BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033G15

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009782891.1|  PREDICTED: eukaryotic translation initiation...    393   7e-133   Nicotiana sylvestris
ref|XP_009630704.1|  PREDICTED: eukaryotic translation initiation...    392   2e-132   Nicotiana tomentosiformis
ref|XP_002308015.1|  eukaryotic translation initiation factor 3E ...    386   5e-130   Populus trichocarpa [western balsam poplar]
ref|XP_011015723.1|  PREDICTED: eukaryotic translation initiation...    386   5e-130   Populus euphratica
ref|XP_011048096.1|  PREDICTED: eukaryotic translation initiation...    386   5e-130   Populus euphratica
gb|KHG29832.1|  Eukaryotic translation initiation factor 3 subunit E    383   6e-130   Gossypium arboreum [tree cotton]
gb|KHG29831.1|  Eukaryotic translation initiation factor 3 subunit E    383   5e-129   Gossypium arboreum [tree cotton]
gb|KJB46273.1|  hypothetical protein B456_007G355800                    382   2e-128   Gossypium raimondii
ref|XP_007202066.1|  hypothetical protein PRUPE_ppa005923mg             382   2e-128   Prunus persica
ref|XP_008244286.1|  PREDICTED: eukaryotic translation initiation...    381   3e-128   Prunus mume [ume]
ref|XP_009363228.1|  PREDICTED: eukaryotic translation initiation...    380   9e-128   Pyrus x bretschneideri [bai li]
ref|XP_009363227.1|  PREDICTED: eukaryotic translation initiation...    380   2e-127   
ref|XP_008464598.1|  PREDICTED: eukaryotic translation initiation...    379   2e-127   Cucumis melo [Oriental melon]
ref|XP_004142652.1|  PREDICTED: eukaryotic translation initiation...    379   2e-127   Cucumis sativus [cucumbers]
gb|KJB46272.1|  hypothetical protein B456_007G355700                    379   2e-127   Gossypium raimondii
ref|XP_011075359.1|  PREDICTED: eukaryotic translation initiation...    379   4e-127   Sesamum indicum [beniseed]
ref|XP_006351291.1|  PREDICTED: eukaryotic translation initiation...    377   9e-127   Solanum tuberosum [potatoes]
ref|XP_008351631.1|  PREDICTED: eukaryotic translation initiation...    377   9e-127   
ref|XP_007030845.1|  Eukaryotic translation initiation factor 3E        377   1e-126   
ref|XP_004249215.1|  PREDICTED: eukaryotic translation initiation...    377   1e-126   Solanum lycopersicum
ref|XP_002284533.1|  PREDICTED: eukaryotic translation initiation...    376   2e-126   Vitis vinifera
ref|XP_007145575.1|  hypothetical protein PHAVU_007G250100g             376   4e-126   Phaseolus vulgaris [French bean]
gb|KDP26094.1|  hypothetical protein JCGZ_21127                         376   4e-126   Jatropha curcas
ref|XP_011078923.1|  PREDICTED: eukaryotic translation initiation...    376   4e-126   Sesamum indicum [beniseed]
gb|KCW90114.1|  hypothetical protein EUGRSUZ_A02306                     370   1e-125   Eucalyptus grandis [rose gum]
ref|XP_003535892.1|  PREDICTED: eukaryotic translation initiation...    374   3e-125   Glycine max [soybeans]
ref|XP_010523678.1|  PREDICTED: eukaryotic translation initiation...    373   6e-125   Tarenaya hassleriana [spider flower]
ref|XP_004303635.1|  PREDICTED: eukaryotic translation initiation...    372   8e-125   Fragaria vesca subsp. vesca
ref|XP_003519090.1|  PREDICTED: eukaryotic translation initiation...    372   9e-125   Glycine max [soybeans]
ref|XP_011033185.1|  PREDICTED: eukaryotic translation initiation...    372   1e-124   Populus euphratica
ref|XP_010056741.1|  PREDICTED: eukaryotic translation initiation...    371   4e-124   Eucalyptus grandis [rose gum]
ref|XP_008806586.1|  PREDICTED: eukaryotic translation initiation...    370   4e-124   Phoenix dactylifera
ref|XP_002322658.1|  eukaryotic translation initiation factor 3E ...    369   2e-123   Populus trichocarpa [western balsam poplar]
ref|XP_010554805.1|  PREDICTED: eukaryotic translation initiation...    369   2e-123   Tarenaya hassleriana [spider flower]
gb|EYU18691.1|  hypothetical protein MIMGU_mgv1a006587mg                369   2e-123   Erythranthe guttata [common monkey flower]
gb|ACJ84967.1|  unknown                                                 360   2e-123   Medicago truncatula
