16   
gb|ELQ58805.1|  FAD synthetase                                        84.3    5e-16   
ref|XP_002042862.1|  GM11526                                          84.7    5e-16   
ref|XP_003347580.1|  hypothetical protein SMAC_04888                  84.7    5e-16   
gb|EOA98901.1|  FAD synthetase                                        84.3    5e-16   
ref|XP_010728145.1|  PREDICTED: FAD synthase isoform X2               86.3    5e-16   
ref|XP_007482072.1|  PREDICTED: FAD synthase isoform X2               86.7    5e-16   
gb|ELT90649.1|  hypothetical protein CAPTEDRAFT_220999                86.3    6e-16   
ref|XP_010728143.1|  PREDICTED: FAD synthase isoform X1               86.3    6e-16   
ref|XP_010728146.1|  PREDICTED: FAD synthase isoform X3               86.3    6e-16   
ref|XP_003662579.1|  hypothetical protein MYCTH_2303360               84.3    6e-16   
ref|XP_005022889.1|  PREDICTED: FAD synthase                          84.0    6e-16   
dbj|GAD97697.1|  FAD synthetase, putative                             84.3    6e-16   
ref|XP_008287120.1|  PREDICTED: FAD synthase                          86.3    7e-16   
gb|EME40961.1|  hypothetical protein DOTSEDRAFT_157982                84.0    7e-16   
ref|XP_009083134.1|  PREDICTED: FAD synthase                          83.6    8e-16   
ref|XP_002057133.1|  GJ16919                                          84.0    8e-16   
ref|XP_004196152.1|  Piso0_005599                                     83.6    8e-16   
ref|XP_008598865.1|  phosphoadenosine phosphosulfate reductase        83.6    8e-16   
gb|EST43474.1|  Phosphoadenosine phosphosulfate reductase family ...  83.6    9e-16   
gb|KFY26058.1|  hypothetical protein V491_01482                       83.6    9e-16   
ref|XP_003715001.1|  FAD synthetase                                   84.0    9e-16   
ref|XP_001214238.1|  conserved hypothetical protein                   85.5    1e-15   
ref|XP_002161577.1|  PREDICTED: FAD synthase-like                     85.5    1e-15   
ref|XP_002154824.1|  PREDICTED: FAD synthase-like                     82.8    1e-15   
ref|XP_009862013.1|  PREDICTED: FAD synthase                          85.5    1e-15   
ref|XP_002067382.1|  GK16392                                          85.5    1e-15   
gb|KEY75945.1|  FAD synthetase                                        85.1    1e-15   
ref|XP_001965041.1|  GF23240                                          82.8    1e-15   
ref|XP_007255988.1|  PREDICTED: FAD synthase isoform X1               85.1    2e-15   
ref|XP_001386891.2|  3'-phosphoadenosine 5'-phosphosulfate sulfot...  82.8    2e-15   
ref|XP_002057435.1|  GJ18102                                          82.4    2e-15   
gb|ERG85228.1|  putative fad synthase                                 84.7    2e-15   
ref|XP_005059163.1|  PREDICTED: FAD synthase                          85.1    2e-15   
ref|XP_003642709.1|  PREDICTED: FAD synthase isoform X1               84.7    2e-15   
emb|CCG81210.1|  putative FAD synthetase                              82.4    2e-15   
ref|XP_004948329.1|  PREDICTED: FAD synthase isoform X4               85.1    2e-15   
ref|XP_009909972.1|  PREDICTED: LOW QUALITY PROTEIN: FAD synthase     85.1    2e-15   
emb|CDK27944.1|  unnamed protein product                              82.0    2e-15   
ref|XP_011189655.1|  PREDICTED: FAD synthase                          82.4    2e-15   
gb|KIW01928.1|  hypothetical protein PV09_06769                       82.4    3e-15   
emb|CCU75928.1|  putative FAD synthetase                              82.4    3e-15   
ref|XP_658195.1|  hypothetical protein AN0591.2                       82.0    3e-15   
ref|XP_010388100.1|  PREDICTED: FAD synthase                          84.0    3e-15   
dbj|GAA83052.1|  FAD synthetase                                       82.0    3e-15   
gb|KFO55380.1|  FAD synthase                                          84.0    3e-15   
gb|KFD57209.1|  hypothetical protein M513_01720                       82.4    3e-15   
ref|XP_010788880.1|  PREDICTED: FAD synthase isoform X1               84.0    4e-15   
ref|XP_010788881.1|  PREDICTED: FAD synthase isoform X2               84.0    4e-15   
ref|XP_010788886.1|  PREDICTED: FAD synthase isoform X4               84.0    4e-15   
ref|XP_010788884.1|  PREDICTED: FAD synthase isoform X3               84.0    4e-15   
ref|XP_008627045.1|  PREDICTED: FAD synthase                          83.6    4e-15   
ref|XP_004948330.1|  PREDICTED: FAD synthase isoform X5               84.3    4e-15   
gb|KFB37507.1|  AGAP002740-PA-like protein                            80.9    4e-15   



>ref|XP_009598660.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
Length=513

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDD RLKTKYNNAIYVIKRALALYS++EVALSFNGGKDSTVL HLLRAG +
Sbjct  1    MEIDKAIRECDDGRLKTKYNNAIYVIKRALALYSVQEVALSFNGGKDSTVLLHLLRAGCF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LHE+E+ +S GD   G   FPIRTIYFES SAFPEINSFTYE AA YN+QMDIIRLDFKS
Sbjct  61   LHEAEENNSRGDAADGGKTFPIRTIYFESPSAFPEINSFTYEAAATYNIQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_009760625.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris]
Length=513

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 154/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDD RLKTKYNNAIYVI+RALALYS++EVALSFNGGKDSTVL HLLRAG +
Sbjct  1    MEIDKAIRECDDGRLKTKYNNAIYVIRRALALYSVQEVALSFNGGKDSTVLLHLLRAGCF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LHE+E+ +S G+   G   FPIRTIYFES SAFPEINSFTYE AA YN+QMDIIRLDFKS
Sbjct  61   LHEAEENNSGGNAADGGKTFPIRTIYFESQSAFPEINSFTYEAAATYNIQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_006354376.1| PREDICTED: uncharacterized protein LOC102579774 isoform X1 [Solanum 
tuberosum]
 ref|XP_006354377.1| PREDICTED: uncharacterized protein LOC102579774 isoform X2 [Solanum 
tuberosum]
Length=513

 Score =   298 bits (764),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDDRRLKTKYNNAIYVIKRALALY ++EVALSFNGGKDSTVL HLLRAG +
Sbjct  1    MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYPVQEVALSFNGGKDSTVLLHLLRAGCF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++E+ +S GD   G   FPIRTIYFES SAFPEINSFTYE A++Y++QMDIIRLDFKS
Sbjct  61   LHQAEEFNSGGDAADGGKTFPIRTIYFESPSAFPEINSFTYEAASIYDIQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_002269812.1| PREDICTED: FAD synthase [Vitis vinifera]
 emb|CBI30146.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIRE DDRRLKTKYNNAIYV++RALALYS+EEVALSFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDEAIRESDDRRLKTKYNNAIYVVRRALALYSVEEVALSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+ HSNG L   E+ FPIRTIYFES SAFPEINSFTYE A  Y LQMDIIRLDFKS
Sbjct  61   LHKREQSHSNGVLTDHEVAFPIRTIYFESPSAFPEINSFTYETATTYGLQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL+A PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLEAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_004246616.1| PREDICTED: FAD synthase [Solanum lycopersicum]
 ref|XP_010325965.1| PREDICTED: FAD synthase [Solanum lycopersicum]
Length=513

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDDRRLKTKYNNAIYVI+RALALY I+EVALSFNGGKDSTVL HLLRAG +
Sbjct  1    MEIDKAIRECDDRRLKTKYNNAIYVIRRALALYPIQEVALSFNGGKDSTVLLHLLRAGCF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++E+ +S GD   G   FPIRTIYFES SAFPEINSFTYE A++Y++QMDIIRLDFKS
Sbjct  61   LHQAEEFNSGGDAVDGGKTFPIRTIYFESPSAFPEINSFTYEAASIYDIQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_006339085.1| PREDICTED: uncharacterized protein LOC102587202 isoform X1 [Solanum 
tuberosum]
Length=512

 Score =   294 bits (752),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDD RLKTKY NAIYVIKRALALYSI+EVALSFNGGKDSTVL HLLRAGY 
Sbjct  1    MEIDKAIRECDDSRLKTKYTNAIYVIKRALALYSIQEVALSFNGGKDSTVLLHLLRAGYV  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++E+  S+ D+  GE  FPIRTIYFE+ + FPEINSFTYE AA YNLQMDI+RLDFKS
Sbjct  61   LHKAEE-SSSQDVADGENTFPIRTIYFETPTVFPEINSFTYETAATYNLQMDILRLDFKS  119

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  120  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  167



>ref|XP_004249480.1| PREDICTED: FAD synthase-like [Solanum lycopersicum]
Length=512

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA+RECDD RLKTKY+NAIYVIKRALALYSI+EVALSFNGGKDSTVL HLLRAGY 
Sbjct  1    MEIDKAVRECDDSRLKTKYSNAIYVIKRALALYSIQEVALSFNGGKDSTVLLHLLRAGYV  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++E+  S  D+  GE  FPIRTIYFE+ + FPEINSFTYE AA YNLQMDI+RLDFKS
Sbjct  61   LHKAEESSSQ-DVADGENSFPIRTIYFETPTVFPEINSFTYETAATYNLQMDILRLDFKS  119

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  120  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  167



>emb|CDP06784.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID A+RE DDRRLKTKY NAIYVI+RA ALYS++EVA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDIAVRESDDRRLKTKYKNAIYVIQRAFALYSVDEVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++EK   NGDL  GEI +PIRTIYFES+SAFPEINSFTYE A  Y LQM+IIRLDFK+
Sbjct  61   LHKAEKIGCNGDLMDGEIAYPIRTIYFESASAFPEINSFTYETAKSYGLQMEIIRLDFKA  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKA PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_009596064.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
 ref|XP_009596065.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
 ref|XP_009596066.1| PREDICTED: FAD synthase-like [Nicotiana tomentosiformis]
Length=504

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIREC+D RLKTKY NAIYVI+RAL LYSI+EVALSFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRECEDSRLKTKYTNAIYVIQRALTLYSIQEVALSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH +E+  S   +G  E  FPIRTIYFES+SAFPEINSFTYE AA YNLQMDIIRLDFKS
Sbjct  61   LHRAEESCSQDVVG--ENTFPIRTIYFESASAFPEINSFTYETAATYNLQMDIIRLDFKS  118

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWP FMRVNPIL
Sbjct  119  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPAFMRVNPIL  166



>gb|KDO51696.1| hypothetical protein CISIN_1g030189mg [Citrus sinensis]
 gb|KDO51697.1| hypothetical protein CISIN_1g030189mg [Citrus sinensis]
 gb|KDO51698.1| hypothetical protein CISIN_1g030189mg [Citrus sinensis]
 gb|KDO51699.1| hypothetical protein CISIN_1g030189mg [Citrus sinensis]
 gb|KDO51700.1| hypothetical protein CISIN_1g030189mg [Citrus sinensis]
Length=181

 Score =   277 bits (709),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAI VI+R LALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FPIRTIYFES+SAFPEINSFTY+ A+ Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNGSL-----TFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKS  115

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL A PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  116  GLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  163



>ref|XP_009795878.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris]
 ref|XP_009795879.1| PREDICTED: FAD synthase-like [Nicotiana sylvestris]
Length=505

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIREC D RLKTKY+NAI VIKRA ALYSI+EVALSFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRECADSRLKTKYSNAISVIKRAFALYSIQEVALSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH +E+  S  D+  GE  FPIRTIYFES+SAFPEINSFTYE AA YNLQMDIIRLDFKS
Sbjct  61   LHRAEESCSQ-DVVDGENTFPIRTIYFESASAFPEINSFTYEAAATYNLQMDIIRLDFKS  119

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWP FMRVNPIL
Sbjct  120  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPAFMRVNPIL  167



>dbj|BAF00583.1| hypothetical protein [Arabidopsis thaliana]
Length=408

 Score =   283 bits (723),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQTCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_011018779.1| PREDICTED: FAD synthase isoform X2 [Populus euphratica]
Length=467

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAIYVIRRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG    G   FPIRTIYFESS+AFPEI+SFTY+ A+ Y LQ+DII  DFKS
Sbjct  61   LHKMEQKCSNG----GLTSFPIRTIYFESSAAFPEIDSFTYDTASSYGLQLDIISSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEKLLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KDP30682.1| hypothetical protein JCGZ_15557 [Jatropha curcas]
Length=507

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAIYVI+RALA+YSIEE+ALSFNGGKDSTVL HLLRAG++
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAIYVIQRALAIYSIEEIALSFNGGKDSTVLLHLLRAGFF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+  +  SNG    G I FPIRTIYFESSSAFPEINSFTYE A+ Y LQ+DII  DFK+
Sbjct  61   LHKGGQSCSNG----GLISFPIRTIYFESSSAFPEINSFTYETASSYGLQLDIISSDFKT  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLENLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010558181.1| PREDICTED: FAD synthase isoform X1 [Tarenaya hassleriana]
 ref|XP_010558182.1| PREDICTED: FAD synthase isoform X2 [Tarenaya hassleriana]
Length=500

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRA++LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIYVIKRAMSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAFPEIN FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQSCSNGGLSL----FPVRTIYFESPSAFPEINGFTYDTAETYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_011018772.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
 ref|XP_011018773.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
 ref|XP_011018774.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
 ref|XP_011018778.1| PREDICTED: FAD synthase isoform X1 [Populus euphratica]
Length=505

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAIYVIRRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG    G   FPIRTIYFESS+AFPEI+SFTY+ A+ Y LQ+DII  DFKS
Sbjct  61   LHKMEQKCSNG----GLTSFPIRTIYFESSAAFPEIDSFTYDTASSYGLQLDIISSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEKLLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010553000.1| PREDICTED: FAD synthase-like [Tarenaya hassleriana]
Length=506

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 149/168 (89%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRALALYS+EEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIYVIKRALALYSVEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG    G + FPIRTIYFES SAFPEIN FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQSCSNG----GLLHFPIRTIYFESPSAFPEINGFTYDTAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKA+PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKASPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|AAK62461.1|AF387016_1 putative protein [Arabidopsis thaliana]
 gb|AAM10037.1| putative protein [Arabidopsis thaliana]
Length=497

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQTCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|NP_568117.1| phosphoadenosine phosphosulfate (PAPS) reductase family protein 
[Arabidopsis thaliana]
 emb|CAB83302.1| putative protein [Arabidopsis thaliana]
 gb|AED90602.1| phosphoadenosine phosphosulfate (PAPS) reductase family protein 
[Arabidopsis thaliana]
Length=497

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQTCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010558183.1| PREDICTED: FAD synthase isoform X3 [Tarenaya hassleriana]
Length=497

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRA++LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIYVIKRAMSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAFPEIN FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQSCSNGGLSL----FPVRTIYFESPSAFPEINGFTYDTAETYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|ACJ85260.1| unknown [Medicago truncatula]
Length=295

 Score =   276 bits (706),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIR C+DRRL+TKYNNA YVI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDEAIRGCEDRRLQTKYNNATYVIQRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++ +  +NGD+      FPIRTIYFES  AFPEINSFTY+IAA Y LQ+D IRLDFKS
Sbjct  61   LHKTGQNSANGDVK----DFPIRTIYFESPCAFPEINSFTYDIAATYGLQIDTIRLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLETLLKDKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_006287585.1| hypothetical protein CARUB_v10000795mg [Capsella rubella]
 gb|EOA20483.1| hypothetical protein CARUB_v10000795mg [Capsella rubella]
Length=498

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_002873090.1| phosphoadenosine phosphosulfate reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH49349.1| phosphoadenosine phosphosulfate reductase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=497

 Score =   282 bits (722),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKEQTCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KJB62376.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
 gb|KJB62377.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=411

 Score =   280 bits (715),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITESDDKRLKTKYNNAIYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG     +I FPIRTIYFES+S FPEIN+FTY+ +  Y LQMDIIR DFKS
Sbjct  61   LHRVEQSCSNG----VQIDFPIRTIYFESTSVFPEINTFTYDTSKTYGLQMDIIRTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|EYU38565.1| hypothetical protein MIMGU_mgv1a004967mg [Erythranthe guttata]
Length=502

 Score =   282 bits (722),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 148/168 (88%), Gaps = 3/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDD RLKTKYNNAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRECDDIRLKTKYNNAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGYH  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+S K  S  D    E+ FPIRTIYFE+ S F EINSFTYE A++Y L MDI RLDFKS
Sbjct  61   LHKSGKNLSTED---AELTFPIRTIYFETKSTFHEINSFTYETASIYKLWMDISRLDFKS  117

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  118  GLETLLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  165



>ref|XP_008387538.1| PREDICTED: FAD synthase [Malus domestica]
 ref|XP_008387539.1| PREDICTED: FAD synthase [Malus domestica]
Length=511

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDDRRLKTKYNNAI+VI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRECDDRRLKTKYNNAIHVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG + Y    FP+RTIYFE  SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNGGVKY----FPMRTIYFECPSAFPEINSFTYDTATTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLK+ PIKAIFLGVRIGDPTAVGQEQFSPSS GWPPFMRVNPIL
Sbjct  117  GLEDLLKSKPIKAIFLGVRIGDPTAVGQEQFSPSSVGWPPFMRVNPIL  164



>ref|XP_011077314.1| PREDICTED: FAD synthase isoform X2 [Sesamum indicum]
Length=490

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA+RE DD RLKTKYNNAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDKAVRESDDIRLKTKYNNAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            +H++    S  D    E  FPIRTIYFESSSAFPEINSFTY+ A +Y LQMDIIRLDFKS
Sbjct  61   MHKAGTNLSTRDPVNDETTFPIRTIYFESSSAFPEINSFTYDTAFVYKLQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKDKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_010490820.1| PREDICTED: FAD synthase-like isoform X2 [Camelina sativa]
Length=462

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHMKEQSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KJB62375.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=456

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITESDDKRLKTKYNNAIYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG     +I FPIRTIYFES+S FPEIN+FTY+ +  Y LQMDIIR DFKS
Sbjct  61   LHRVEQSCSNG----VQIDFPIRTIYFESTSVFPEINTFTYDTSKTYGLQMDIIRTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_011077312.1| PREDICTED: FAD synthase isoform X1 [Sesamum indicum]
 ref|XP_011077313.1| PREDICTED: FAD synthase isoform X1 [Sesamum indicum]
Length=510

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA+RE DD RLKTKYNNAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDKAVRESDDIRLKTKYNNAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            +H++    S  D    E  FPIRTIYFESSSAFPEINSFTY+ A +Y LQMDIIRLDFKS
Sbjct  61   MHKAGTNLSTRDPVNDETTFPIRTIYFESSSAFPEINSFTYDTAFVYKLQMDIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLKDKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_002519482.1| molybdopterin-binding, putative [Ricinus communis]
 gb|EEF42896.1| molybdopterin-binding, putative [Ricinus communis]
Length=512

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 150/170 (88%), Gaps = 4/170 (2%)
 Frame = +3

Query  171  EAMEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAG  350
            E MEIDKAI E DDRRLKTKYNNAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAG
Sbjct  3    EYMEIDKAISESDDRRLKTKYNNAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAG  62

Query  351  YYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            Y+L++ EK  SNG    G   FPIRTIYFESSSAFPEINSFT++ A+ Y LQ+DII  DF
Sbjct  63   YFLYKGEKSCSNG----GLTSFPIRTIYFESSSAFPEINSFTHDTASSYGLQLDIISSDF  118

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  119  KSGLENLLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_010490819.1| PREDICTED: FAD synthase-like isoform X1 [Camelina sativa]
Length=498

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHMKEQSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_007027436.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007027437.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY07938.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY07939.1| Phosphoadenosine phosphosulfate (PAPS) reductase family protein 
isoform 1 [Theobroma cacao]
Length=508

 Score =   280 bits (717),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DD RLKTKYNNA+YVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDTRLKTKYNNAVYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+   NG L      FPIRTIYFES+SAFPEINSFTY+IA MY +QMDIIR DFKS
Sbjct  61   LHRREQNCPNGVL----TDFPIRTIYFESASAFPEINSFTYDIAKMYGMQMDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLKA PI+AIFLGVRIGDPTAVGQEQFSPSSPGWP FMRVNPIL
Sbjct  117  GLEMLLKAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPSFMRVNPIL  164



>ref|XP_006398792.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 gb|ESQ40245.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
Length=499

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RL+TKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLRTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHKKELSCSNGGLS----KFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_009362100.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362101.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362102.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362106.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362107.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009362108.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
Length=511

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI+ECDDRRLKTKYNNAIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDKAIKECDDRRLKTKYNNAIYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SN D+      FP+RTIYFES SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNEDVK----DFPMRTIYFESPSAFPEINSFTYDAATTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLK+ PIKAIFLGVRIGDPTAVGQ+QFSPSS GWPPFMRVNPIL
Sbjct  117  GLEDLLKSKPIKAIFLGVRIGDPTAVGQDQFSPSSVGWPPFMRVNPIL  164



>gb|KJB62378.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=505

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITESDDKRLKTKYNNAIYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG     +I FPIRTIYFES+S FPEIN+FTY+ +  Y LQMDIIR DFKS
Sbjct  61   LHRVEQSCSNG----VQIDFPIRTIYFESTSVFPEINTFTYDTSKTYGLQMDIIRTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KJB62379.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=489

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITESDDKRLKTKYNNAIYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG     +I FPIRTIYFES+S FPEIN+FTY+ +  Y LQMDIIR DFKS
Sbjct  61   LHRVEQSCSNG----VQIDFPIRTIYFESTSVFPEINTFTYDTSKTYGLQMDIIRTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KJB62374.1| hypothetical protein B456_009G414300 [Gossypium raimondii]
Length=508

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAIYVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITESDDKRLKTKYNNAIYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG     +I FPIRTIYFES+S FPEIN+FTY+ +  Y LQMDIIR DFKS
Sbjct  61   LHRVEQSCSNG----VQIDFPIRTIYFESTSVFPEINTFTYDTSKTYGLQMDIIRTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|AFK39867.1| unknown [Medicago truncatula]
Length=413

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIR C+DRRL+TKYNNA YVI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDEAIRGCEDRRLQTKYNNATYVIQRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++ +  +NGD+      FPIRTIYFES  AFPEINSFTY+IAA Y LQ+D IRLDFKS
Sbjct  61   LHKTGQNSANGDVK----DFPIRTIYFESPCAFPEINSFTYDIAATYGLQIDTIRLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLETLLKDKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010423717.1| PREDICTED: FAD synthase-like isoform X1 [Camelina sativa]
 ref|XP_010423719.1| PREDICTED: FAD synthase-like isoform X3 [Camelina sativa]
Length=498

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRAL LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALTLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKS
Sbjct  61   LHMKEQSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010243269.1| PREDICTED: probable FAD synthase, partial [Nelumbo nucifera]
Length=312

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNA+YVI+RA ALY+ EEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAVYVIQRAFALYAFEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +    NG+    E+ FP+RTIYFES  AFPEINSFTYE A  Y LQM+IIRLDFKS
Sbjct  61   LHKEKPKSCNGNQTDCEMNFPVRTIYFESPDAFPEINSFTYETATDYELQMEIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL+  PI+AIFLG RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLREKPIRAIFLGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_008241395.1| PREDICTED: FAD synthase [Prunus mume]
 ref|XP_008241396.1| PREDICTED: FAD synthase [Prunus mume]
Length=511

 Score =   280 bits (715),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI ECDDRRLKTKY+NAIYVI+R LALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITECDDRRLKTKYSNAIYVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ EK  SNGD+      FPIRTIYFES SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEKSCSNGDVK----DFPIRTIYFESPSAFPEINSFTYDTATTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL A PIKAIFLGVR+GDPTAVGQEQFSPSS GWPPFMRVNPIL
Sbjct  117  GLEALLNAKPIKAIFLGVRMGDPTAVGQEQFSPSSLGWPPFMRVNPIL  164



>ref|XP_007204563.1| hypothetical protein PRUPE_ppa004416mg [Prunus persica]
 gb|EMJ05762.1| hypothetical protein PRUPE_ppa004416mg [Prunus persica]
Length=511

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI ECDDRRLKTKY+NAIYVI+R LALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAITECDDRRLKTKYSNAIYVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ EK  SNGD+      FPIRTIYFES SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEKSCSNGDVK----DFPIRTIYFESPSAFPEINSFTYDTATTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL A PIKAIFLGVR+GDPTAVGQEQFSPSS GWPPFMRVNPIL
Sbjct  117  GLEALLNAKPIKAIFLGVRMGDPTAVGQEQFSPSSLGWPPFMRVNPIL  164



>ref|XP_006428353.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 ref|XP_006428354.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 ref|XP_006428355.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 ref|XP_006428356.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41593.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41594.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41595.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
 gb|ESR41596.1| hypothetical protein CICLE_v10011527mg [Citrus clementina]
Length=505

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAI VI+R LALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FPIRTIYFES+SAFPEINSFTY+ A+ Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNGSL-----TFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKS  115

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL A PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  116  GLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  163



>ref|XP_006491700.1| PREDICTED: uncharacterized protein LOC102612726 isoform X7 [Citrus 
sinensis]
Length=521

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAI VI+R LALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FPIRTIYFES+SAFPEINSFTY+ A+ Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNGSL-----TFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKS  115

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL A PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  116  GLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  163



>ref|XP_006491694.1| PREDICTED: uncharacterized protein LOC102612726 isoform X1 [Citrus 
sinensis]
 ref|XP_006491695.1| PREDICTED: uncharacterized protein LOC102612726 isoform X2 [Citrus 
sinensis]
 ref|XP_006491696.1| PREDICTED: uncharacterized protein LOC102612726 isoform X3 [Citrus 
sinensis]
 ref|XP_006491697.1| PREDICTED: uncharacterized protein LOC102612726 isoform X4 [Citrus 
sinensis]
 ref|XP_006491698.1| PREDICTED: uncharacterized protein LOC102612726 isoform X5 [Citrus 
sinensis]
 ref|XP_006491699.1| PREDICTED: uncharacterized protein LOC102612726 isoform X6 [Citrus 
sinensis]
Length=522

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDRRLKTKYNNAI VI+R LALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRRLKTKYNNAINVIQRTLALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FPIRTIYFES+SAFPEINSFTY+ A+ Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNGSL-----TFPIRTIYFESNSAFPEINSFTYDTASKYVLQLDIIRSDFKS  115

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL A PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  116  GLEALLNAKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  163



>ref|XP_003554393.1| PREDICTED: uncharacterized protein LOC100816619 [Glycine max]
Length=506

 Score =   278 bits (712),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDDRRL+TKYNNA YV++RALALYSIEEVA SFNGGKDSTVL H+LRAGY+
Sbjct  1    MEIDKAIRECDDRRLQTKYNNATYVVQRALALYSIEEVAFSFNGGKDSTVLLHILRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+  +  +NGDL      FPIRTIYFES  AFPEINSFTY+ AA Y LQ+D I LDFKS
Sbjct  61   LHKKGQNSANGDLK----DFPIRTIYFESPCAFPEINSFTYDTAATYGLQIDTISLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKEKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_003625689.1| FAD synthetase [Medicago truncatula]
 gb|AES81907.1| phosphoadenosine phosphosulfate reductase family protein [Medicago 
truncatula]
 gb|AFK44331.1| unknown [Medicago truncatula]
Length=502

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIR C+DRRL+TKYNNA YVI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDEAIRGCEDRRLQTKYNNATYVIQRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++ +  +NGD+      FPIRTIYFES  AFPEINSFTY+IAA Y LQ+D IRLDFKS
Sbjct  61   LHKTGQNSANGDVK----DFPIRTIYFESPCAFPEINSFTYDIAATYGLQIDTIRLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLETLLKDKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_009377023.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
 ref|XP_009377024.1| PREDICTED: FAD synthase-like [Pyrus x bretschneideri]
Length=511

 Score =   278 bits (710),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI+ECDDRRLKTKYN+AIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAG +
Sbjct  1    MEIDKAIKECDDRRLKTKYNSAIYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGCF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG + Y    FP+RTIYFE  SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNGGVKY----FPMRTIYFECPSAFPEINSFTYDTATTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLK+ PIKAIFLGVRIGDPTAVGQEQFSPSS GWPPFMRVNPIL
Sbjct  117  GLEDLLKSKPIKAIFLGVRIGDPTAVGQEQFSPSSVGWPPFMRVNPIL  164



>ref|XP_003521410.1| PREDICTED: uncharacterized protein LOC100795114 [Glycine max]
Length=506

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDDRRL+TKYNNA YV++RALALYSIEEVA SFNGGKDSTVL H+LRAGY+
Sbjct  1    MEIDKAIRECDDRRLQTKYNNATYVVQRALALYSIEEVAFSFNGGKDSTVLLHILRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+  +   NGDL      FPIRTIYFES  AFPEINSFTY+ AA+Y LQ+D I LDFKS
Sbjct  61   LHKKGQNSVNGDLK----DFPIRTIYFESPCAFPEINSFTYDTAAIYGLQIDTISLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR+NPIL
Sbjct  117  GLEALLKEKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRLNPIL  164



>emb|CDY04882.1| BnaAnng00640D [Brassica napus]
Length=503

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIRRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG    G   FP+RTIYFES SAF EINSFTY+ A  Y+LQ+DIIR DFKS
Sbjct  61   LHKKELTCSNG----GISNFPVRTIYFESPSAFTEINSFTYDAAQTYDLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_009125503.1| PREDICTED: FAD synthase-like [Brassica rapa]
Length=503

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIRRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG    G   FP+RTIYFES SAF EINSFTY+ A  Y+LQ+DIIR DFKS
Sbjct  61   LHKKELTCSNG----GISNFPVRTIYFESPSAFTEINSFTYDAAQTYDLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010684031.1| PREDICTED: FAD synthase [Beta vulgaris subsp. vulgaris]
Length=541

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI +C+DRRLKTKYN A+YVI+RALALY+IEEVA SFNGGKDSTVL HLLRAG+Y
Sbjct  1    MEIDKAIGDCNDRRLKTKYNTAVYVIQRALALYNIEEVAFSFNGGKDSTVLLHLLRAGHY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ ++   + D  +    F IRTIYFES SAFPEINSFTYE A  YNLQ+DIIR DFKS
Sbjct  61   LHQQKQAKHDEDPAHDHCKFAIRTIYFESPSAFPEINSFTYETATTYNLQLDIIRQDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEGLLKTKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  168



>ref|XP_011468136.1| PREDICTED: FAD synthase [Fragaria vesca subsp. vesca]
 ref|XP_011468137.1| PREDICTED: FAD synthase [Fragaria vesca subsp. vesca]
 ref|XP_011468138.1| PREDICTED: FAD synthase [Fragaria vesca subsp. vesca]
Length=511

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI+ECDDRRLKTKYNNAIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIKECDDRRLKTKYNNAIYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  +NG    G   FPIRTIYF+  SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCTNG----GVQDFPIRTIYFDCPSAFPEINSFTYDAANTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVR+GDPTAVGQEQFSPSS GWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRMGDPTAVGQEQFSPSSLGWPPFMRVNPIL  164



>ref|XP_009122699.1| PREDICTED: FAD synthase-like isoform X2 [Brassica rapa]
Length=499

 Score =   275 bits (704),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRAL+LYS+EEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALSLYSMEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG L      FP+RTIYFES SAF EIN+FTY+ A  Y +Q+DIIR DFKS
Sbjct  61   LHKKELSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYGIQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_004494068.1| PREDICTED: uncharacterized protein LOC101502847 isoform X2 [Cicer 
arietinum]
Length=503

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIR C+DRRL+TKYNNA YVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDEAIRGCEDRRLQTKYNNATYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++ +  +NGD+      FPIRTIYFES  AFPEINSFTY+IAA Y LQ+D I LDFKS
Sbjct  61   LHKAGQNSANGDVK----NFPIRTIYFESPCAFPEINSFTYDIAATYGLQIDTISLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLETLLKEKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_004494067.1| PREDICTED: uncharacterized protein LOC101502847 isoform X1 [Cicer 
arietinum]
Length=516

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIR C+DRRL+TKYNNA YVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDEAIRGCEDRRLQTKYNNATYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH++ +  +NGD+      FPIRTIYFES  AFPEINSFTY+IAA Y LQ+D I LDFKS
Sbjct  61   LHKAGQNSANGDVK----NFPIRTIYFESPCAFPEINSFTYDIAATYGLQIDTISLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLETLLKEKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_008369548.1| PREDICTED: FAD synthase-like [Malus domestica]
 ref|XP_008369550.1| PREDICTED: FAD synthase-like [Malus domestica]
Length=515

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI+ECDDRRLKTKYNNAIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIKECDDRRLKTKYNNAIYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SN  +      FP+RTIYFES SAFPEINSFTY+ A  Y LQ+DIIR DFKS
Sbjct  61   LHKGEQSCSNECVK----DFPMRTIYFESPSAFPEINSFTYDAATTYGLQLDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLK+ PIKAIFLGVRIGDPTAVGQ+QFSPSS GWPPFMRVNPIL
Sbjct  117  GLEDLLKSKPIKAIFLGVRIGDPTAVGQDQFSPSSVGWPPFMRVNPIL  164



>emb|CDY10380.1| BnaCnng02810D [Brassica napus]
Length=500

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIRRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG L      FP+RTIYFES SAF EIN+FTY+ A  Y +Q+DIIR DFKS
Sbjct  61   LHKKELSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYGIQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KHN09529.1| Putative FAD synthase [Glycine soja]
Length=506

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRECDDRRL+TKYNNA +V++RALALYSIEEVA SFNGGKDSTVL H+LRAGY+
Sbjct  1    MEIDKAIRECDDRRLQTKYNNATHVVQRALALYSIEEVAFSFNGGKDSTVLLHILRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+  +   NGDL      FPIRTIYFES  AFPEINSFTY+ AA+Y LQ+D I LDFKS
Sbjct  61   LHKKGQNSVNGDLK----DFPIRTIYFESPCAFPEINSFTYDTAAIYGLQIDTISLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR+NPIL
Sbjct  117  GLEALLKEKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRLNPIL  164



>emb|CDX70308.1| BnaA10g26570D [Brassica napus]
Length=499

 Score =   275 bits (702),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIRRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG L      FP+RTIYFES SAF EIN+FTY+ A  Y +Q+DIIR DFKS
Sbjct  61   LHKKELSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYGIQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>emb|CDY44367.1| BnaC02g03100D [Brassica napus]
Length=501

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRALALYS EEVA SFNGGKDSTVL HLLR GY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALALYSTEEVAFSFNGGKDSTVLLHLLRTGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SNG L      FP+RTIYFES SAF E NSFTY+ A  Y+LQ+DIIR DFKS
Sbjct  61   LHKKELTCSNGGLS----SFPVRTIYFESPSAFTETNSFTYDAAQTYDLQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_004137977.1| PREDICTED: uncharacterized protein LOC101215823 [Cucumis sativus]
 ref|XP_004161280.1| PREDICTED: uncharacterized LOC101215823 [Cucumis sativus]
 gb|KGN58989.1| hypothetical protein Csa_3G740810 [Cucumis sativus]
Length=512

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 145/169 (86%), Gaps = 6/169 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIR+CDDRRLKTKYNNAIYV+KRALALYS EEVA SFNGGKDSTVL H+LRA ++
Sbjct  1    MEIDKAIRDCDDRRLKTKYNNAIYVVKRALALYSTEEVAFSFNGGKDSTVLLHILRAAFF  60

Query  357  LH-ESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH E E C  +G        FPIRTIYFES SAFPEINSFTY++A  Y L MDIIR DFK
Sbjct  61   LHKEEEGCSVDG-----LKEFPIRTIYFESPSAFPEINSFTYDMATNYGLLMDIIRTDFK  115

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLESLLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  116  SGLESLLKSRPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_008442712.1| PREDICTED: FAD synthase [Cucumis melo]
Length=512

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 145/169 (86%), Gaps = 6/169 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIR+CDDRRLKTKYNNAIYV+KRALALYS EEVA SFNGGKDSTVL H+LRA ++
Sbjct  1    MEIDKAIRDCDDRRLKTKYNNAIYVVKRALALYSTEEVAFSFNGGKDSTVLLHVLRAAFF  60

Query  357  LH-ESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH E E C  +G        FPIRTIYFES SAFPEINSFTY++A  Y L MDIIR DFK
Sbjct  61   LHKEEEGCSVDG-----LKEFPIRTIYFESPSAFPEINSFTYDMATNYGLLMDIIRTDFK  115

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLESLLK+ PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  116  SGLESLLKSRPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_006398793.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 ref|XP_006398794.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 gb|ESQ40246.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
 gb|ESQ40247.1| hypothetical protein EUTSA_v10013303mg [Eutrema salsugineum]
Length=507

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 147/176 (84%), Gaps = 12/176 (7%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYS--------IEEVALSFNGGKDSTVLF  332
            MEIDKAI E DD+RL+TKYNNAI+VIKRALALYS        IEEVA SFNGGKDSTVL 
Sbjct  1    MEIDKAIGESDDKRLRTKYNNAIFVIKRALALYSVQLVDFCSIEEVAFSFNGGKDSTVLL  60

Query  333  HLLRAGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMD  512
            HLLRAGY+LH+ E   SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+D
Sbjct  61   HLLRAGYFLHKKELSCSNGGLS----KFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLD  116

Query  513  IIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            IIR DFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  IIRQDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  172



>ref|XP_007162778.1| hypothetical protein PHAVU_001G179700g [Phaseolus vulgaris]
 gb|ESW34772.1| hypothetical protein PHAVU_001G179700g [Phaseolus vulgaris]
Length=504

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 143/168 (85%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AIRECDDRRL+TKY NA YV++RAL LYSIEEVA SFNGGKDSTVL H+LRAGY+
Sbjct  1    MEIDRAIRECDDRRLQTKYKNATYVVQRALTLYSIEEVAFSFNGGKDSTVLLHILRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+  +   NGDL      FPIRTIYFES  AFPEINSFTY+ AA Y LQ+D I LDFKS
Sbjct  61   LHKKGQNSVNGDLK----DFPIRTIYFESPCAFPEINSFTYDTAATYGLQIDTISLDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKEKPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KDP29170.1| hypothetical protein JCGZ_16559 [Jatropha curcas]
Length=508