gb|EYU20768.1|  hypothetical protein MIMGU_mgv1a006585mg                369   3e-123   Erythranthe guttata [common monkey flower]
ref|XP_010931576.1|  PREDICTED: eukaryotic translation initiation...    367   8e-123   Elaeis guineensis
ref|XP_010672915.1|  PREDICTED: eukaryotic translation initiation...    366   3e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004516371.1|  PREDICTED: eukaryotic translation initiation...    365   9e-122   Cicer arietinum [garbanzo]
gb|AFK46442.1|  unknown                                                 364   1e-121   Medicago truncatula
gb|KEH38776.1|  eukaryotic translation initiation factor 3E             364   1e-121   Medicago truncatula
ref|XP_010090220.1|  Eukaryotic translation initiation factor 3 s...    363   4e-121   Morus notabilis
ref|XP_009410425.1|  PREDICTED: eukaryotic translation initiation...    362   7e-121   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16601.1|  unknown                                                 362   7e-121   Picea sitchensis
gb|ACN40777.1|  unknown                                                 362   9e-121   Picea sitchensis
ref|NP_567047.1|  eukaryotic translation initiation factor 3E           362   9e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAF67757.1|AF255679_1  eIF3e                                         362   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878144.1|  hypothetical protein ARALYDRAFT_486171             362   1e-120   Arabidopsis lyrata subsp. lyrata
gb|KFK34965.1|  hypothetical protein AALP_AA5G216900                    362   1e-120   Arabis alpina [alpine rockcress]
emb|CDY30993.1|  BnaC04g24310D                                          362   1e-120   Brassica napus [oilseed rape]
emb|CDX88939.1|  BnaA04g02470D                                          362   2e-120   
ref|XP_009139041.1|  PREDICTED: eukaryotic translation initiation...    362   2e-120   Brassica rapa
ref|XP_010269659.1|  PREDICTED: eukaryotic translation initiation...    361   3e-120   Nelumbo nucifera [Indian lotus]
gb|KEH41514.1|  eukaryotic translation initiation factor 3E             361   4e-120   Medicago truncatula
ref|XP_008786889.1|  PREDICTED: eukaryotic translation initiation...    360   6e-120   Phoenix dactylifera
ref|XP_010922234.1|  PREDICTED: eukaryotic translation initiation...    360   7e-120   Elaeis guineensis
ref|XP_006837958.1|  hypothetical protein AMTR_s00102p00062980          358   4e-119   Amborella trichopoda
emb|CDY06117.1|  BnaA09g36630D                                          358   7e-119   
ref|XP_009116433.1|  PREDICTED: eukaryotic translation initiation...    357   7e-119   Brassica rapa
ref|XP_006402894.1|  hypothetical protein EUTSA_v10005924mg             358   2e-118   
ref|XP_010279582.1|  PREDICTED: eukaryotic translation initiation...    354   1e-117   Nelumbo nucifera [Indian lotus]
emb|CAB68135.1|  translation initiation factor 3-like protein           353   2e-117   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72053.1|  BnaC08g28210D                                          354   2e-117   
ref|XP_006421164.1|  hypothetical protein CICLE_v10004983mg             353   4e-117   Citrus clementina [clementine]
gb|AIZ68193.1|  eukaryotic translation initiation factor 3 subuni...    352   1e-116   Ornithogalum longebracteatum [sea-onion]
ref|XP_010427598.1|  PREDICTED: eukaryotic translation initiation...    351   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010516342.1|  PREDICTED: eukaryotic translation initiation...    351   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010504654.1|  PREDICTED: eukaryotic translation initiation...    351   3e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006491490.1|  PREDICTED: eukaryotic translation initiation...    350   4e-116   
ref|XP_001783391.1|  predicted protein                                  346   3e-114   
ref|XP_001765099.1|  predicted protein                                  345   5e-114   
ref|XP_001753385.1|  predicted protein                                  343   2e-113   