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 147/168 (88%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI++I+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIHIIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L++     SNG L      FPIRTIYFESSSAFPEINSFT++ A+ Y LQ+DII  DFKS
Sbjct  61   LYKGGHSCSNGGLN----SFPIRTIYFESSSAFPEINSFTHDTASSYGLQLDIISSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLENLLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KCW49387.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=407

 Score =   265 bits (676),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA++ECDDRRLKTKY NAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAG+Y
Sbjct  1    MEIDKAVKECDDRRLKTKYANAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGHY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L E+ +   NG+L      FP RTIYFESSSAF EINSFT+ IA  Y LQM++I  DFKS
Sbjct  61   LSEANQRSPNGNLK----GFPFRTIYFESSSAFSEINSFTHGIATTYALQMEVIHTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE L+K+  I+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEDLIKSKSIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>gb|KCW49386.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=458

 Score =   266 bits (679),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA++ECDDRRLKTKY NAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAG+Y
Sbjct  1    MEIDKAVKECDDRRLKTKYANAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGHY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L E+ +   NG+L      FP RTIYFESSSAF EINSFT+ IA  Y LQM++I  DFKS
Sbjct  61   LSEANQRSPNGNLK----GFPFRTIYFESSSAFSEINSFTHGIATTYALQMEVIHTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE L+K+  I+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEDLIKSKSIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010456377.1| PREDICTED: FAD synthase-like, partial [Camelina sativa]
Length=489

 Score =   266 bits (681),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +3

Query  207  DDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSN  386
            DD+RLKTKYNNAI+VIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+LH  E+  SN
Sbjct  2    DDKRLKTKYNNAIFVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYFLHMKEQSFSN  61

Query  387  GDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP  566
            G L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKSGLE+LLKANP
Sbjct  62   GGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKSGLEALLKANP  117

Query  567  IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            I+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  118  IRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  155



>ref|XP_010098792.1| FAD synthase [Morus notabilis]
 gb|EXB75880.1| FAD synthase [Morus notabilis]
Length=511

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 145/168 (86%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DDR LKTKYN AIYVI+RALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDRWLKTKYNRAIYVIQRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  ++ D       FPIRTIYFES SAFPEINSFTY+ AA Y +QMDIIR DFKS
Sbjct  61   LHKREQNCASED----PKDFPIRTIYFESPSAFPEINSFTYDAAANYGMQMDIIRSDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK+ PI+AIFLGVR+GDPTAVGQEQFSPSS GWPPFMRVNPIL
Sbjct  117  GLEALLKSKPIRAIFLGVRMGDPTAVGQEQFSPSSVGWPPFMRVNPIL  164



>gb|KCW49385.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=477

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA++ECDDRRLKTKY NAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAG+Y
Sbjct  1    MEIDKAVKECDDRRLKTKYANAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGHY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L E+ +   NG+L      FP RTIYFESSSAF EINSFT+ IA  Y LQM++I  DFKS
Sbjct  61   LSEANQRSPNGNLK----GFPFRTIYFESSSAFSEINSFTHGIATTYALQMEVIHTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE L+K+  I+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEDLIKSKSIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010267372.1| PREDICTED: uncharacterized protein LOC104604633 [Nelumbo nucifera]
Length=721

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE +D RLKTKYNNA+YVI+RA ALYS EEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESNDTRLKTKYNNAVYVIQRAFALYSFEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  +   S+G     E+  PIRTIYFES SAFPEINSFTYE A +Y LQM+IIRLDFKS
Sbjct  61   LHRQKLSSSHGSPTDCEMKCPIRTIYFESPSAFPEINSFTYETATIYELQMEIIRLDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL+  PI+AIFLG RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLREKPIRAIFLGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  168



>emb|CDX80868.1| BnaC03g01220D [Brassica napus]
Length=496

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+RLKTKYNNAI+VIKRAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKRLKTKYNNAIFVIKRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SN     G   FP RTIYFES SAF EIN+FTY+ A  Y +Q+DIIR DFKS
Sbjct  61   LHKKELSSSN----GGLSSFPARTIYFESPSAFTEINAFTYDAAQTYGIQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010037643.1| PREDICTED: FAD synthase [Eucalyptus grandis]
 ref|XP_010037645.1| PREDICTED: FAD synthase [Eucalyptus grandis]
 gb|KCW49384.1| hypothetical protein EUGRSUZ_K02925 [Eucalyptus grandis]
Length=508

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 143/168 (85%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA++ECDDRRLKTKY NAIYVI+RALALYS+EEVA SFNGGKDSTVL HLLRAG+Y
Sbjct  1    MEIDKAVKECDDRRLKTKYANAIYVIQRALALYSVEEVAFSFNGGKDSTVLLHLLRAGHY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L E+ +   NG+L      FP RTIYFESSSAF EINSFT+ IA  Y LQM++I  DFKS
Sbjct  61   LSEANQRSPNGNLK----GFPFRTIYFESSSAFSEINSFTHGIATTYALQMEVIHTDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE L+K+  I+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEDLIKSKSIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>emb|CDY11253.1| BnaA03g00890D [Brassica napus]
Length=496

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 145/168 (86%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E +D+RLKTKYNNAI+VI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESEDKRLKTKYNNAIFVIRRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SN     G   FP+RTIYFES SAF EIN+FTY+ A  Y +Q+DIIR DFKS
Sbjct  61   LHKKELSSSN----GGLSSFPVRTIYFESPSAFTEINAFTYDAAQTYGIQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_009130755.1| PREDICTED: FAD synthase-like [Brassica rapa]
Length=496

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 144/168 (86%), Gaps = 4/168 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            M IDKAI E DD+RLKTKYNNAI+VI+RAL+LYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MGIDKAIGESDDKRLKTKYNNAIFVIRRALSLYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E   SN     G   FP+RTIYFES SAF EIN+FTY+ A  Y +Q+DIIR DFKS
Sbjct  61   LHKKELSSSN----GGLSSFPVRTIYFESPSAFTEINAFTYDAAQTYGIQLDIIRQDFKS  116

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  164



>ref|XP_010936065.1| PREDICTED: probable FAD synthase isoform X6 [Elaeis guineensis]
Length=445

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010936066.1| PREDICTED: probable FAD synthase isoform X7 [Elaeis guineensis]
Length=440

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010936063.1| PREDICTED: FAD synthase-like isoform X4 [Elaeis guineensis]
Length=464

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010936064.1| PREDICTED: FAD synthase-like isoform X5 [Elaeis guineensis]
Length=463

 Score =   261 bits (666),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010936062.1| PREDICTED: FAD synthase-like isoform X3 [Elaeis guineensis]
Length=489

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010936059.1| PREDICTED: FAD synthase-like isoform X1 [Elaeis guineensis]
Length=513

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010936061.1| PREDICTED: FAD synthase-like isoform X2 [Elaeis guineensis]
Length=512

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFE   AFPEINSFTYE AA Y+LQ++I+R DFKS
Sbjct  61   LHKEKINYSNGNQPDCMLKCPIRTIYFECPCAFPEINSFTYETAAAYDLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_008796395.1| PREDICTED: FAD synthase-like isoform X2 [Phoenix dactylifera]
Length=512

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PI+TIYFES  AFPEINSFTYE AA Y LQ++I+R DFKS
Sbjct  61   LHKEKTNYSNGNQPDCMLKCPIQTIYFESPCAFPEINSFTYETAAAYGLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_008796393.1| PREDICTED: FAD synthase-like isoform X1 [Phoenix dactylifera]
Length=548

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PI+TIYFES  AFPEINSFTYE AA Y LQ++I+R DFKS
Sbjct  61   LHKEKTNYSNGNQPDCMLKCPIQTIYFESPCAFPEINSFTYETAAAYGLQLEIMRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLESLLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLESLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>gb|KHN02312.1| Putative FAD synthase [Glycine soja]
Length=539

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 146/212 (69%), Gaps = 48/212 (23%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYS--------------------------  278
            MEIDKAIRECDDRRL+TKYNNA YV++RALALYS                          
Sbjct  1    MEIDKAIRECDDRRLQTKYNNATYVVQRALALYSLEFMCEELDSFAPFLLVNVNQKTRRV  60

Query  279  ------------------IEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYG  404
                              IEEVA SFNGGKDSTVL H+LRAGY+LH+  +  +NGDL   
Sbjct  61   LRAVDSIFIVALTGKMNSIEEVAFSFNGGKDSTVLLHILRAGYFLHKKGQNSANGDLK--  118

Query  405  EIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFL  584
               FPIRTIYFES  AFPEINSFTY+ AA Y LQ+D I LDFKSGLE+LLK  PI+AIFL
Sbjct  119  --DFPIRTIYFESPCAFPEINSFTYDTAATYGLQIDTISLDFKSGLEALLKEKPIRAIFL  176

Query  585  GVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  177  GVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  208



>ref|XP_009420445.1| PREDICTED: FAD synthase-like [Musa acuminata subsp. malaccensis]
Length=508

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+RE  DRRL+TKY NA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAVREGSDRRLQTKYRNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +   SNG L    +  PIRTIYFES  AFPEINSFTYE A +Y LQ++ I  DFKS
Sbjct  61   LHKGKPECSNGSLSDSVLNCPIRTIYFESPCAFPEINSFTYETATVYGLQLETIHSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  P KAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLEALLKEKPTKAIFLGTRIGDPNAVGQEQFSPSSIGWPPFMRVNPIL  168



>ref|XP_008789470.1| PREDICTED: FAD synthase-like isoform X1 [Phoenix dactylifera]
Length=511

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 139/168 (83%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+AI+E  DRRL+TKYNNA+YVI+R  ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAIKESSDRRLQTKYNNAVYVIQRTFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +S+G+     +  PIRTIYFES  AFP+IN FTYE AA+Y+L ++IIR DFKS
Sbjct  61   LHKEKTDNSHGNQLDCMLNCPIRTIYFESPCAFPDINLFTYETAAVYDLHLEIIRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLETLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_010940691.1| PREDICTED: FAD synthase-like isoform X2 [Elaeis guineensis]
Length=429

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            M+ID+AI+E  DRRL+TKY+NA+YVI+R  +LY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MDIDRAIKESSDRRLQTKYHNAVYVIQRTFSLYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFES  AFPEINSFTYE AA+Y+L ++IIR DFKS
Sbjct  61   LHKGKTDNSNGNQLDCMLKCPIRTIYFESPCAFPEINSFTYETAAVYDLHLEIIRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK    KAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLETLLKEKSTKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_009384127.1| PREDICTED: FAD synthase-like [Musa acuminata subsp. malaccensis]
Length=509

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 135/168 (80%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+ E  DRRL+TKY NA+YVI+RA ALY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAVGESCDRRLQTKYRNAVYVIQRAFALYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +     G+L    +  PIRTIYFES SAFPEIN+FTYE A  YNLQ++ IR DFKS
Sbjct  61   LHKGKSECFQGNLSDSMLNCPIRTIYFESPSAFPEINAFTYETATAYNLQLETIRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  P KAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLEALLKEKPTKAIFLGTRIGDPNAVGQEQFSPSSIGWPPFMRVNPIL  168



>ref|XP_010940690.1| PREDICTED: FAD synthase-like isoform X1 [Elaeis guineensis]
Length=514

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            M+ID+AI+E  DRRL+TKY+NA+YVI+R  +LY  E+VA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MDIDRAIKESSDRRLQTKYHNAVYVIQRTFSLYEFEQVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ +  +SNG+     +  PIRTIYFES  AFPEINSFTYE AA+Y+L ++IIR DFKS
Sbjct  61   LHKGKTDNSNGNQLDCMLKCPIRTIYFESPCAFPEINSFTYETAAVYDLHLEIIRSDFKS  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK    KAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  121  GLETLLKEKSTKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  168



>ref|XP_006840651.1| hypothetical protein AMTR_s00211p00019770 [Amborella trichopoda]
 gb|ERN02326.1| hypothetical protein AMTR_s00211p00019770 [Amborella trichopoda]
Length=512

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 136/168 (81%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            M+I +AI+   DRRL TKYNNAIYVI+RALALYS EEVA SFNGGKDSTVL HLLRAGY 
Sbjct  1    MDIVRAIQGSQDRRLVTKYNNAIYVIQRALALYSFEEVAFSFNGGKDSTVLLHLLRAGYA  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L E      N +    ++  PIRTIYFES  AF EIN+FTYE AA Y+LQ++IIRLDFK+
Sbjct  61   LQEDRAGCLNVECSNSKLKHPIRTIYFESPCAFLEINAFTYETAAAYDLQLEIIRLDFKA  120

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LL+  P+KAIFLG RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  121  GLEALLREKPVKAIFLGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  168



>gb|AFW79647.1| hypothetical protein ZEAMMB73_828913, partial [Zea mays]
Length=395

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R C DRR++TKY+NA+YV++RA ALY  EEVA SFNGGKDSTVL HL+RAGYY
Sbjct  1    MEIDQAVRGCSDRRMRTKYSNAVYVVQRAFALYPFEEVAFSFNGGKDSTVLLHLIRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            L++ +    +GD+   +     P+RTIYFES  AFPEINSFTYEI + Y L ++ I  DF
Sbjct  61   LYKKD----SGDVAQTDAVKNCPLRTIYFESPCAFPEINSFTYEIVSTYGLPLETIHSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>gb|EEC70347.1| hypothetical protein OsI_01253 [Oryza sativa Indica Group]
Length=502

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 134/169 (79%), Gaps = 4/169 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R   DRRL+TKY+NA+YV++RA ALY  EEVA SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDRAVRGSSDRRLRTKYDNAVYVVQRAFALYPFEEVAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIP-FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH+S    S+G++    I   P+RTIYFES  AFPEINSFTYE  + Y L ++ I  DFK
Sbjct  61   LHKSS---SDGEVEMNTIQNCPVRTIYFESPCAFPEINSFTYETVSTYGLPLETIHSDFK  117

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  118  SGLEGLLKERPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>ref|XP_008654383.1| PREDICTED: uncharacterized protein LOC100193543 isoform X1 [Zea 
mays]
 gb|ACN35205.1| unknown [Zea mays]
 gb|AFW79648.1| hypothetical protein ZEAMMB73_828913 [Zea mays]
Length=507

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R C DRR++TKY+NA+YV++RA ALY  EEVA SFNGGKDSTVL HL+RAGYY
Sbjct  1    MEIDQAVRGCSDRRMRTKYSNAVYVVQRAFALYPFEEVAFSFNGGKDSTVLLHLIRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            L++ +    +GD+   +     P+RTIYFES  AFPEINSFTYEI + Y L ++ I  DF
Sbjct  61   LYKKD----SGDVAQTDAVKNCPLRTIYFESPCAFPEINSFTYEIVSTYGLPLETIHSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>gb|AFW79649.1| hypothetical protein ZEAMMB73_828913 [Zea mays]
Length=490

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R C DRR++TKY+NA+YV++RA ALY  EEVA SFNGGKDSTVL HL+RAGYY
Sbjct  1    MEIDQAVRGCSDRRMRTKYSNAVYVVQRAFALYPFEEVAFSFNGGKDSTVLLHLIRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            L++ +    +GD+   +     P+RTIYFES  AFPEINSFTYEI + Y L ++ I  DF
Sbjct  61   LYKKD----SGDVAQTDAVKNCPLRTIYFESPCAFPEINSFTYEIVSTYGLPLETIHSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>ref|XP_002457596.1| hypothetical protein SORBIDRAFT_03g009960 [Sorghum bicolor]
 gb|EES02716.1| hypothetical protein SORBIDRAFT_03g009960 [Sorghum bicolor]
Length=507

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 132/170 (78%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R C DRRL+TKY NA+YV++RA ALY  EE+A SFNGGKDSTVL HL+RAGYY
Sbjct  1    MEIDEAVRGCSDRRLRTKYGNAVYVVQRAFALYPFEEIAFSFNGGKDSTVLLHLIRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            L++ +    +GD+         P+RTIYFES  AFPEINSFTYE  + Y L ++ I  DF
Sbjct  61   LYKKD----SGDIAQMNAVKNCPLRTIYFESPCAFPEINSFTYETVSTYGLPLETIHSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>ref|XP_006644015.1| PREDICTED: uncharacterized protein LOC102722152 [Oryza brachyantha]
Length=501

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R   DRRL+TKY+NA+YV++RA ALY  EEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDRAVRASSDRRLRTKYDNAVYVVQRAFALYPFEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIP-FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH+S      G+     I   P+RTIYFES  AFPEINSFTYE  + Y L ++ I  DFK
Sbjct  61   LHKSS---FGGEDEMNTIQNCPLRTIYFESPCAFPEINSFTYETVSTYGLPLETIHSDFK  117

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  118  SGLEGLLKERPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>ref|XP_004967807.1| PREDICTED: uncharacterized protein LOC101755558 [Setaria italica]
Length=507

 Score =   237 bits (604),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 132/170 (78%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R C DRRL+TKY NA+YV++RA ALY  EEVA SFNGGKDSTVL HL+RAGYY
Sbjct  1    MEIDEAVRGCSDRRLRTKYANAVYVVQRAFALYPFEEVAFSFNGGKDSTVLLHLIRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            L++ +      D+   +     P+RTIYFES  AFPEINSFTYE  + Y L ++ I+ DF
Sbjct  61   LYKKDSV----DVAQMDAVKNCPLRTIYFESPCAFPEINSFTYETVSTYGLPLETIQSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>ref|XP_010230726.1| PREDICTED: FAD synthase [Brachypodium distachyon]
Length=507

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 131/170 (77%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID A+R   D RL+TKY +A+YV++RA ALY  EE+A SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIDAAVRASSDGRLRTKYGSAVYVVQRAFALYPFEEIAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            LH++    S+GD    +     P+RTIYFE+  AFPEINSFTYE  + Y L ++ IR DF
Sbjct  61   LHKT----SSGDGAQTDTIQNCPLRTIYFETPCAFPEINSFTYETVSTYGLPLETIRSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>ref|XP_010558184.1| PREDICTED: FAD synthase isoform X4 [Tarenaya hassleriana]
Length=480

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 128/168 (76%), Gaps = 24/168 (14%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAI E DD+R                    IEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIGESDDKR--------------------IEEVAFSFNGGKDSTVLLHLLRAGYF  40

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+ E+  SNG L      FP+RTIYFES SAFPEIN FTY+ A  YNLQ+DIIR DFKS
Sbjct  41   LHKKEQSCSNGGLSL----FPVRTIYFESPSAFPEINGFTYDTAETYNLQLDIIRQDFKS  96

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  97   GLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  144



>ref|XP_006645730.1| PREDICTED: probable FAD synthase-like [Oryza brachyantha]
Length=255

 Score =   226 bits (575),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 127/169 (75%), Gaps = 3/169 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            ME++ A+R   D  ++ KY  A+YV++RA ALY  +E+A SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEVEAAVRASGDSVMRAKYGRAVYVVQRAFALYPFDEIAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIP-FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH +     NGD     I   P+RTIYFE  +AFPEINSFTY+ A+ Y L ++ IR DFK
Sbjct  61   LHRTSS--GNGDQTDCTIQNCPMRTIYFEDPTAFPEINSFTYDTASTYGLPLETIRTDFK  118