ref|XP_004955814.1|  PREDICTED: eukaryotic translation initiation...    339   1e-111   Setaria italica
tpg|DAA39490.1|  TPA: putative eukaryotic translation initiation ...    336   2e-111   
ref|NP_001150632.1|  eukaryotic translation initiation factor 3 s...    337   5e-111   Zea mays [maize]
gb|ACN28978.1|  unknown                                                 337   5e-111   Zea mays [maize]
ref|XP_006291150.1|  hypothetical protein CARUB_v10017266mg             337   9e-111   Capsella rubella
gb|EPS73624.1|  hypothetical protein M569_01130                         332   6e-109   Genlisea aurea
ref|XP_003557378.1|  PREDICTED: eukaryotic translation initiation...    331   2e-108   Brachypodium distachyon [annual false brome]
ref|NP_001131771.1|  uncharacterized protein LOC100193141               325   3e-106   Zea mays [maize]
ref|XP_006657560.1|  PREDICTED: eukaryotic translation initiation...    323   1e-105   
gb|ABK34475.1|  eukaryotic initiation factor 3e                         322   5e-105   Oryza sativa Indica Group [Indian rice]
ref|NP_001059202.1|  Os07g0222300                                       321   1e-104   
gb|ABK34467.1|  eukaryotic initiation factor 3e                         319   8e-104   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06719.1|  hypothetical protein F775_27177                         298   4e-94    
gb|EMS48036.1|  Eukaryotic translation initiation factor 3 subunit E    289   3e-92    Triticum urartu
gb|KHN41695.1|  Eukaryotic translation initiation factor 3 subunit E    288   2e-91    Glycine soja [wild soybean]
ref|XP_002992749.1|  hypothetical protein SELMODRAFT_269977             286   5e-91    
emb|CBI33382.3|  unnamed protein product                                283   1e-90    Vitis vinifera
emb|CDP21587.1|  unnamed protein product                                275   1e-87    Coffea canephora [robusta coffee]
emb|CDP14171.1|  unnamed protein product                                275   2e-87    Coffea canephora [robusta coffee]
ref|XP_004955815.1|  PREDICTED: eukaryotic translation initiation...    268   8e-84    Setaria italica
dbj|BAD30375.1|  putative eIF3e                                         262   8e-82    Oryza sativa Japonica Group [Japonica rice]
gb|KJB67152.1|  hypothetical protein B456_010G177900                    253   2e-81    Gossypium raimondii
gb|KJB67153.1|  hypothetical protein B456_010G177900                    253   3e-81    Gossypium raimondii
ref|XP_011015724.1|  PREDICTED: eukaryotic translation initiation...    258   6e-81    Populus euphratica
ref|XP_005651050.1|  eukaryotic translation initiation factor 3, ...    256   1e-79    Coccomyxa subellipsoidea C-169
ref|XP_004349023.1|  eukaryotic translation initiation factor 3 s...    253   4e-78    Capsaspora owczarzaki ATCC 30864
gb|KIY98828.1|  putative Eukaryotic translation initiation factor...    249   1e-76    Monoraphidium neglectum
ref|XP_002503313.1|  predicted protein                                  238   2e-72    Micromonas commoda
ref|XP_003058422.1|  predicted protein                                  234   4e-71    Micromonas pusilla CCMP1545
dbj|BAD30374.1|  putative eIF3e                                         232   2e-70    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058974.2|  Os07g0167000                                       232   2e-70    
ref|XP_001702351.1|  eukaryotic initiation factor                       232   4e-70    Chlamydomonas reinhardtii
tpg|DAA54572.1|  TPA: putative eukaryotic translation initiation ...    226   2e-68    
gb|KDD74800.1|  eIF3 subunit 6 N terminal domain-containing protein     226   1e-67    Helicosporidium sp. ATCC 50920
ref|XP_004170682.1|  PREDICTED: eukaryotic translation initiation...    215   2e-67    
emb|CEG79386.1|  Putative Eukaryotic translation initiation facto...    222   2e-67    Rhizopus microsporus
ref|XP_007124479.1|  PREDICTED: eukaryotic translation initiation...    217   1e-66    
emb|CDY70248.1|  BnaAnng33080D                                          218   3e-66    Brassica napus [oilseed rape]