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLE+LLK  P KAIFLG R GDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  119  SGLEALLKEKPTKAIFLGTRNGDPNAVGQEQFSPSSPGWPPFMRVNPIL  167



>emb|CDM82643.1| unnamed protein product [Triticum aestivum]
Length=507

 Score =   231 bits (588),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID A++   D RL+TKY+NA+YV++RA ALY  EE+A SFNGGKDSTVL HL+RAGYY
Sbjct  1    MEIDAAVQASSDGRLRTKYDNAVYVVQRAFALYPFEEIAFSFNGGKDSTVLLHLIRAGYY  60

Query  357  LHESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            LH++    S+GD          P+RTIYFE+  AFPEINSFTYE  + Y L ++ IR DF
Sbjct  61   LHKT----SSGDEAQINTVQNCPLRTIYFETPCAFPEINSFTYETVSTYGLPLETIRSDF  116

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK    KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  117  KSGLEGLLKEKSTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  166



>gb|ADE76044.1| unknown [Picea sitchensis]
Length=523

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 129/168 (77%), Gaps = 1/168 (1%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEI+KA+ E  D+RL  KY  +IYVIKR L LYS +EVA SFNGGKDSTVL HLLRAGY 
Sbjct  1    MEIEKAVVESGDKRLLAKYRQSIYVIKRTLTLYSFDEVAFSFNGGKDSTVLLHLLRAGYA  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
              E+ + H   +    ++  PIRTIYF++  AF EIN+FTYE A  Y+LQM+IIRLDFKS
Sbjct  61   SVETAE-HGGSEHVCSKLKHPIRTIYFDNPGAFQEINAFTYETAKTYDLQMEIIRLDFKS  119

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE LLK  P+KAI LG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  120  GLEELLKEKPVKAILLGTRIGDPNAVGQEQFSPSSEGWPPFMRVNPIL  167



>ref|XP_006645728.1| PREDICTED: probable FAD synthase-like [Oryza brachyantha]
Length=263

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 126/169 (75%), Gaps = 3/169 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            ME++ A+R   D  ++ KY  A+YV++RA ALY  +E+A SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEVEAAVRASGDSVMRAKYGRAVYVVQRAFALYPFDEIAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIP-FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH +     NGD     I   P+RTIYFE  +AFPEINSFTY+ A+ Y L ++ IR DFK
Sbjct  61   LHRTSS--GNGDQTDCTIQNCPMRTIYFEDPTAFPEINSFTYDTASTYGLPLETIRTDFK  118

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLE+LLK    KAIFLG R GDP AVGQE+FSPSSPGWPPFMRVNPIL
Sbjct  119  SGLEALLKEKLTKAIFLGTRNGDPNAVGQEEFSPSSPGWPPFMRVNPIL  167



>gb|EPS72355.1| hypothetical protein M569_02401, partial [Genlisea aurea]
Length=145

 Score =   216 bits (551),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 127/146 (87%), Gaps = 1/146 (1%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKA+RE DD+RLK KY++AIYVI+RALALYS+EE+ALSFNGGKDSTVL HLLRAG+Y
Sbjct  1    MEIDKAMRETDDKRLKRKYDSAIYVIRRALALYSVEELALSFNGGKDSTVLLHLLRAGFY  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH+S +  S+      EI FPI+ IYFESSSAF EINSFTY++ ++Y LQM+IIR+D KS
Sbjct  61   LHKSREDSSSCTTEDAEI-FPIQAIYFESSSAFAEINSFTYDMCSIYKLQMEIIRVDLKS  119

Query  537  GLESLLKANPIKAIFLGVRIGDPTAV  614
            GLE+LL++ PI+AIFLGVRIGDPTAV
Sbjct  120  GLEALLRSKPIRAIFLGVRIGDPTAV  145



>ref|XP_003565609.1| PREDICTED: probable FAD synthase [Brachypodium distachyon]
Length=260

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 124/169 (73%), Gaps = 3/169 (2%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEID+A+R   D R++ KY+ A+Y I+RA ALY  +E A SFNGGKDSTVL HLLRA YY
Sbjct  1    MEIDRAVRASSDSRMRAKYDRAVYAIQRAFALYPFDETAFSFNGGKDSTVLLHLLRASYY  60

Query  357  LHE-SEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFK  533
            LH+ S  C    D      P  IRTIYFE  +AFPEI++FTY+ AA+Y L ++ I  DFK
Sbjct  61   LHKVSSGCGDQMDNTIQNCP--IRTIYFEDPTAFPEIDAFTYDTAAVYGLPLESINTDFK  118

Query  534  SGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            SGLE+LLK  PIKAIFLG R GDP AV QEQFSPSS  WPPFMRVNPIL
Sbjct  119  SGLEALLKEKPIKAIFLGTRNGDPNAVDQEQFSPSSASWPPFMRVNPIL  167



>ref|XP_010558185.1| PREDICTED: FAD synthase isoform X5 [Tarenaya hassleriana]
 ref|XP_010558186.1| PREDICTED: FAD synthase isoform X5 [Tarenaya hassleriana]
Length=477

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 117/136 (86%), Gaps = 4/136 (3%)
 Frame = +3

Query  273  YSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSA  452
            + IEEVA SFNGGKDSTVL HLLRAGY+LH+ E+  SNG L      FP+RTIYFES SA
Sbjct  10   FLIEEVAFSFNGGKDSTVLLHLLRAGYFLHKKEQSCSNGGLSL----FPVRTIYFESPSA  65

Query  453  FPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFS  632
            FPEIN FTY+ A  YNLQ+DIIR DFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFS
Sbjct  66   FPEINGFTYDTAETYNLQLDIIRQDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFS  125

Query  633  PSSPGWPPFMRVNPIL  680
            PSSPGWPPFMRVNPIL
Sbjct  126  PSSPGWPPFMRVNPIL  141



>ref|XP_008675798.1| PREDICTED: probable FAD synthase [Zea mays]
 tpg|DAA54108.1| TPA: hypothetical protein ZEAMMB73_017601 [Zea mays]
Length=261

 Score =   216 bits (550),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 128/172 (74%), Gaps = 8/172 (5%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEI++A+R   D RL+ KY+ A+Y+I+RA ALY  EE+A SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIERAVRGSGDARLRAKYDAAVYIIRRAYALYPFEELAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIP----FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRL  524
            LH +    S+GD+    +      P+RTIYFE   AFP I+ FTYE A+ Y L ++ IR 
Sbjct  61   LHRT----SSGDVDSTALQTVKNCPMRTIYFEDPDAFPAIDRFTYETASTYGLPLETIRT  116

Query  525  DFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
             +KSGLE+LL+  P KAIFLG R GDP AVGQ++FSPSSPGWPPFMRVNPIL
Sbjct  117  GYKSGLEALLEEKPTKAIFLGTRNGDPNAVGQQEFSPSSPGWPPFMRVNPIL  168



>ref|XP_006381393.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
 gb|ERP59190.1| hypothetical protein POPTR_0006s12490g [Populus trichocarpa]
Length=482

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 116/134 (87%), Gaps = 4/134 (3%)
 Frame = +3

Query  279  IEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFP  458
            IEEVA SFNGGKDSTVL HLLRAGY+LH+ E+  SNG L      FPIRTIYFESS+AFP
Sbjct  13   IEEVAFSFNGGKDSTVLLHLLRAGYFLHKMEQKCSNGGL----TSFPIRTIYFESSAAFP  68

Query  459  EINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPS  638
            EINSFTY+ A+ Y LQ+DII  DFKSGLE LLKANPI+AIFLGVRIGDPTAVGQEQFSPS
Sbjct  69   EINSFTYDTASSYGLQLDIISSDFKSGLEKLLKANPIRAIFLGVRIGDPTAVGQEQFSPS  128

Query  639  SPGWPPFMRVNPIL  680
            SPGWPPFMRVNPIL
Sbjct  129  SPGWPPFMRVNPIL  142



>ref|XP_008673877.1| PREDICTED: probable FAD synthase [Zea mays]
Length=259

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 125/174 (72%), Gaps = 9/174 (5%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEI++A+R   D RL+ KY+ A+Y+++RA ALY  EE+A SFNGGKDSTVL HLLRAGYY
Sbjct  1    MEIEQAMRGSSDVRLRAKYDAAVYIVRRAYALYPFEELAFSFNGGKDSTVLLHLLRAGYY  60

Query  357  LHESEKCHSNGDLGYGEIPF------PIRTIYFESSSAFPEINSFTYEIAAMYNLQMDII  518
            LH   +  S GD+             P+RTIYFE   AFPEI+ FTYE A+ Y L ++ I
Sbjct  61   LH---RASSGGDVDDDSTVLQTVKNCPMRTIYFEDPDAFPEIDCFTYETASTYGLPLESI  117

Query  519  RLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            R  +KSGLE+LLK  P KAI LG R GDP AVGQ++FSPSSP WPPFMRVNPIL
Sbjct  118  RTGYKSGLEALLKEKPTKAILLGTRNGDPNAVGQQEFSPSSPDWPPFMRVNPIL  171



>ref|XP_009122698.1| PREDICTED: FAD synthase-like isoform X1 [Brassica rapa]
Length=461

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 114/134 (85%), Gaps = 4/134 (3%)
 Frame = +3

Query  279  IEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFP  458
            +EEVA SFNGGKDSTVL HLLRAGY+LH+ E   SNG L      FP+RTIYFES SAF 
Sbjct  1    MEEVAFSFNGGKDSTVLLHLLRAGYFLHKKELSCSNGGLS----SFPVRTIYFESPSAFT  56

Query  459  EINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPS  638
            EIN+FTY+ A  Y +Q+DIIR DFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPS
Sbjct  57   EINAFTYDAAQTYGIQLDIIRQDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPS  116

Query  639  SPGWPPFMRVNPIL  680
            SPGWPPFMRVNPIL
Sbjct  117  SPGWPPFMRVNPIL  130



>ref|XP_006645729.1| PREDICTED: probable FAD synthase-like [Oryza brachyantha]
Length=242

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            ++ KY+ A+YV++RA ALY  +E+A SFNGGKDSTVL HLLRAGYYLH +     NGD  
Sbjct  1    MRAKYDRAVYVVQRAFALYPFDEIAFSFNGGKDSTVLLHLLRAGYYLHRTSS--GNGDQT  58

Query  399  YGEIP-FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKA  575
               I   P+RTIYFE  +AFPEINSFTY+ A+ Y L ++ IR DFKSGLE+LLK    KA
Sbjct  59   DCTIQNCPMRTIYFEDPTAFPEINSFTYDTASTYGLPLETIRTDFKSGLEALLKEKLTKA  118

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            IFLG R GDP AVGQE+FSPSSPGWPPFMRVNPIL
Sbjct  119  IFLGTRNGDPNAVGQEEFSPSSPGWPPFMRVNPIL  153



>tpg|DAA54007.1| TPA: hypothetical protein ZEAMMB73_776808 [Zea mays]
Length=394

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 126/175 (72%), Gaps = 9/175 (5%)
 Frame = +3

Query  174  AMEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGY  353
            AMEI++A+R   D RL+ KY+ A+Y+++RA ALY  EE+A SFNGGKDSTVL HLLRAGY
Sbjct  135  AMEIEQAMRGSSDVRLRAKYDAAVYIVRRAYALYPFEELAFSFNGGKDSTVLLHLLRAGY  194

Query  354  YLHESEKCHSNGDLGYGEIPF------PIRTIYFESSSAFPEINSFTYEIAAMYNLQMDI  515
            YLH   +  S GD+             P+RTIYFE   AFPEI+ FTYE A+ Y L ++ 
Sbjct  195  YLH---RASSGGDVDDDSTVLQTVKNCPMRTIYFEDPDAFPEIDCFTYETASTYGLPLES  251

Query  516  IRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            IR  +KSGLE+LLK  P KAI LG R GDP AVGQ++FSPSSP WPPFMRVNPIL
Sbjct  252  IRTGYKSGLEALLKEKPTKAILLGTRNGDPNAVGQQEFSPSSPDWPPFMRVNPIL  306



>ref|XP_002976522.1| hypothetical protein SELMODRAFT_54778, partial [Selaginella moellendorffii]
 gb|EFJ22191.1| hypothetical protein SELMODRAFT_54778, partial [Selaginella moellendorffii]
Length=414

 Score =   213 bits (542),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 125/168 (74%), Gaps = 6/168 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEI +A+    DRRL+ KY +A++VI R LALY  +EVA SFNGGKDSTVL HLLRAGY 
Sbjct  1    MEICRAVDASCDRRLQAKYKHAMFVIDRTLALYRPDEVAFSFNGGKDSTVLLHLLRAGYA  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
              +S+           +    IRTIYFE   AFPEI+SFTYE A  YNL+++++R DFKS
Sbjct  61   ALKSKLSLP------ADAEDRIRTIYFEGPDAFPEIDSFTYETAQEYNLELEVLRQDFKS  114

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  115  GLEALLKNKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  162



>ref|XP_002973384.1| hypothetical protein SELMODRAFT_54760, partial [Selaginella moellendorffii]
 gb|EFJ25758.1| hypothetical protein SELMODRAFT_54760, partial [Selaginella moellendorffii]
Length=414

 Score =   210 bits (534),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 124/168 (74%), Gaps = 6/168 (4%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEI +A+    DRRL+ KY +A++VI R LALY  +EVA SFNGGKDSTVL HLLRAG  
Sbjct  1    MEICRAVDASCDRRLQAKYKHAMFVIDRTLALYRPDEVAFSFNGGKDSTVLLHLLRAGCA  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
              +S+           +    IRTIYFE   AFPEI+SFTYE A  YNL+++++R DFKS
Sbjct  61   ALKSKLSLP------ADAEDRIRTIYFEGPDAFPEIDSFTYETAQEYNLELEVLRQDFKS  114

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE+LLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  115  GLEALLKNKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  162



>gb|EEE54271.1| hypothetical protein OsJ_01171 [Oryza sativa Japonica Group]
Length=497

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 124/170 (73%), Gaps = 11/170 (6%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRAL-ALYSIEEVALSFNGGKDSTVLFHLLRAGY  353
            MEID+A+R   DRRL+TKY+NA+YV++RA  A   + ++  +        VL HLLRAGY
Sbjct  1    MEIDRAVRGSSDRRLRTKYDNAVYVVQRAFRASTRLRKLPSAL------MVLLHLLRAGY  54

Query  354  YLHESEKCHSNGDLGYGEIP-FPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDF  530
            YLH+S    S+G++    I   P+RTIYFES  AFPEINSFTYE  + Y L ++ IR DF
Sbjct  55   YLHKSS---SDGEVEMNTIQNCPVRTIYFESPCAFPEINSFTYETVSTYGLPLETIRSDF  111

Query  531  KSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KSGLE LLK  P KAIF+G RIGDP AVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  112  KSGLEGLLKERPTKAIFIGTRIGDPNAVGQEQFSPSSPGWPPFMRVNPIL  161



>ref|XP_010558189.1| PREDICTED: FAD synthase isoform X7 [Tarenaya hassleriana]
 ref|XP_010558190.1| PREDICTED: FAD synthase isoform X7 [Tarenaya hassleriana]
 ref|XP_010558191.1| PREDICTED: FAD synthase isoform X7 [Tarenaya hassleriana]
Length=451

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 4/112 (4%)
 Frame = +3

Query  345  AGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRL  524
            AGY+LH+ E+  SNG L      FP+RTIYFES SAFPEIN FTY+ A  YNLQ+DIIR 
Sbjct  8    AGYFLHKKEQSCSNGGLSL----FPVRTIYFESPSAFPEINGFTYDTAETYNLQLDIIRQ  63

Query  525  DFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            DFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  64   DFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  115



>ref|XP_010558187.1| PREDICTED: FAD synthase isoform X6 [Tarenaya hassleriana]
Length=470

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 96/112 (86%), Gaps = 4/112 (4%)
 Frame = +3

Query  345  AGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRL  524
            AGY+LH+ E+  SNG L      FP+RTIYFES SAFPEIN FTY+ A  YNLQ+DIIR 
Sbjct  27   AGYFLHKKEQSCSNGGLSL----FPVRTIYFESPSAFPEINGFTYDTAETYNLQLDIIRQ  82

Query  525  DFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            DFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  83   DFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  134



>ref|XP_010423718.1| PREDICTED: FAD synthase-like isoform X2 [Camelina sativa]
Length=436

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 89/104 (86%), Gaps = 4/104 (4%)
 Frame = +3

Query  369  EKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLES  548
            E+  SNG L      FP+RTIYFES SAF EIN+FTY+ A  YNLQ+DIIR DFKSGLE+
Sbjct  3    EQSCSNGGLS----SFPVRTIYFESPSAFTEINAFTYDAAQTYNLQLDIIRQDFKSGLEA  58

Query  549  LLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  59   LLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  102



>ref|XP_005843031.1| hypothetical protein CHLNCDRAFT_28612 [Chlorella variabilis]
 gb|EFN50929.1| hypothetical protein CHLNCDRAFT_28612 [Chlorella variabilis]
Length=372

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 105/175 (60%), Gaps = 11/175 (6%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGY-  353
            ME+  AI  C+D RLK ++  AI ++ RAL LY    VA SFNGGKDSTVL HLLRA   
Sbjct  1    MEVLTAIEGCEDTRLKARFLKAISLVSRALDLYGTRGVAFSFNGGKDSTVLLHLLRATVA  60

Query  354  ---YLHESEKCHSNG---DLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDI  515
                LHE+     NG   DL  G     + T +F   + FPEI  FT+E    Y L M+I
Sbjct  61   QRQRLHEATVGTPNGFCDDLPLG----GVLTFFFHHDTDFPEILEFTHETNKQYGLCMEI  116

Query  516  IRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            +  DFK GLE LL+   I+ I LG R GDP A  QE F PSS GWPPFMR+NPIL
Sbjct  117  LTGDFKQGLEQLLQQTHIQGIILGTRRGDPNAADQETFCPSSVGWPPFMRINPIL  171



>ref|XP_011400676.1| FAD synthase [Auxenochlorella protothecoides]
 gb|KFM27689.1| FAD synthase [Auxenochlorella protothecoides]
Length=517

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 108/167 (65%), Gaps = 1/167 (1%)
 Frame = +3

Query  180  EIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYL  359
            ++ +A+    D R+K K+ +AI V++RA+ALY +  +A SFNGGKDSTVL H++RA   +
Sbjct  3    DVLEAVARLTDDRVKAKFESAISVVERAIALYGLPSLAFSFNGGKDSTVLLHIIRAAVAM  62

Query  360  HESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSG  539
            HE            G +   + T +F++ + F E+ +FTY   A YNLQ+  +   F+ G
Sbjct  63   HEQASPSGAAQAKVGGLSDMV-TFFFDNPADFREVVAFTYATGAEYNLQLKSLHGGFRQG  121

Query  540  LESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            LE+LL++  +KAI LG R GDP AV QE F PSS GWPPFMRVNP+L
Sbjct  122  LEALLESTSVKAILLGTRKGDPNAVDQETFCPSSAGWPPFMRVNPVL  168



>ref|XP_005646168.1| hypothetical protein COCSUDRAFT_17414, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21624.1| hypothetical protein COCSUDRAFT_17414, partial [Coccomyxa subellipsoidea 
C-169]
Length=573

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 104/168 (62%), Gaps = 0/168 (0%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEI +AI    D  LK K+  A+  ++R + LY +  +A SFNGGKDSTV+ H+LRA   
Sbjct  2    MEIVQAIEALQDSHLKIKFFKAVTNVQRTVDLYGVTALAFSFNGGKDSTVVLHVLRAAMA  61

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            L  +     NG   YG     I + +FE    F E+  F + + A Y LQ+  +  DFK+
Sbjct  62   LRNAGLPLCNGSAVYGPGLGGILSFFFERRDDFTEVLEFVHAMNAQYELQVRKMHGDFKA  121

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            GLE L+  + ++AIFLG R GDP A GQ++F PSSPGWPPFMRVNPIL
Sbjct  122  GLEQLVSVSGVRAIFLGTRRGDPNAHGQDEFCPSSPGWPPFMRVNPIL  169



>gb|KHG16140.1| FAD synthase [Gossypium arboreum]
Length=454

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 95/168 (57%), Gaps = 58/168 (35%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            MEIDKAIRE DD+RLKTKYNNAIYVIKRALALYSIEEVA SFNGGKDSTVL HLLRAGY+
Sbjct  1    MEIDKAIRESDDKRLKTKYNNAIYVIKRALALYSIEEVAFSFNGGKDSTVLLHLLRAGYF  60

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKS  536
            LH  E+  SNG     +I FPIRTIYFES+S                             
Sbjct  61   LHRVEQSCSNG----VQIDFPIRTIYFESTSV----------------------------  88

Query  537  GLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            G E    ++P                          GWPPFMRVNPIL
Sbjct  89   GQEQFSPSSP--------------------------GWPPFMRVNPIL  110



>gb|EYU29880.1| hypothetical protein MIMGU_mgv1a0051982mg, partial [Erythranthe 
guttata]
Length=404

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +3

Query  495  YNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNP  674
            Y LQMDIIRLDFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNP
Sbjct  1    YKLQMDIIRLDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNP  60

Query  675  IL  680
            +L
Sbjct  61   VL  62



>ref|XP_002958238.1| hypothetical protein VOLCADRAFT_99481 [Volvox carteri f. nagariensis]
 gb|EFJ40692.1| hypothetical protein VOLCADRAFT_99481 [Volvox carteri f. nagariensis]
Length=632

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 97/175 (55%), Gaps = 15/175 (9%)
 Frame = +3

Query  177  MEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY  356
            M+I + I    D  +  K   A+ V++R  ALY ++++A SFNGGKDSTVL HLLRA   
Sbjct  1    MDILQQIDSIPDPVVADKACKAVQVLRRTCALYPLDKIAFSFNGGKDSTVLLHLLRAA--  58

Query  357  LHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAM------YNLQMDII  518
            + + E C   G LG       I++ YF +   FPE+  F     A       Y L ++ +
Sbjct  59   VAQLENCTDLGGLGG------IKSFYFCNDDDFPEVKDFVQRTDAECVQSVGYGLCVEYL  112

Query  519  RL-DFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            RL DFK GL   L    + AI LG R GDP    Q+ F PSS GWPPFMRVNPI+
Sbjct  113  RLSDFKRGLCEYLDRTGVMAIVLGTRRGDPNGGNQDCFCPSSDGWPPFMRVNPII  167



>ref|XP_001693086.1| FAD synthetase [Chlamydomonas reinhardtii]
 gb|EDP03655.1| FAD synthetase [Chlamydomonas reinhardtii]
Length=578

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 85/152 (56%), Gaps = 9/152 (6%)
 Frame = +3

Query  228  KYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGE  407
            K   AI  ++R  ALY +E++A SFNGGKDSTVL HLLRA     E+ K    G  G G 
Sbjct  19   KSKKAIACLRRTCALYPLEKIAFSFNGGKDSTVLLHLLRAAVAQQEAAK----GSAGLGG  74

Query  408  IPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDII-RLDFKSGLESLLKANPIKAIFL  584
            +     + YF     F E+ +F       Y L ++ +   DFK GL   L+   + AI L
Sbjct  75   M----LSFYFRQKDDFAEVKAFVEGADKAYGLDVEYLSEQDFKKGLCEYLERTGVMAIVL  130

Query  585  GVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            G R GDP A GQ+ F PSS GWP FMRVNPIL
Sbjct  131  GTRRGDPNAGGQDVFCPSSEGWPAFMRVNPIL  162



>ref|XP_006339086.1| PREDICTED: uncharacterized protein LOC102587202 isoform X2 [Solanum 
tuberosum]
Length=403

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/58 (95%), Positives = 58/58 (100%), Gaps = 0/58 (0%)
 Frame = +3

Query  507  MDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            MDI+RLDFKSGLE+LLKANPI+AIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL
Sbjct  1    MDILRLDFKSGLEALLKANPIRAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  58



>ref|XP_002907427.1| FAD synthetase, putative [Phytophthora infestans T30-4]
 gb|EEY63991.1| FAD synthetase, putative [Phytophthora infestans T30-4]
Length=291

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 96/190 (51%), Gaps = 33/190 (17%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLR---AGYYLHESEKCH  380
            D  ++ +   A+ V++ A+ ++ +E V  SFNGGKDSTV+ HLLR   A   L E++  H
Sbjct  22   DAAMQKRLQKALDVMRSAIDIFGLEGVCFSFNGGKDSTVVLHLLRIVVAKRVLEEAQLAH  81

Query  381  SNGD-----------------------LGYGEIPFPIRT-------IYFESSSAFPEINS  470
               +                       L   E+   ++T       +YF+S   FPE+  
Sbjct  82   LKAEQEAENGPKTTVTSPRNSFVSADLLQEEELEARVKTQLQRVPVMYFDSYDQFPEVRE  141

Query  471  FTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGW  650
            FT E    + L   + +  F  G++ +L    +K I++GVR GDP     E FSPSSPGW
Sbjct  142  FTEECNTKFALSCHVYKCSFVEGVKDILDKLQVKGIYMGVRGGDPYTEDMEHFSPSSPGW  201

Query  651  PPFMRVNPIL  680
            PPF+RVNPIL
Sbjct  202  PPFLRVNPIL  211



>ref|XP_009517847.1| hypothetical protein PHYSODRAFT_477086 [Phytophthora sojae]
 gb|EGZ30572.1| hypothetical protein PHYSODRAFT_477086 [Phytophthora sojae]
Length=291

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 96/190 (51%), Gaps = 33/190 (17%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLR---AGYYLHESEKCH  380
            D  ++ +   A+ V++ A+ ++ +E V  SFNGGKDSTV+ HLLR   A   L E+E+ H
Sbjct  22   DAAMQKRLQQALDVMRSAIDIFGLEGVCFSFNGGKDSTVVLHLLRIVVAKRVLEEAEQEH  81

Query  381  SNGD-----------------------LGYGEIPFPIRT-------IYFESSSAFPEINS  470
            +                          L   E+   ++        +YF+S   FPE+  
Sbjct  82   ARAQHEAEDDHKTTVTSPRNSFVSVDLLQEDELEARVQAQLQRVPVMYFDSHDQFPEVRD  141

Query  471  FTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGW  650
            FT      + L   + +  F  G++ +L+   IK +++GVR GDP     E FSPSSPGW
Sbjct  142  FTELCTKKFALSCHVYKCSFVEGVKDILEKLKIKGVYMGVRGGDPYTEDMEHFSPSSPGW  201

Query  651  PPFMRVNPIL  680
            PPF+RVNPIL
Sbjct  202  PPFLRVNPIL  211



>ref|XP_008897008.1| hypothetical protein PPTG_05248 [Phytophthora parasitica INRA-310]
 gb|ETI34348.1| hypothetical protein F443_19137 [Phytophthora parasitica P1569]
 gb|ETK74693.1| hypothetical protein L915_18560 [Phytophthora parasitica]
 gb|ETL28113.1| hypothetical protein L916_18461 [Phytophthora parasitica]
 gb|ETL81350.1| hypothetical protein L917_18289 [Phytophthora parasitica]
 gb|ETM34562.1| hypothetical protein L914_18375 [Phytophthora parasitica]
 gb|ETN17446.1| hypothetical protein PPTG_05248 [Phytophthora parasitica INRA-310]
 gb|ETO63126.1| hypothetical protein F444_19093 [Phytophthora parasitica P1976]
 gb|ETP04253.1| hypothetical protein F441_18949 [Phytophthora parasitica CJ01A1]
 gb|ETP32365.1| hypothetical protein F442_18913 [Phytophthora parasitica P10297]
Length=291

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 95/190 (50%), Gaps = 33/190 (17%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLR---AGYYLHESEKCH  380
            D  ++ +   A+ V++ A+ ++ +E V  SFNGGKDSTV+ HLLR   A   L E++  H
Sbjct  22   DVAMQKRLQKALDVVRSAIDIFGLEGVCFSFNGGKDSTVVLHLLRIVVAKRVLEEAQLAH  81

Query  381  SNGD-----------------------LGYGEIPFPIR-------TIYFESSSAFPEINS  470
               +                       L   E+   ++        +YF+S   FPE+  
Sbjct  82   LKAEQEALDGPKTTVTSPRNSFVSADILQEEELEARVKAQLQRVPVMYFDSYDQFPEVRE  141

Query  471  FTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGW  650
            FT E    + L   + +  F  G++ +L    IK I++GVR GDP     E FSPSSPGW
Sbjct  142  FTEECTKKFALSCHVYKCSFVEGVKDILDKLKIKGIYMGVRGGDPYTEDMEHFSPSSPGW  201

Query  651  PPFMRVNPIL  680
            PPF+RVNPIL
Sbjct  202  PPFLRVNPIL  211



>ref|XP_003286734.1| hypothetical protein DICPUDRAFT_31417 [Dictyostelium purpureum]
 gb|EGC36709.1| hypothetical protein DICPUDRAFT_31417 [Dictyostelium purpureum]
Length=287

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 97/162 (60%), Gaps = 7/162 (4%)
 Frame = +3

Query  207  DDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHL----LRAGYYLHESEK  374
            D      K  ++I  I  A   ++ +E++LSFNGGKD  VL HL    L+  +  +    
Sbjct  34   DKEDFYNKIKDSIETIMIAFNKFTFQEISLSFNGGKDCCVLLHLINYVLQKTFNNNNINC  93

Query  375  CHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLL  554
             +++    Y +    ++TIYF++ ++F ++N FT + +++YNL +  +    K GLE+++
Sbjct  94   HNNSNGNNYKD---GLKTIYFQTPNSFEQVNDFTEKCSSIYNLNILYVSSGIKEGLENII  150

Query  555  KANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
             +  IKA+F+G+R GDP +   E+FS + PGWP F+R+NPIL
Sbjct  151  DSQNIKAVFIGIRYGDPNSSHLEKFSVTDPGWPQFLRINPIL  192



>gb|EFA77806.1| hypothetical protein PPL_09304 [Polysphondylium pallidum PN500]
Length=247

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 84/158 (53%), Gaps = 0/158 (0%)
 Frame = +3

Query  207  DDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSN  386
            DD  L  K N +I  I+     Y  EE+AL FNGGKD  VL HL+         ++  +N
Sbjct  20   DDPSLIEKINKSIATIELTFNKYKFEEIALCFNGGKDCVVLLHLMNYVLVKRTKQQKDNN  79

Query  387  GDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP  566
             D       + +RT+YF S  +F E+  FT   + +YNL ++ I    K GLE  +  + 
Sbjct  80   IDNNNSIDSYKLRTLYFHSEDSFKEVTKFTDYCSKIYNLHVESIDKGLKDGLEQQVNMHS  139

Query  567  IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            IKAIF G R  DP +    +F+ + P WP F+RV+PIL
Sbjct  140  IKAIFAGTRSTDPYSSHLTEFTQTDPSWPQFIRVSPIL  177



>gb|KDO34763.1| hypothetical protein SPRG_00824 [Saprolegnia parasitica CBS 223.65]
Length=259

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 86/163 (53%), Gaps = 6/163 (4%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY------LHESE  371
            D  ++  +  +I V+ RA+ +  ++++  SFNGGKDSTV+ HLLR          L  ++
Sbjct  16   DADMRCAFQRSIEVLDRAIDILGLDKICFSFNGGKDSTVVLHLLRIAVAKRVLASLARTQ  75

Query  372  KCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESL  551
            +     +  Y      +  +YF ++  F E+N F     A Y LQ  +    F  G++++
Sbjct  76   QPPEAFEAAYHAAMQRMPVLYFHTTDQFAEVNDFISHCIATYGLQCGVQACSFMEGIQNI  135

Query  552  LKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            +    ++A  +GVR GDP     E F+PSS GWP F RVNPIL
Sbjct  136  MDKRGVQAFTMGVRKGDPFTDDLEHFAPSSKGWPAFFRVNPIL  178



>ref|WP_028830572.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=255

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 86/157 (55%), Gaps = 5/157 (3%)
 Frame = +3

Query  213  RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLR-AGYYLHESEKCHSNG  389
            RR  +    AI +I + L ++     + SFNGGKDSTV+ HLLR A Y   +S K     
Sbjct  39   RRFCSNVRGAIAMIDKLLDIFP-NSASFSFNGGKDSTVVLHLLRLAMYKRGKSGKIKPAL  97

Query  390  DLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPI  569
              G G     + T YF+S S F E   F    A  +++ +  ++  FK GLESL K + +
Sbjct  98   QTGAGG---ELITFYFDSDSCFDEEKEFVDSTATKFDISIMKLKCTFKEGLESLTKEHGV  154

Query  570  KAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KAIF+G R  DP     ++ S SSPGWP F+RVNP L
Sbjct  155  KAIFMGTRRADPDGKDIDKLSTSSPGWPAFLRVNPCL  191



>ref|XP_008605218.1| hypothetical protein SDRG_01471 [Saprolegnia diclina VS20]
 gb|EQC41504.1| hypothetical protein SDRG_01471 [Saprolegnia diclina VS20]
Length=265

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 87/166 (52%), Gaps = 9/166 (5%)
 Frame = +3

Query  201  ECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY------LH  362
            + D RR  T+   +I V+ RA+ +  ++++  SFNGGKDSTV+ HLLR          L 
Sbjct  16   DADTRRAFTR---SIEVLDRAIDILGLDKICFSFNGGKDSTVVLHLLRIAVAKRVLASLA  72

Query  363  ESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGL  542
             + +     D  Y      +  +YF ++  F E+N F     A Y LQ  +    F  G+
Sbjct  73   RTSQPPEAFDAAYHAAMQRMPVLYFHTTDQFAEVNDFISHCIATYGLQCGVQACSFMEGI  132

Query  543  ESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            +++ +   ++A  +GVR GDP     E F+PSS GWP F R+NPIL
Sbjct  133  QNIQETRGVQAFTMGVRKGDPFTDDLEHFAPSSKGWPAFFRINPIL  178



>gb|KDO17861.1| hypothetical protein SPRG_16733 [Saprolegnia parasitica CBS 223.65]
Length=252

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 85/163 (52%), Gaps = 6/163 (4%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYY------LHESE  371
            D   +  +  +I V+ RA+ +  ++++  SFNGGKDSTV+ HLLR          L  ++
Sbjct  16   DADTRCAFLRSIEVLDRAIDILGLDKICFSFNGGKDSTVVLHLLRIAVAKRVLASLARTQ  75

Query  372  KCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESL  551
            +     +  Y      +  +YF ++  F E+N F     A Y LQ  +    F  G++++
Sbjct  76   QPPEAFEAAYHAAMQRMPVLYFHTTDQFAEVNDFISHCIATYGLQCGVQACSFMEGIQNI  135

Query  552  LKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            +    ++A  +GVR GDP     E F+PSS GWP F RVNPIL
Sbjct  136  MDKRGVQAFTMGVRKGDPFTDDLEHFAPSSKGWPAFFRVNPIL  178



>ref|XP_639278.1| hypothetical protein DDB_G0282955 [Dictyostelium discoideum AX4]
 gb|EAL65921.1| hypothetical protein DDB_G0282955 [Dictyostelium discoideum AX4]
Length=300

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 101/191 (53%), Gaps = 21/191 (11%)
 Frame = +3

Query  165  RQEAMEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLR  344
            +++ +E +K   + +      K   +I  I+ A   +  +E+ALSFNGGKD  VL HL+ 
Sbjct  20   KKKFLEYEKHNNKINKEEFYNKIMESIETIECAFNKFEFQEIALSFNGGKDCCVLLHLI-  78

Query  345  AGYYLHESEKCHSNGDLGYGEIPFP------------------IRTIYFESSSAFPEINS  470
              Y L +  K   N                             ++TIYF++  +F ++N 
Sbjct  79   -NYVLLKKFKNTINNSCNNNNNINNNNNKNNNNNNQINNKRNGLKTIYFQTPDSFNQVNE  137

Query  471  FTYEIAAMYNLQM-DIIRLDFKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPG  647
            FT   +++YNL + ++  +  K GLE ++ +  IKA+F+G+R GDP ++  E+FS + PG
Sbjct  138  FTETCSSIYNLNLLEVSSIGIKEGLEKIITSENIKAVFIGIRFGDPNSLHLEKFSYTDPG  197

Query  648  WPPFMRVNPIL  680
            WP F+RVNPIL
Sbjct  198  WPHFLRVNPIL  208



>ref|XP_005411594.1| PREDICTED: FAD synthase isoform X1 [Chinchilla lanigera]
 ref|XP_005411595.1| PREDICTED: FAD synthase isoform X2 [Chinchilla lanigera]
Length=490

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 83/155 (54%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+ +I+ ALA Y + ++ L FNGGKD T L HL             H+     
Sbjct  279  LGKKVASALQIIEAALAQYHLTQLCLGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQM     D K  L  L + +P ++A
Sbjct  327  FPDVPKPLQILYIRSVSPFPELEQFLQDTIKRYNLQMLEAEGDMKQALGELQRRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSRSLCPFSPTDPGWPSFMRINPLL  421



>ref|NP_001103608.1| FAD synthase [Rattus norvegicus]
Length=490

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYHLSQICVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQM     + K  L  L   +P ++A
Sbjct  327  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGNMKQALGELQGKHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLHHFSPTDPGWPSFMRINPLL  421



>ref|XP_003040037.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU34324.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=198

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 93/178 (52%), Gaps = 6/178 (3%)
 Frame = +3

Query  162  CRQEAMEIDKAIRECDD----RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVL  329
            C +   ++D  + E  D    R ++ +   +I V+  AL  Y  E+++LS+NGGKD  VL
Sbjct  14   CIEIKDKVDAFLAEVPDTQILRDVQAQLRVSIGVVDEALEKYRPEQISLSYNGGKDCLVL  73

Query  330  FHLLRAGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQM  509
              ++ A      S+   +NG       P  ++ +Y  +S  FPEI+ F    +A YNL++
Sbjct  74   LIVILACMGKRYSQTTATNG-TSNSATPEKLQAVYIVASYPFPEIDEFVESSSAEYNLEV  132

Query  510  DIIRLDFKSGLESLLKANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
                L  K GLE  L+  P IKAIF+G R  DP       F P+  GWP FMRV+P++
Sbjct  133  ARYVLSMKKGLEIYLEERPSIKAIFVGTRRTDPHGENLTHFDPTDSGWPAFMRVHPVI  190