emb|CEJ01650.1|  Putative Eukaryotic translation initiation facto...    222   3e-66    Rhizopus microsporus
emb|CEG66950.1|  Putative Eukaryotic translation initiation facto...    219   3e-66    Rhizopus microsporus
gb|KJE91084.1|  eukaryotic translation initiation factor 3 subunit E    221   9e-66    Capsaspora owczarzaki ATCC 30864
gb|EPB84383.1|  translation initiation factor 3 subunit E               220   1e-65    Mucor circinelloides f. circinelloides 1006PhL
emb|CEG66948.1|  Putative Eukaryotic translation initiation facto...    220   2e-65    Rhizopus microsporus
ref|NP_001059730.1|  Os07g0503700                                       220   2e-65    
emb|CEG66949.1|  Putative Eukaryotic translation initiation facto...    219   5e-65    Rhizopus microsporus
ref|XP_008430171.1|  PREDICTED: eukaryotic translation initiation...    219   7e-65    Poecilia reticulata
gb|EXX57549.1|  hypothetical protein RirG_206150                        218   7e-65    Rhizophagus irregularis DAOM 197198w
ref|XP_007563282.1|  PREDICTED: eukaryotic translation initiation...    219   8e-65    Poecilia formosa
ref|XP_005844652.1|  hypothetical protein CHLNCDRAFT_138996             218   9e-65    Chlorella variabilis
ref|XP_006005204.1|  PREDICTED: eukaryotic translation initiation...    218   1e-64    Latimeria chalumnae
ref|XP_006250447.1|  PREDICTED: eukaryotic translation initiation...    217   1e-64    
gb|ESA16451.1|  hypothetical protein GLOINDRAFT_156542                  218   1e-64    
dbj|BAB27621.1|  unnamed protein product                                217   1e-64    Mus musculus [mouse]
gb|EFB25663.1|  hypothetical protein PANDA_007264                       217   2e-64    Ailuropoda melanoleuca
pdb|3J8B|E  Chain E, Model Of The Human Eif3 Pci-mpn Octamer Dock...    217   2e-64    Homo sapiens [man]
ref|XP_005613308.1|  PREDICTED: eukaryotic translation initiation...    218   2e-64    
ref|NP_001279788.1|  eukaryotic translation initiation factor 3, ...    218   2e-64    Callorhinchus milii [Australian ghost shark]
ref|XP_010614025.1|  PREDICTED: eukaryotic translation initiation...    217   2e-64    Fukomys damarensis [Damara mole rat]
ref|XP_008400652.1|  PREDICTED: eukaryotic translation initiation...    214   3e-64    Poecilia reticulata
gb|AAX36482.1|  eukaryotic translation initiation factor 3 subunit 6    217   3e-64    synthetic construct
ref|XP_004796181.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64    
ref|XP_006830704.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64    Chrysochloris asiatica
ref|NP_001126100.1|  eukaryotic translation initiation factor 3 s...    217   3e-64    Pongo abelii [orang utan]
emb|CAG33310.1|  EIF3S6                                                 217   3e-64    Homo sapiens [man]
ref|XP_007188837.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64    Balaenoptera acutorostrata scammoni
gb|AAX29771.1|  eukaryotic translation initiation factor 3 subuni...    217   3e-64    synthetic construct
ref|XP_007075896.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64    Panthera tigris altaica
ref|XP_005799084.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64    Xiphophorus maculatus
ref|XP_005869124.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64    
dbj|BAG36003.1|  unnamed protein product                                217   3e-64    Homo sapiens [man]
ref|XP_005170108.1|  PREDICTED: eukaryotic translation initiation...    217   3e-64    
ref|XP_010369113.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64    Rhinopithecus roxellana
ref|XP_003903117.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64    Papio anubis [baboon]
ref|NP_001559.1|  eukaryotic translation initiation factor 3 subu...    217   3e-64    Homo sapiens [man]
ref|NP_001029775.1|  eukaryotic translation initiation factor 3 s...    217   3e-64    Bos taurus [bovine]
ref|XP_003256152.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64    Nomascus leucogenys [White-cheeked Gibbon]