>gb|EDM00631.1| rCG62600, isoform CRA_a [Rattus norvegicus]
Length=552

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYHLSQICVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQM     + K  L  L   +P ++A
Sbjct  327  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGNMKQALGELQGKHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLHHFSPTDPGWPSFMRINPLL  421



>ref|XP_004629853.1| PREDICTED: FAD synthase [Octodon degus]
Length=490

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 83/155 (54%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+ +I+ ALA Y + ++ L FNGGKD T L HL    Y+     KC       
Sbjct  279  LGKKVASALQIIEAALAQYHLSQLCLGFNGGKDCTALLHL----YHAAVQRKCP------  328

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQ+       K  L  L + +P ++A
Sbjct  329  --DVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGGMKQALGELQRQHPQLQA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSRSLCSFSPTDPGWPAFMRINPLL  421



>ref|XP_010593100.1| PREDICTED: FAD synthase isoform X2 [Loxodonta africana]
Length=486

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YSI ++ + FNGGKD T L HL  A        KC +     
Sbjct  279  LGQKVAGALQTIETALARYSIAQLCVGFNGGKDCTALLHLFHAAV----QRKCPA-----  329

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                P P++ +Y  S S FPE+  F  +    YNLQ+   + D K  L  L   +P ++A
Sbjct  330  ---APEPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAQGDMKQALGELHTRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_003415157.2| PREDICTED: FAD synthase isoform X1 [Loxodonta africana]
 ref|XP_010593099.1| PREDICTED: FAD synthase isoform X1 [Loxodonta africana]
Length=490

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YSI ++ + FNGGKD T L HL  A        KC +     
Sbjct  279  LGQKVAGALQTIETALARYSIAQLCVGFNGGKDCTALLHLFHAAV----QRKCPA-----  329

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                P P++ +Y  S S FPE+  F  +    YNLQ+   + D K  L  L   +P ++A
Sbjct  330  ---APEPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAQGDMKQALGELHTRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>dbj|BAE73079.1| hypothetical protein [Macaca fascicularis]
Length=233

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  22   LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  69

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  70   LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  129

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  130  VLMGTRRTDPYSCSLCPFSPTDPGWPVFMRINPLL  164



>ref|XP_006153487.1| PREDICTED: FAD synthase isoform X1 [Tupaia chinensis]
 ref|XP_006153488.1| PREDICTED: FAD synthase isoform X2 [Tupaia chinensis]
 gb|ELW62438.1| FAD synthase [Tupaia chinensis]
Length=490

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALETIETALARYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L    P ++A
Sbjct  327  FPDVPKPLQILYIRSVSPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQTQYPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMRVNP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRVNPLL  421



>ref|XP_008262585.1| PREDICTED: FAD synthase isoform X1 [Oryctolagus cuniculus]
Length=490

 Score =   105 bits (262),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIESALARYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  327  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALGELQAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_005703934.1| FAD synthetase [Galdieria sulphuraria]
 gb|EME27414.1| FAD synthetase [Galdieria sulphuraria]
Length=486

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 80/151 (53%), Gaps = 9/151 (6%)
 Frame = +3

Query  228  KYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGE  407
            K   ++ V+  AL LY  E +ALSFNGGKD+TV+ HLLRA    H   +  S        
Sbjct  12   KVRESLQVLLGALRLYGTESLALSFNGGKDATVVMHLLRAAVGEHSQGREDSCSH-----  66

Query  408  IPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLG  587
                I  +YF  S  F ++  F   +   Y+L + +    F  GL+ +++   +K+  +G
Sbjct  67   ----INAVYFTDSDYFEQVELFVKAMRERYHLNLILQEGGFLQGLKIIVEERNMKSFTMG  122

Query  588  VRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
             R  DP     E F+PSS GWPPFMRVNPIL
Sbjct  123  TRRSDPDGKHLEHFTPSSQGWPPFMRVNPIL  153



>ref|XP_004667290.1| PREDICTED: FAD synthase [Jaculus jaculus]
Length=490

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 83/155 (54%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL+            H+     
Sbjct  279  LGKKVAGALQTIETALARYQLTQLCVGFNGGKDCTALLHLV------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S+S FPE+  F  +    Y+L++     + K  L  L K +P ++A
Sbjct  327  FPDVPKPLQILYIRSTSPFPELEQFLQDTVKRYDLRLLEAEGNMKQALSELQKQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPTFMRINPLL  421



>ref|XP_007946707.1| PREDICTED: FAD synthase [Orycteropus afer afer]
 ref|XP_007946708.1| PREDICTED: FAD synthase [Orycteropus afer afer]
Length=491

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+ +I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  280  LGQKVAGALQIIETALAQYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  333

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+   + D K  L  L   +P + A
Sbjct  334  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAQGDMKQALGELQARHPQLAA  387

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  388  VLMGTRRTDPYSCSLRPFSPTDPGWPSFMRINPLL  422



>ref|NP_796015.2| FAD synthase [Mus musculus]
 sp|Q8R123.1|FAD1_MOUSE RecName: Full=FAD synthase; AltName: Full=FAD pyrophosphorylase; 
AltName: Full=FMN adenylyltransferase; AltName: Full=Flavin 
adenine dinucleotide synthase; Includes: RecName: Full=Molybdenum 
cofactor biosynthesis protein-like region; Includes: 
RecName: Full=FAD synthase region [Mus musculus]
 gb|AAH25817.1| RFad1, flavin adenine dinucleotide synthetase, homolog (yeast) 
[Mus musculus]
 gb|AAH46769.1| RFad1, flavin adenine dinucleotide synthetase, homolog (yeast) 
[Mus musculus]
Length=492

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  281  LGKKVAGALQTIETALAQYHLSQLCVGFNGGKDCTALLHLF------------HAAVQRK  328

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L + +P ++A
Sbjct  329  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEA  388

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  389  VLMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLL  423



>dbj|BAC31952.1| unnamed protein product [Mus musculus]
 gb|EDL15200.1| RFad1, flavin adenine dinucleotide synthetase, homolog (yeast), 
isoform CRA_c [Mus musculus]
Length=518

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  281  LGKKVAGALQTIETALAQYHLSQLCVGFNGGKDCTALLHLF------------HAAVQRK  328

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L + +P ++A
Sbjct  329  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEA  388

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  389  VLMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLL  423



>ref|XP_004388605.1| PREDICTED: FAD synthase [Trichechus manatus latirostris]
Length=490

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+ +I+ ALA YS+ ++ + FNGGKD T L HL  A        KC +  +  
Sbjct  279  LGQKVAGALQIIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPAAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+   + D K  L  L   +P ++A
Sbjct  333  ------PLQILYVRSISPFPELEQFLQDTIKRYNLQVLEAQGDMKQALGELHARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP F+RVNP+L
Sbjct  387  VLMGTRRTDPYSCSLRPFSPTDPGWPSFVRVNPLL  421



>gb|EDL15199.1| RFad1, flavin adenine dinucleotide synthetase, homolog (yeast), 
isoform CRA_b [Mus musculus]
Length=541

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  330  LGKKVAGALQTIETALAQYHLSQLCVGFNGGKDCTALLHLF------------HAAVQRK  377

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L + +P ++A
Sbjct  378  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEA  437

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  438  VLMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLL  472



>ref|XP_005898727.1| PREDICTED: FAD synthase isoform X2 [Bos mutus]
 ref|XP_010836619.1| PREDICTED: LOW QUALITY PROTEIN: FAD synthase [Bison bison bison]
Length=446

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_006060993.1| PREDICTED: FAD synthase isoform X4 [Bubalus bubalis]
Length=446

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPELEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_005245560.1| PREDICTED: FAD synthase isoform X3 [Homo sapiens]
 gb|EAW53156.1| Fad1, flavin adenine dinucleotide synthetase, homolog (yeast), 
isoform CRA_d [Homo sapiens]
Length=320

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  109  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  156

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  157  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  216

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  217  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  251



>ref|XP_003795368.1| PREDICTED: FAD synthase isoform 1 [Otolemur garnettii]
 ref|XP_003795369.1| PREDICTED: FAD synthase isoform 2 [Otolemur garnettii]
Length=490

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA Y++ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVASALQTIETALARYNLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y    S FPE+  F  +    YNLQ+     + K  L  L   +P ++A
Sbjct  327  FPDVPKPLQILYIRGISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWPPF+RVNP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPPFLRVNPLL  421



>ref|XP_008046782.1| PREDICTED: FAD synthase [Tarsius syrichta]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGEKVAGALQTIETALAQYSLIQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L   +P ++A
Sbjct  327  FPDVPKPLQILYIRSVSPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMRVNP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRVNPLL  421



>gb|AAH20253.1| FLAD1 protein, partial [Homo sapiens]
Length=332

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  121  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  168

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  169  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  228

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  229  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  263



>ref|XP_002810135.1| PREDICTED: FAD synthase isoform X1 [Pongo abelii]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_009241813.1| PREDICTED: FAD synthase isoform X3 [Pongo abelii]
Length=479

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  268  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  315

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  316  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  375

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  376  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  410



>ref|XP_005677471.1| PREDICTED: FAD synthase isoform X1 [Capra hircus]
 ref|XP_005677472.1| PREDICTED: FAD synthase isoform X2 [Capra hircus]
 ref|XP_005677473.1| PREDICTED: FAD synthase isoform X3 [Capra hircus]
 ref|XP_005677474.1| PREDICTED: FAD synthase isoform X4 [Capra hircus]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQSRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPTFMRINPLL  421



>ref|XP_005898726.1| PREDICTED: FAD synthase isoform X1 [Bos mutus]
 ref|XP_005898728.1| PREDICTED: FAD synthase isoform X3 [Bos mutus]
Length=484

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|NP_001030211.2| FAD synthase [Bos taurus]
 ref|XP_010801185.1| PREDICTED: FAD synthase isoform X1 [Bos taurus]
 tpg|DAA31852.1| TPA: FAD1 flavin adenine dinucleotide synthetase homolog [Bos 
taurus]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_004026883.1| PREDICTED: FAD synthase isoform 1 [Gorilla gorilla gorilla]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_004988732.1| hypothetical protein PTSG_10768 [Salpingoeca rosetta]
 gb|EGD79783.1| hypothetical protein PTSG_10768 [Salpingoeca rosetta]
Length=332

 Score =   102 bits (253),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 73/147 (50%), Gaps = 16/147 (11%)
 Frame = +3

Query  240  AIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPFP  419
            AI  I+  + L+      LSFNGGKDST+L HL+   +               Y  I F 
Sbjct  11   AISTIRTTVELFGFSGTCLSFNGGKDSTLLLHLVMEAF------------PDDYRNITF-  57

Query  420  IRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANPIKAIFLGVRIG  599
               +YF     FP++  F       Y L +  +   + + LE LL    IKAIF+G R G
Sbjct  58   ---VYFRQEHEFPQVEDFIDMCDRRYGLSLQHLGSSYGTALEGLLSQTSIKAIFMGTRRG  114

Query  600  DPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            DP A   E F+PS PGWP FMRV+P+L
Sbjct  115  DPKADTLETFAPSDPGWPTFMRVHPVL  141



>ref|XP_005541697.1| PREDICTED: FAD synthase isoform X4 [Macaca fascicularis]
Length=429

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPVFMRINPLL  421



>dbj|BAE36639.1| unnamed protein product [Mus musculus]
Length=492

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  281  LGKKVAGALQTIETALAQYHLSQLCVGFNGGKDCTALLHLF------------HAAVQRK  328

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L + +P ++A
Sbjct  329  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEA  388

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  389  VQMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLL  423



>ref|XP_006060990.1| PREDICTED: FAD synthase isoform X1 [Bubalus bubalis]
 ref|XP_006060991.1| PREDICTED: FAD synthase isoform X2 [Bubalus bubalis]
 ref|XP_006060992.1| PREDICTED: FAD synthase isoform X3 [Bubalus bubalis]
Length=490

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPELEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_855063.1| PREDICTED: FAD synthase isoform X2 [Canis lupus familiaris]
 ref|XP_005622833.1| PREDICTED: FAD synthase isoform X1 [Canis lupus familiaris]
Length=490

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 85/172 (49%), Gaps = 14/172 (8%)
 Frame = +3

Query  168  QEAMEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRA  347
            Q+A E    + E  +  L  K   A+  I+ ALA Y +  + + FNGGKD T L HLL A
Sbjct  263  QQASEAVYKLAE-SESSLGKKVAGALQTIEGALAQYGLTHLCVGFNGGKDCTALLHLLHA  321

Query  348  GYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLD  527
                    KC    +        P++ +Y  S S FPE+  F  +    YNLQ+     D
Sbjct  322  AV----QRKCPDAQE--------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGD  369

Query  528  FKSGLESLLKANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
             K  L  L   +P ++A+ +G R  DP +     FSP+ PGWP FMRVNP+L
Sbjct  370  MKQALSELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRVNPLL  421



>ref|XP_009241807.1| PREDICTED: FAD synthase isoform X2 [Pongo abelii]
 ref|XP_009241809.1| PREDICTED: FAD synthase isoform X2 [Pongo abelii]
Length=488

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  277  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  324

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  325  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  384

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  385  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  419



>ref|XP_003259418.1| PREDICTED: FAD synthase isoform 1 [Nomascus leucogenys]
Length=490

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPDPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_008521339.1| PREDICTED: FAD synthase isoform X1 [Equus przewalskii]
Length=496

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  285  LGAKVAGALQTIETALARYSLPQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  338

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  +   +P ++A
Sbjct  339  ------PLQILYVRSISPFPELEQFLQDTIKRYNLQVLQAEGDMKQALSDMQTRHPQLEA  392

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  393  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  427



>sp|Q5RCH4.1|FAD1_PONAB RecName: Full=FAD synthase; AltName: Full=FAD pyrophosphorylase; 
AltName: Full=FMN adenylyltransferase; AltName: Full=Flavin 
adenine dinucleotide synthase; Includes: RecName: Full=Molybdenum 
cofactor biosynthesis protein-like region; Includes: 
RecName: Full=FAD synthase region [Pongo abelii]
 emb|CAH90533.1| hypothetical protein [Pongo abelii]
Length=491

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  280  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  327

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  328  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  387

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  388  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  422



>ref|XP_005245559.1| PREDICTED: FAD synthase isoform X2 [Homo sapiens]
Length=429

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_008521340.1| PREDICTED: FAD synthase isoform X2 [Equus przewalskii]
 ref|XP_008521341.1| PREDICTED: FAD synthase isoform X2 [Equus przewalskii]
Length=490

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGAKVAGALQTIETALARYSLPQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  +   +P ++A
Sbjct  333  ------PLQILYVRSISPFPELEQFLQDTIKRYNLQVLQAEGDMKQALSDMQTRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_001497976.1| PREDICTED: FAD synthase isoform X1 [Equus caballus]
 ref|XP_005610118.1| PREDICTED: FAD synthase isoform X2 [Equus caballus]
Length=490

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGAKVAGALQTIETALARYSLPQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  +   +P ++A
Sbjct  333  ------PLQILYVRSISPFPELEQFLQDTIKRYNLQVLQAEGDMKQALSDMQTRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_005367238.1| PREDICTED: FAD synthase [Microtus ochrogaster]
Length=490

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ AL  Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGRKVASALQTIETALDQYDLSKLCVGFNGGKDCTALLHLF------------HAAVQKR  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L + +P ++A
Sbjct  327  FPDVPKPLQILYIRSISTFPELEQFLQDTIKRYNLQVFEAEGNMKQALAELQEKHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLRHFSPTDPGWPSFMRINPLL  421



>ref|XP_005663396.1| PREDICTED: FAD synthase isoform X3 [Sus scrofa]
Length=446

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+ +I+ ALA YS+ ++ + FNGGKD T L HL  A       ++ H +    
Sbjct  279  LGRKVAGALQIIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV-----QRKHPDARE-  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>gb|ELR54237.1| FAD synthase, partial [Bos mutus]
Length=549

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  344  LGEKVAGALQTIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  397

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  398  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  451

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  452  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  486



>gb|AAB50199.1| unknown [Homo sapiens]
Length=437

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  226  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  273

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  274  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  333

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  334  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  368



>ref|NP_001171820.1| FAD synthase isoform 3 [Homo sapiens]
 gb|AAH11378.1| FLAD1 protein [Homo sapiens]
 gb|EAW53159.1| Fad1, flavin adenine dinucleotide synthetase, homolog (yeast), 
isoform CRA_g [Homo sapiens]
Length=446

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_005975126.1| PREDICTED: FAD synthase isoform X1 [Pantholops hodgsonii]
 ref|XP_005975127.1| PREDICTED: FAD synthase isoform X2 [Pantholops hodgsonii]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSVSPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQSRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLVGTRRTDPYSRSLCPFSPTDPGWPAFMRINPLL  421



>gb|EWM21421.1| fad synthetase [Nannochloropsis gaditana]
Length=741

 Score =   103 bits (258),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 67/185 (36%), Positives = 99/185 (54%), Gaps = 17/185 (9%)
 Frame = +3

Query  171  EAMEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAG  350
            +A+ + K +R  DD  +  K + A+ V+++AL LY    V  S+NGGKD+ V+ HLLRA 
Sbjct  92   DALTLYKTLRADDDSSMADKVHTALDVVEQALRLYGPSHVFASYNGGKDAVVVMHLLRAA  151

Query  351  YYLH----------ESEKCHSNGDLGYGEIPFPIRTIYFES-SSAFPEINSFTYEIAAMY  497
               H           ++   S+   G   IP P R +YFE  S+ FPE+ +   +    Y
Sbjct  152  LARHVQAYDLDSPAPADTASSSPSSGPSTIPRP-RLVYFEQPSTEFPEVKALVSQTTQRY  210

Query  498  NLQMDIIR-LDFKSGLESLLKAN---PIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR  665
            +L + + + + F  GL++ ++     P+ A  LG R GDP    QE F+PSS   P FMR
Sbjct  211  DLDLRVYQDVPFAQGLKACIEGEGGAPL-AFLLGTRKGDPNCKEQETFAPSSTWMPAFMR  269

Query  666  VNPIL  680
            VNPIL
Sbjct  270  VNPIL  274



>ref|XP_004002615.1| PREDICTED: FAD synthase isoform 1 [Ovis aries]
 ref|XP_004002616.1| PREDICTED: FAD synthase isoform 2 [Ovis aries]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQSRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSRSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_001114732.1| PREDICTED: FAD synthase-like isoform 2 [Macaca mulatta]
 ref|XP_001114826.1| PREDICTED: FAD synthase-like isoform 7 [Macaca mulatta]
 ref|XP_003892788.1| PREDICTED: FAD synthase isoform X1 [Papio anubis]
 ref|XP_005541694.1| PREDICTED: FAD synthase isoform X1 [Macaca fascicularis]
 ref|XP_005541695.1| PREDICTED: FAD synthase isoform X2 [Macaca fascicularis]
 ref|XP_009180713.1| PREDICTED: FAD synthase isoform X1 [Papio anubis]
 gb|EHH15300.1| hypothetical protein EGK_01368 [Macaca mulatta]
 gb|EHH50336.1| hypothetical protein EGM_01147 [Macaca fascicularis]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPVFMRINPLL  421



>ref|XP_008590919.1| PREDICTED: FAD synthase isoform X1 [Galeopterus variegatus]
Length=436

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  278  LGGKVAGALRTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  325

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + + P P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  326  FPDGPNPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALGELQVQHPQLEA  385

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  386  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  420



>ref|XP_007178527.1| PREDICTED: FAD synthase isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007178528.1| PREDICTED: FAD synthase isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  327  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_006976381.1| PREDICTED: FAD synthase isoform X1 [Peromyscus maniculatus bairdii]
 ref|XP_006976382.1| PREDICTED: FAD synthase isoform X2 [Peromyscus maniculatus bairdii]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ AL  Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVASALQTIETALDRYHLSKLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + + P P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L + +P ++A
Sbjct  327  FPDAPKPLQILYIHSISTFPELEQFLQDTIKRYNLQVLEAEGDMKQALGELQERHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLSSFSPTDPGWPSFMRINPLL  421



>ref|XP_001929410.3| PREDICTED: FAD synthase isoformX1 [Sus scrofa]
 ref|XP_003355186.1| PREDICTED: FAD synthase isoform X2 [Sus scrofa]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+ +I+ ALA YS+ ++ + FNGGKD T L HL  A       ++ H +    
Sbjct  279  LGRKVAGALQIIETALARYSLTQLCVGFNGGKDCTALLHLFHAAV-----QRKHPDAR--  331

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  332  -----EPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_007975099.1| PREDICTED: FAD synthase isoform X1 [Chlorocebus sabaeus]
 ref|XP_007975100.1| PREDICTED: FAD synthase isoform X1 [Chlorocebus sabaeus]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGEKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPVFMRINPLL  421



>ref|XP_004330633.1| PREDICTED: FAD synthase isoform 2 [Tursiops truncatus]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  327  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLGPFSPTDPGWPSFMRINPLL  421



>ref|XP_004284690.1| PREDICTED: FAD synthase isoform 2 [Orcinus orca]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  327  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLGPFSPTDPGWPSFMRINPLL  421



>ref|NP_958800.1| FAD synthase isoform 2 [Homo sapiens]
 gb|AAO49318.1|AF481877_1 FAD-synthetase [Homo sapiens]
 gb|AAH32323.1| FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) 
[Homo sapiens]
 gb|AAH21096.2| FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) 
[Homo sapiens]
 gb|EAW53155.1| Fad1, flavin adenine dinucleotide synthetase, homolog (yeast), 
isoform CRA_c [Homo sapiens]
 gb|ABM85078.1| FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) 
[synthetic construct]
 gb|AIC52390.1| FLAD1, partial [synthetic construct]
Length=490

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_007640443.1| PREDICTED: FAD synthase [Cricetulus griseus]
 ref|XP_007640444.1| PREDICTED: FAD synthase [Cricetulus griseus]
 ref|XP_007612619.1| PREDICTED: FAD synthase [Cricetulus griseus]
 ref|XP_007612620.1| PREDICTED: FAD synthase [Cricetulus griseus]
 gb|EGV98100.1| FAD synthetase [Cricetulus griseus]
Length=490

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ AL  Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVASALQTIETALDQYHLSKLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNLQ+     + K  L  L + +P ++A
Sbjct  327  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLL  421



>gb|ABM81905.1| FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) 
[synthetic construct]
Length=490

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  421



>ref|XP_003475639.2| PREDICTED: FAD synthase [Cavia porcellus]
Length=490

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+ +I+ ALA Y + ++ L FNGGKD T L HL             H+     
Sbjct  279  LGKKVASALQIIEAALARYHLTQLCLGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ ++  S S FPE+  F  +    YNLQ+     D K  L  L + +P ++A
Sbjct  327  FPDVPKPLQILHIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALGELQRLHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+  GWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDAGWPSFMRINPLL  421



>ref|XP_007108960.1| PREDICTED: FAD synthase isoform X2 [Physeter catodon]
Length=490

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  327  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_005855287.1| FAD synthetase [Nannochloropsis gaditana CCMP526]
 gb|EKU21065.1| FAD synthetase [Nannochloropsis gaditana CCMP526]
Length=683

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 99/185 (54%), Gaps = 17/185 (9%)
 Frame = +3

Query  171  EAMEIDKAIRECDDRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAG  350
            +A+ + K +R  DD  +  K + A+ V+++AL LY    V  S+NGGKD+ V+ HLLRA 
Sbjct  34   DALTLYKTLRADDDSSMADKVHTALDVVEQALRLYGPSHVFASYNGGKDAVVVMHLLRAA  93

Query  351  YYLH----------ESEKCHSNGDLGYGEIPFPIRTIYFES-SSAFPEINSFTYEIAAMY  497
               H           ++   S+   G   IP P R +YFE  S+ FPE+ +   +    Y
Sbjct  94   LARHVQAYDLDSPAPADTASSSPSSGPSTIPRP-RLVYFEQPSTEFPEVKALVSQTTQRY  152

Query  498  NLQMDIIR-LDFKSGLESLLKAN---PIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR  665
            +L + + + + F  GL++ ++     P+ A  LG R GDP    QE F+PSS   P FMR
Sbjct  153  DLDLRVYQDVPFAQGLKACIEGEGGAPL-AFLLGTRKGDPNCKEQETFAPSSTWMPAFMR  211

Query  666  VNPIL  680
            VNPIL
Sbjct  212  VNPIL  216



>ref|XP_008590926.1| PREDICTED: FAD synthase isoform X2 [Galeopterus variegatus]
Length=489

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  278  LGGKVAGALRTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  325

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + + P P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  326  FPDGPNPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALGELQVQHPQLEA  385

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  386  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  420



>gb|EHK45271.1| hypothetical protein TRIATDRAFT_38099 [Trichoderma atroviride 
IMI 206040]
Length=249

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 89/163 (55%), Gaps = 7/163 (4%)
 Frame = +3

Query  213  RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESE-KCHSNG  389
            RR + +   ++ V+  AL  Y  EE+++S+NGGKD  V+  +L A Y    S  K  +  
Sbjct  19   RRAQEQVRISVQVVDEALERYRPEEISISYNGGKDCLVMLIVLLACYARRYSPPKSVAGA  78

Query  390  DLGYGEI---PFP--IRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLL  554
            +L  G     PFP  + ++Y  S+  F E++ F  + +AMY+L +    L  K GLE   
Sbjct  79   NLQNGAPKLPPFPETLHSVYIVSADPFAEVDDFVEKSSAMYHLDVARFTLPMKKGLEVFK  138

Query  555  KANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
              NP ++AIF+G R  DP     + F P+  GWP FMR++P++
Sbjct  139  AQNPSVRAIFVGTRRTDPHGEKLKHFDPTDAGWPDFMRIHPVI  181



>ref|XP_005331372.1| PREDICTED: FAD synthase [Ictidomys tridecemlineatus]
Length=490

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALARYHLNQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F  +    YNL +     D K  L  L   +P ++A
Sbjct  327  FPDVPKPLQILYIRSISPFPELEQFLQDTIKRYNLHVLEAEGDMKQALCELQTQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_007458039.1| PREDICTED: FAD synthase isoform X2 [Lipotes vexillifer]
Length=490

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y LQ+     D K  L  L   +P ++A
Sbjct  327  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYGLQVLEAEGDMKQALSELRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>dbj|GAA97164.1| hypothetical protein E5Q_03840 [Mixia osmundae IAM 14324]
 gb|KEI42548.1| hypothetical protein L969DRAFT_91987 [Mixia osmundae IAM 14324]
Length=924

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 85/165 (52%), Gaps = 11/165 (7%)
 Frame = +3

Query  216  RLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRA-------GYYLHES--  368
            RL  + + A+ ++  AL  Y  ++++LSFNGGKD TV+ HLL A       G   H+S  
Sbjct  685  RLGKQVSEALRILTEALDTYGDDQISLSFNGGKDCTVILHLLAAAVCMRATGVRDHKSFK  744

Query  369  EKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLES  548
            E    NG       P  I+ +Y    S F E+ SF     A Y L++D +    KS L  
Sbjct  745  ESDRLNGAHAAAR-PTSIQCMYVRCDSPFDEVESFVETCRARYQLKIDKVAASMKSALAQ  803

Query  549  LLKANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
               ++P +KAI +G R GDP     + F  + P WP +MRV+PIL
Sbjct  804  YQSSHPAVKAIIVGTRRGDPHGASLDSFQSTDPDWPQYMRVHPIL  848



>emb|CCF35714.1| phosphoadenosine phosphosulfate reductase [Colletotrichum higginsianum]
Length=221

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 92/182 (51%), Gaps = 8/182 (4%)
 Frame = +3

Query  159  VCRQEAMEIDKAIRECDD----RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTV  326
            VC +    +D  + E       R ++ +   ++ V++ ALA YS+E++++S+NGGKD  V
Sbjct  33   VCNELRQRVDAFLAEDQKTEVLRNVQAQLRVSMAVVEEALARYSLEQISISYNGGKDCLV  92

Query  327  LFHLLRAGY---YLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMY  497
            L  +L A     Y   S+   +N   G    P   + +Y  S   F E++ F    ++ Y
Sbjct  93   LLIMLLACLARRYPSPSKPSQTNDSNGTTSFPDKFQAVYIVSKHPFAEVDDFVEATSSQY  152

Query  498  NLQMDIIRLDFKSGLESLLKANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNP  674
             L +    +  K GL + L+  P +KAIF+G R  DP       F P+  GWP FMRV+P
Sbjct  153  YLDVKRYLMSMKEGLGAYLEDRPNVKAIFVGTRRTDPHGEKLTHFDPTDSGWPDFMRVHP  212

Query  675  IL  680
            ++
Sbjct  213  VI  214



>ref|XP_004330632.1| PREDICTED: FAD synthase isoform 1 [Tursiops truncatus]
Length=566

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  355  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  402

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  403  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  462

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  463  VLMGTRRTDPYSCSLGPFSPTDPGWPSFMRINPLL  497



>ref|XP_004284689.1| PREDICTED: FAD synthase isoform 1 [Orcinus orca]
Length=566

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  355  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  402

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  403  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  462

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  463  VLMGTRRTDPYSCSLGPFSPTDPGWPSFMRINPLL  497



>ref|XP_010362970.1| PREDICTED: FAD synthase isoform X2 [Rhinopithecus roxellana]
Length=461

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ AL  YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALTQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPVFMRINPLL  421



>ref|XP_007272700.1| FAD synthetase [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA38258.1| FAD synthetase [Colletotrichum gloeosporioides Nara gc5]
Length=324

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 87/162 (54%), Gaps = 6/162 (4%)
 Frame = +3

Query  213  RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRA--GYYLHESEKCHSN  386
            R ++ +   ++ V+  ALA YS+E+++LS+NGGKD  VL  +L A        S+   SN
Sbjct  94   RNVQEQLRVSMGVVNEALATYSLEQISLSYNGGKDCLVLLIMLLACLARRFPSSKTNGSN  153

Query  387  GDLGYGE---IPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLK  557
            G  G  +    P   + +Y  S   F E++ F    +++Y+L +    +  K GLE+ L 
Sbjct  154  GSNGAADAKSFPDEFQAVYIVSKHPFAEVDDFVATTSSIYHLNVKRYAMSMKQGLEAYLA  213

Query  558  ANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
              P +KAIF+G R  DP       F P+  GWP FMRV+P++
Sbjct  214  DRPSVKAIFVGTRRTDPHGEKLTHFDPTDSGWPDFMRVHPVI  255



>ref|XP_007108959.1| PREDICTED: FAD synthase isoform X1 [Physeter catodon]
Length=566

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  355  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  402

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  403  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYSLQVLEAEGDMKQALSELRAQHPQLEA  462

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  463  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  497



>ref|NP_079483.3| FAD synthase isoform 1 [Homo sapiens]
 sp|Q8NFF5.1|FAD1_HUMAN RecName: Full=FAD synthase; AltName: Full=FAD pyrophosphorylase; 
AltName: Full=FMN adenylyltransferase; AltName: Full=Flavin 
adenine dinucleotide synthase; Includes: RecName: Full=Molybdenum 
cofactor biosynthesis protein-like region; Includes: 
RecName: Full=FAD synthase region; Flags: Precursor [Homo 
sapiens]
 gb|AAM77338.1|AF520568_1 unknown [Homo sapiens]
 gb|ABE65383.1| FAD synthetase isoform 1 [Homo sapiens]
 gb|EAW53158.1| Fad1, flavin adenine dinucleotide synthetase, homolog (yeast), 
isoform CRA_f [Homo sapiens]
Length=587

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ +LA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  376  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  423

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  424  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  483

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  484  VLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLL  518



>gb|KDN62794.1| putative phosphoadenosine phosphosulfate reductase [Colletotrichum 
sublineola]
Length=258

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 85/160 (53%), Gaps = 4/160 (3%)
 Frame = +3

Query  213  RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGY---YLHESEKCHS  383
            R ++++   ++ V++ AL  YS+E+++LS+NGGKD  VL  +L A     Y   S+   S
Sbjct  55   RNVQSQLRVSMGVVEEALERYSLEQISLSYNGGKDCLVLLIMLLACLARRYPSPSQSPRS  114

Query  384  NGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKAN  563
            N   G    P   + +Y  S   F E++ F    ++ Y+L +    +  K GL + L   
Sbjct  115  NDSNGATSFPSQFQAVYIVSKHPFAEVDDFVETTSSQYHLDVKRYAMSMKEGLGAYLADR  174

Query  564  P-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            P +KAIF+G R  DP       F P+  GWP FMRV+P++
Sbjct  175  PSVKAIFVGTRRTDPHGEKLTHFDPTDSGWPDFMRVHPVI  214



>ref|XP_007458038.1| PREDICTED: FAD synthase isoform X1 [Lipotes vexillifer]
Length=566

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L+ K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  355  LREKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQKK  402

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y LQ+     D K  L  L   +P ++A
Sbjct  403  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYGLQVLEAEGDMKQALSELRAQHPQLEA  462

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  463  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  497



>ref|XP_010362969.1| PREDICTED: FAD synthase isoform X1 [Rhinopithecus roxellana]
Length=490

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ AL  YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALTQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQM       K  L  L   +P ++A
Sbjct  327  LPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPVFMRINPLL  421



>ref|XP_006895890.1| PREDICTED: FAD synthase [Elephantulus edwardii]
Length=490

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 81/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I++ LA Y++ ++ + FNGGKD T L HL  A        KC       
Sbjct  279  LGQKVAGALQTIEKGLAQYTLTQLCVGFNGGKDCTALLHLFHAAV----RRKCP------  328

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++  P++ +Y +S + FPE+  F  +    YNL +   + D K  L  L   +P ++A
Sbjct  329  --DVQEPLQILYIQSIAPFPELEQFLQDTIKRYNLHVLEAQGDMKQALGELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMRVNP+L
Sbjct  387  VLMGTRRTDPYSCSLLPFSPTDPGWPSFMRVNPLL  421



>ref|XP_004363675.1| flavin adenine dinucleotide synthetase [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93109.1| flavin adenine dinucleotide synthetase [Capsaspora owczarzaki 
ATCC 30864]
Length=385

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 76/149 (51%), Gaps = 7/149 (5%)
 Frame = +3

Query  237  NAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPF  416
             A   I++AL +Y  + + LSFNGGKD  V+ HLL A        +C  +       +P 
Sbjct  154  QATTAIEQALQIYKTDTIMLSFNGGKDCMVVLHLLNAVLR----TRCGRHNAENSRHLPI  209

Query  417  PIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKAIFLGVR  593
            P   IY      F E+ SF  E A  Y++ +  I    K+GL  L K  P ++AIF G R
Sbjct  210  P--AIYLSFPDQFHEVESFVREAAQDYSMDLFTIDGSIKAGLTELSKQRPQVRAIFAGTR  267

Query  594  IGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
              DP +   E  +P+ P WP FMR+NPIL
Sbjct  268  RTDPFSASLETCTPTDPDWPQFMRINPIL  296



>ref|XP_006861579.1| PREDICTED: FAD synthase isoform X1 [Chrysochloris asiatica]
 ref|XP_006861580.1| PREDICTED: FAD synthase isoform X2 [Chrysochloris asiatica]
Length=490

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA YS+ ++ + FNGGKD T L  L             H+     
Sbjct  279  LGQKVASALQTIETALAQYSLTQLCVGFNGGKDCTALLQLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    Y+LQ+   + D K  L  L   +P +KA
Sbjct  327  YPDTQEPLQILYIRSISPFPELEQFLQDTIKRYDLQVLEAQGDMKQALGELQTQHPQLKA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>gb|EMF09340.1| adenine nucleotide alpha hydrolases-like protein [Sphaerulina 
musiva SO2202]
Length=277

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 92/185 (50%), Gaps = 12/185 (6%)
 Frame = +3

Query  144  HQKGSVCRQEAMEIDKAIRECDD-----RRLKTKYNNAIYVIKRALALYSIEEVALSFNG  308
            H  G  C+     +D  +R+        R+++     ++ VI+ AL  YS++ ++ S+NG
Sbjct  19   HDLGDACKNVHARVDAFLRQDAKSNSRLRQVQRTTRESLDVIEEALERYSLDHLSFSYNG  78

Query  309  GKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIA  488
            GKD  VL  L  A  + H ++   S        +P  ++T+Y  + + FP + SF +  A
Sbjct  79   GKDCLVLLILYLAALHTHSTKSTSSY------RLPSTLQTVYIVTPNPFPAVTSFVHHSA  132

Query  489  AMYNLQMDIIRLDFKSGLESLLKANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMR  665
              Y+L +       +    S L+ +P I+AIF+G R  DP       F P+  GWP F+R
Sbjct  133  KKYHLSLQQYHKPMREAFASYLQDHPQIQAIFVGTRRTDPHGAKLTSFDPTDGGWPEFVR  192

Query  666  VNPIL  680
            ++P++
Sbjct  193  IHPVI  197



>gb|EXX67488.1| FMN adenylyltransferase [Rhizophagus irregularis DAOM 197198w]
Length=198

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 83/158 (53%), Gaps = 11/158 (7%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNG  389
            ++ +  K   A+ VI+ +L  Y ++ V+LSFNGGKD  VL HL  A YY     K + N 
Sbjct  26   EQPISKKTTFALKVIEESLERYGLDGVSLSFNGGKDCVVLLHLFAAVYY-----KFYQNS  80

Query  390  DLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-  566
            D    EIP  I+ +Y    + F E++ F  E    Y L +  I    K  L   LK  P 
Sbjct  81   D----EIP-NIQALYVTHPNPFSEVDEFVKECEKRYCLNIVKIEGSMKPALIKYLKQKPN  135

Query  567  IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            IKAI +G R  DP     ++F+P+  GWP  MRV+PIL
Sbjct  136  IKAILVGTRRNDPHGGKLKEFTPTDDGWPSIMRVHPIL  173



>ref|XP_006177299.1| PREDICTED: FAD synthase [Camelus ferus]
 ref|XP_010952263.1| PREDICTED: FAD synthase isoform X2 [Camelus bactrianus]
 ref|XP_010952264.1| PREDICTED: FAD synthase isoform X2 [Camelus bactrianus]
 ref|XP_010952265.1| PREDICTED: FAD synthase isoform X2 [Camelus bactrianus]
Length=490

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIEMALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPDWPSFMRINPLL  421



>ref|XP_010978262.1| PREDICTED: FAD synthase isoform X1 [Camelus dromedarius]
Length=501

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  290  LGEKVAGALQTIEMALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  343

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  344  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  397

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  398  VLMGTRRTDPYSCSLCPFSPTDPDWPSFMRINPLL  432



>ref|XP_010978267.1| PREDICTED: FAD synthase isoform X2 [Camelus dromedarius]
 ref|XP_010978276.1| PREDICTED: FAD synthase isoform X2 [Camelus dromedarius]
 ref|XP_010978285.1| PREDICTED: FAD synthase isoform X2 [Camelus dromedarius]
Length=490

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGEKVAGALQTIEMALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPDWPSFMRINPLL  421



>ref|XP_008153958.1| PREDICTED: FAD synthase [Eptesicus fuscus]
Length=446

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y + ++ + FNGGKD T L HL+ A        KC    +  
Sbjct  279  LGKKVAGALQTIETALARYRLTQLCVGFNGGKDCTALLHLVHAAV----QRKCPDTQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  + S FPE+  F  +    YNL++     + K  L  L   +P ++A
Sbjct  333  ------PLQILYIRTISPFPELEQFLQDTIKRYNLRVLEAEGEMKQALRQLRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
              +G R  DP++     FSP+ PGWP FMR+NP+L
Sbjct  387  ALMGTRRTDPSSCSLHPFSPTDPGWPSFMRINPLL  421



>ref|XP_010952262.1| PREDICTED: FAD synthase isoform X1 [Camelus bactrianus]
Length=501

 Score =   100 bits (249),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  290  LGEKVAGALQTIEMALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  343

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  344  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  397

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  398  VLMGTRRTDPYSCSLCPFSPTDPDWPSFMRINPLL  432



>ref|XP_007525401.1| PREDICTED: FAD synthase [Erinaceus europaeus]
Length=490

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L +K   A+  I+ ALA Y + ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGSKVAGALQTIETALAQYKLSQLCVGFNGGKDCTALLHLFHAAV----QRKCPDTRE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ ++  S S FPE+  F  +    YNLQ+  ++ D K  L  L   +P ++A
Sbjct  333  ------PLQILHIRSISPFPELEQFLQDTIKRYNLQVLEVQGDMKQALGELQVRHPQLQA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+  GWP FMRVNP+L
Sbjct  387  VLMGTRRTDPYSRSLSPFSPTDTGWPTFMRVNPLL  421



>ref|XP_002180385.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47793.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=403

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 83/159 (52%), Gaps = 15/159 (9%)
 Frame = +3

Query  237  NAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPF  416
             A+  +  A  LY  E V  SFNGGKD+ V+ HL+RA +     ++ + +G+      P 
Sbjct  4    QALNNLDHAYRLYGPESVICSFNGGKDAVVILHLVRAAHARFYDQQRNLDGNPIE---PL  60

Query  417  PIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIR--LDFKSGLESLLKAN---------  563
              R +YFE    FPEI SF  E+  +Y L M      + F  GL++L+  N         
Sbjct  61   RPRVVYFEHKDEFPEIRSFLREMVDVYELDMIAFEQGIKFSEGLKTLVTHNVPQNSNVSF  120

Query  564  PIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            P+ A  LG R  DP A GQ  F+PSS   PPFMRVNP+L
Sbjct  121  PV-AFVLGTRATDPNARGQGTFAPSSHYMPPFMRVNPVL  158



>ref|XP_009843532.1| hypothetical protein H257_16705 [Aphanomyces astaci]
 gb|ETV67015.1| hypothetical protein H257_16705 [Aphanomyces astaci]
Length=247

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 83/161 (52%), Gaps = 4/161 (2%)
 Frame = +3

Query  210  DRRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGY----YLHESEKC  377
            D   +  ++ +I V+ RA+ + S+E +  SFNGGKDSTV+ HLLR        +      
Sbjct  15   DEETRNAFHRSIEVLNRAIDILSLERMCFSFNGGKDSTVVLHLLRLVLAKRALVSHPGAS  74

Query  378  HSNGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLK  557
                D  Y  +   +  +YF++   FP++  F +     Y  Q ++    +  G++S++ 
Sbjct  75   EEEFDAAYRSLLHQLPVMYFDTPDQFPQVTDFIHHCIHTYGFQCEMQTSSYVQGIQSIIS  134

Query  558  ANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
                +A  +GVR GDP     E FSPSS GWP F RVNPIL
Sbjct  135  KRKTQAFVMGVRRGDPGTEDLEHFSPSSTGWPAFFRVNPIL  175



>gb|EXX67487.1| FMN adenylyltransferase [Rhizophagus irregularis DAOM 197198w]
Length=250

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 79/148 (53%), Gaps = 11/148 (7%)
 Frame = +3

Query  240  AIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLGYGEIPFP  419
            A+ VI+ +L  Y ++ V+LSFNGGKD  VL HL  A YY     K + N D    EIP  
Sbjct  36   ALKVIEESLERYGLDGVSLSFNGGKDCVVLLHLFAAVYY-----KFYQNSD----EIP-N  85

Query  420  IRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKAIFLGVRI  596
            I+ +Y    + F E++ F  E    Y L +  I    K  L   LK  P IKAI +G R 
Sbjct  86   IQALYVTHPNPFSEVDEFVKECEKRYCLNIVKIEGSMKPALIKYLKQKPNIKAILVGTRR  145

Query  597  GDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
             DP     ++F+P+  GWP  MRV+PIL
Sbjct  146  NDPHGGKLKEFTPTDDGWPSIMRVHPIL  173



>ref|XP_010346677.1| PREDICTED: FAD synthase isoform X1 [Saimiri boliviensis boliviensis]
 ref|XP_010346678.1| PREDICTED: FAD synthase isoform X1 [Saimiri boliviensis boliviensis]
Length=495

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQ+       K  L  L    P ++A
Sbjct  327  LPDVPDPLQILYIRSISTFPELEQFLQDTIRRYNLQVLEAEGSMKQALGELQARYPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_003937809.1| PREDICTED: FAD synthase isoform X2 [Saimiri boliviensis boliviensis]
Length=490

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              ++P P++ +Y  S S FPE+  F  +    YNLQ+       K  L  L    P ++A
Sbjct  327  LPDVPDPLQILYIRSISTFPELEQFLQDTIRRYNLQVLEAEGSMKQALGELQARYPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_008789471.1| PREDICTED: FAD synthase-like isoform X2 [Phoenix dactylifera]
Length=400

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +3

Query  528  FKSGLESLLKANPIKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            FKSGLE+LLK  PIKAIFLG RIGDP AVGQEQFSPSS GWPPFMRVNPIL
Sbjct  7    FKSGLETLLKEKPIKAIFLGTRIGDPNAVGQEQFSPSSTGWPPFMRVNPIL  57



>ref|XP_007595430.1| phosphoadenosine phosphosulfate reductase [Colletotrichum fioriniae 
PJ7]
 gb|EXF80877.1| phosphoadenosine phosphosulfate reductase [Colletotrichum fioriniae 
PJ7]
Length=282

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 86/160 (54%), Gaps = 4/160 (3%)
 Frame = +3

Query  213  RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGY---YLHESEKCHS  383
            R ++ +   ++ V+  ALA YS+E++++S+NGGKD  VL  +L A     Y    +  H+
Sbjct  54   RNVQKQLRASMGVVDEALARYSLEQISISYNGGKDCLVLLIILLAALARRYSSPPKASHT  113

Query  384  NGDLGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKAN  563
            NG  G    P   + +Y  S   F E++ F    +A Y+L +    +  K GLE+ L   
Sbjct  114  NGSNGTTSFPPEFQAVYIVSKHPFAEVDDFVETTSAEYHLDVKRYAMSMKDGLEAYLADR  173

Query  564  P-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            P +KAIF+G R  DP       F P+  GWP FMRV+P++
Sbjct  174  PNVKAIFVGTRRTDPHGEKLTDFDPTDSGWPAFMRVHPVI  213



>gb|EPE05906.1| fad synthetase [Ophiostoma piceae UAMH 11346]
Length=325

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 98/190 (52%), Gaps = 10/190 (5%)
 Frame = +3

Query  141  QHQKGSVCRQEAMEI----DKAIRECDD--RRLKTKYNNAIYVIKRALALYSIEEVALSF  302
            Q+Q   VC Q   ++     K + E D     ++++   ++ VI++AL  Y+++E++LS+
Sbjct  56   QYQFADVCYQLRHKVLAFLAKKVPESDKLLHNVQSQVRVSVDVIEQALRQYTLDEISLSY  115

Query  303  NGGKDSTVLFHLLRAGYYL-HESEKCHSNGDLGYGEI--PFPIRTIYFESSSAFPEINSF  473
            NGGKD  VL  L+ A   +  E  K   N          P P+  IY      FPE++ F
Sbjct  116  NGGKDCLVLLILILACLPICSEDTKDSENAGPKPSSTTPPRPLSAIYIVPPDPFPEVDEF  175

Query  474  TYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKAIFLGVRIGDPTAVGQEQFSPSSPGW  650
              E  A YNL +    L  ++ L++ L   P ++AIF+G R  DP       F+P+  GW
Sbjct  176  VDESTADYNLDLARYPLAMRAALDAFLTDRPTVRAIFMGTRRTDPHGEFLTHFTPTDAGW  235

Query  651  PPFMRVNPIL  680
            P FMRV+P++
Sbjct  236  PQFMRVHPVI  245



>ref|XP_008982748.1| PREDICTED: FAD synthase [Callithrix jacchus]
Length=490

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQTIETALAQYSLTQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
              +IP P++ +Y  S S FPE+  F  +    YNLQ+       K  L  L    P ++A
Sbjct  327  LPDIPDPLQILYIRSISTFPELEQFLQDTIKRYNLQVLEAEGCMKQALGELQARYPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_002787733.1| FAD synthetase, putative [Perkinsus marinus ATCC 50983]
 gb|EER19529.1| FAD synthetase, putative [Perkinsus marinus ATCC 50983]
Length=308

 Score = 98.2 bits (243),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 88/160 (55%), Gaps = 20/160 (13%)
 Frame = +3

Query  216  RLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDL  395
            R++ +   ++ +I  A   Y  EE+ L+FNGGKD TVL H++      H   + HS G  
Sbjct  91   RVRQQTAKSLSIIAEAYDNYKPEELCLAFNGGKDCTVLLHMVD-----HVFRQKHSEG--  143

Query  396  GYGEIPFPIRTIYFES--SSAFPEINSFTYEIAAMYNLQMDIIRL--DFKSGLESLLKAN  563
                   P+RT+Y     +  F E+ SF  ++  +YNL  DI+R+    K GLE + + +
Sbjct  144  ------VPLRTLYIADPKNDTFEEVESFIEDMQKVYNL--DIMRVVGGVKVGLERIKEEH  195

Query  564  P-IKAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            P +KAIF+G R  DP       F+ ++ GWP FMRVNPIL
Sbjct  196  PELKAIFMGSRSTDPFCGDLTAFAKTTEGWPEFMRVNPIL  235



>ref|XP_006734875.1| PREDICTED: FAD synthase isoform X1 [Leptonychotes weddellii]
 ref|XP_006734876.1| PREDICTED: FAD synthase isoform X2 [Leptonychotes weddellii]
Length=490

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 77/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA Y +  + + FNGGKD T L HLL A        KC    +  
Sbjct  279  LGEKVAGALQTIETALARYDLARLCVGFNGGKDCTALLHLLHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQTRHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPSWPSFMRINPLL  421



>ref|XP_006775723.1| PREDICTED: FAD synthase [Myotis davidii]
Length=490

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 80/155 (52%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA Y + ++ + FNGGKD T L HL+ A        KC    +  
Sbjct  279  LGKKVASALQTIETALAQYRLTQLCVGFNGGKDCTALLHLVHAAV----QRKCPGTQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNL++     + K  L  L   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYNLRVLEAEGEMKQALRQLRAQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
              +G R  DP++     FSP+ PGWP FMR+NP+L
Sbjct  387  ALMGTRRTDPSSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_006214728.1| PREDICTED: FAD synthase [Vicugna pacos]
Length=490

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL             H+     
Sbjct  279  LGEKVAGALQTIEMALARYSLNQLCVGFNGGKDCTALLHLF------------HAAVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            Y +   P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  327  YPDAQEPLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPDWPSFMRINPLL  421



>ref|XP_004436180.1| PREDICTED: FAD synthase [Ceratotherium simum simum]
Length=490

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  279  LGRKVAGALQTIETALARYSLPQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  332

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    Y+L++     D K  L  +   +P ++A
Sbjct  333  ------PLQILYIRSISPFPELEQFLQDTIKRYSLRVLEAEGDMKQALSDVQTRHPQVEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLHPFSPTDPGWPSFMRINPLL  421



>ref|XP_008852809.1| PREDICTED: FAD synthase isoform X1 [Nannospalax galili]
Length=532

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA Y + ++ + FNGGKD T L HL  A       +         
Sbjct  321  LGKKVASALQTIETALAQYHLNQLCVGFNGGKDCTALLHLFHAAVQRKSPD---------  371

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
               +P  ++ +Y    S+FPE+  F  +    YNLQ+     D K  L  L + +P ++A
Sbjct  372  ---VPKHLQILYIRCISSFPELEQFLQDTIKRYNLQVLEAEGDMKQALSKLKEQHPQLEA  428

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  429  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  463



>ref|XP_008852842.1| PREDICTED: FAD synthase isoform X4 [Nannospalax galili]
Length=490

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA Y + ++ + FNGGKD T L HL  A       +         
Sbjct  279  LGKKVASALQTIETALAQYHLNQLCVGFNGGKDCTALLHLFHAAVQRKSPD---------  329

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
               +P  ++ +Y    S+FPE+  F  +    YNLQ+     D K  L  L + +P ++A
Sbjct  330  ---VPKHLQILYIRCISSFPELEQFLQDTIKRYNLQVLEAEGDMKQALSKLKEQHPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_008852832.1| PREDICTED: FAD synthase isoform X3 [Nannospalax galili]
Length=521

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA Y + ++ + FNGGKD T L HL  A       +         
Sbjct  321  LGKKVASALQTIETALAQYHLNQLCVGFNGGKDCTALLHLFHAAVQRKSPD---------  371

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
               +P  ++ +Y    S+FPE+  F  +    YNLQ+     D K  L  L + +P ++A
Sbjct  372  ---VPKHLQILYIRCISSFPELEQFLQDTIKRYNLQVLEAEGDMKQALSKLKEQHPQLEA  428

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  429  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  463



>ref|XP_008852817.1| PREDICTED: FAD synthase isoform X2 [Nannospalax galili]
 ref|XP_008852823.1| PREDICTED: FAD synthase isoform X2 [Nannospalax galili]
Length=530

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K  +A+  I+ ALA Y + ++ + FNGGKD T L HL  A       +         
Sbjct  319  LGKKVASALQTIETALAQYHLNQLCVGFNGGKDCTALLHLFHAAVQRKSPD---------  369

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
               +P  ++ +Y    S+FPE+  F  +    YNLQ+     D K  L  L + +P ++A
Sbjct  370  ---VPKHLQILYIRCISSFPELEQFLQDTIKRYNLQVLEAEGDMKQALSKLKEQHPQLEA  426

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  427  VLMGTRRTDPYSCSLCPFSPTDPGWPSFMRINPLL  461



>dbj|GAD99193.1| hypothetical protein THITE_2171095 [Byssochlamys spectabilis 
No. 5]
Length=263

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 82/157 (52%), Gaps = 12/157 (8%)
 Frame = +3

Query  213  RRLKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGD  392
            +R++ +   ++ VI+ AL  Y +EE++LS+NGGKD  VL  L+ A         C  N  
Sbjct  50   QRVQGQVRTSMQVIEEALRRYRLEELSLSYNGGKDCLVLLVLILA---------CLPN--  98

Query  393  LGYGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-I  569
            L        +R IY  S   FPE+ +F    A  Y+L +    L  +  LE+ L+  P +
Sbjct  99   LTASSTGATLRAIYIVSHHPFPEVEAFVQTSATYYHLDLIRYMLPIRDALETYLREKPTV  158

Query  570  KAIFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            KAIF+G R  DP       F P+ P WP FMR++P++
Sbjct  159  KAIFVGTRRTDPHGERLTHFDPTDPNWPQFMRIHPVI  195



>ref|XP_004589038.1| PREDICTED: FAD synthase [Ochotona princeps]
Length=490

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+ +I+ ALA Y + ++ + FNGGKD T L HL             H+     
Sbjct  279  LGKKVAGALQIIESALARYRLPQLCVGFNGGKDCTALLHLF------------HAVVQRK  326

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
            + ++P P++ +Y  S S FPE+  F       Y+LQ+     D K  L  L    P ++A
Sbjct  327  FPDVPKPLQILYIRSVSPFPELEQFLQHTIKRYHLQVLEAEGDMKQALGELRAQYPQLEA  386

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMR+NP+L
Sbjct  387  VLMGTRRTDPYSRSLCPFSPTDPGWPSFMRINPLL  421



>ref|XP_004619248.1| PREDICTED: FAD synthase [Sorex araneus]
Length=564

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 79/155 (51%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ AL  Y + ++ + FNGGKD T L HL  A       ++ H +    
Sbjct  353  LGDKVAGALQTIEMALTRYKLSQLCVGFNGGKDCTALLHLFHAAV-----QRRHPDA---  404

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                P P++ +Y  S S FPE+  F  +    Y+LQ+     D K  L  L   +P ++A
Sbjct  405  ----PEPLQILYIRSVSPFPELEQFLQDTIKRYHLQVLEAEGDMKQALSELQARHPKLEA  460

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ PGWP FMRVNP+L
Sbjct  461  VLMGTRRTDPYSRSLCAFSPTDPGWPSFMRVNPLL  495



>gb|EPY86603.1| hypothetical protein CB1_000306083 [Camelus ferus]
Length=1186

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 78/155 (50%), Gaps = 13/155 (8%)
 Frame = +3

Query  219  LKTKYNNAIYVIKRALALYSIEEVALSFNGGKDSTVLFHLLRAGYYLHESEKCHSNGDLG  398
            L  K   A+  I+ ALA YS+ ++ + FNGGKD T L HL  A        KC    +  
Sbjct  379  LGEKVAGALQTIEMALARYSLTQLCVGFNGGKDCTALLHLFHAAV----QRKCPDAQE--  432

Query  399  YGEIPFPIRTIYFESSSAFPEINSFTYEIAAMYNLQMDIIRLDFKSGLESLLKANP-IKA  575
                  P++ +Y  S S FPE+  F  +    YNLQ+     D K  L  L   +P ++A
Sbjct  433  ------PLQILYIRSISPFPELEQFLQDTIKRYNLQVLEAEGDMKQALSELQARHPQLEA  486

Query  576  IFLGVRIGDPTAVGQEQFSPSSPGWPPFMRVNPIL  680
            + +G R  DP +     FSP+ P WP FMR+NP+L
Sbjct  487  VLMGTRRTDPYSCSLCPFSPTDPDWPSFMRINPLL  521



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060