gb|AIC63065.1|  EIF3E                                                   217   3e-64    synthetic construct
gb|ABF57434.1|  eukaryotic translation initiation factor 3, subun...    217   3e-64    Bos taurus [bovine]
ref|XP_004370748.1|  PREDICTED: eukaryotic translation initiation...    218   3e-64    Trichechus manatus latirostris
ref|XP_006737590.1|  PREDICTED: eukaryotic translation initiation...    217   4e-64    Leptonychotes weddellii
ref|XP_002759346.1|  PREDICTED: eukaryotic translation initiation...    218   4e-64    Callithrix jacchus [common marmoset]
ref|XP_003760371.1|  PREDICTED: eukaryotic translation initiation...    217   4e-64    Sarcophilus harrisii
ref|XP_007229269.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    217   4e-64    
ref|XP_003965946.1|  PREDICTED: eukaryotic translation initiation...    217   4e-64    Takifugu rubripes [tiger puffer]
ref|XP_004642297.1|  PREDICTED: eukaryotic translation initiation...    216   5e-64    Octodon degus
gb|KFO18524.1|  Eukaryotic translation initiation factor 3 subunit E    218   5e-64    Fukomys damarensis [Damara mole rat]
ref|XP_007056150.1|  PREDICTED: eukaryotic translation initiation...    216   5e-64    Chelonia mydas [green seaturtle]
ref|XP_004850341.1|  PREDICTED: eukaryotic translation initiation...    216   6e-64    Heterocephalus glaber [naked mole rat]
ref|XP_007999543.1|  PREDICTED: eukaryotic translation initiation...    218   6e-64    Chlorocebus sabaeus
sp|Q1LUA8.2|EI3EB_DANRE  RecName: Full=Eukaryotic translation ini...    216   7e-64    Danio rerio [leopard danio]
gb|EIE75948.1|  hypothetical protein RO3G_00652                         216   7e-64    Rhizopus delemar RA 99-880
ref|XP_008166528.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    217   8e-64    
ref|XP_006794555.1|  PREDICTED: eukaryotic translation initiation...    215   9e-64    Neolamprologus brichardi [lyretail cichlid]
gb|EMP39258.1|  Eukaryotic translation initiation factor 3 subunit E    216   9e-64    Chelonia mydas [green seaturtle]
ref|XP_004661452.1|  PREDICTED: eukaryotic translation initiation...    216   9e-64    Jaculus jaculus
emb|CAG07918.1|  unnamed protein product                                216   1e-63    Tetraodon nigroviridis
gb|AAH17887.1|  Eukaryotic translation initiation factor 3, subun...    216   1e-63    Homo sapiens [man]
gb|ACQ58587.1|  Eukaryotic translation initiation factor 3 subunit E    216   1e-63    Anoplopoma fimbria
ref|XP_004679709.1|  PREDICTED: eukaryotic translation initiation...    216   1e-63    Condylura cristata
ref|XP_005924386.1|  PREDICTED: eukaryotic translation initiation...    216   1e-63    Haplochromis burtoni
ref|XP_010738667.1|  PREDICTED: eukaryotic translation initiation...    216   1e-63    Larimichthys crocea [croceine croaker]
ref|XP_004850340.1|  PREDICTED: eukaryotic translation initiation...    217   1e-63    
ref|XP_006892391.1|  PREDICTED: eukaryotic translation initiation...    215   1e-63    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002113968.1|  hypothetical protein TRIADDRAFT_50473              215   1e-63    Trichoplax adhaerens
ref|XP_008400651.1|  PREDICTED: eukaryotic translation initiation...    214   2e-63    Poecilia reticulata
dbj|GAN10003.1|  eukaryotic translation initiation factor 3 subun...    215   2e-63    Mucor ambiguus
ref|XP_006038115.1|  PREDICTED: eukaryotic translation initiation...    215   2e-63    Alligator sinensis
ref|XP_004086680.1|  PREDICTED: eukaryotic translation initiation...    215   2e-63    Oryzias latipes [Japanese rice fish]
ref|XP_006635626.1|  PREDICTED: eukaryotic translation initiation...    215   2e-63    Lepisosteus oculatus
gb|EHH28709.1|  Eukaryotic translation initiation factor 3 subunit E    215   2e-63    Macaca mulatta [rhesus macaque]
ref|XP_003408482.1|  PREDICTED: eukaryotic translation initiation...    215   2e-63    
ref|XP_006113079.1|  PREDICTED: eukaryotic translation initiation...    214   3e-63    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_004569303.1|  PREDICTED: eukaryotic translation initiation...    215   3e-63    Maylandia zebra
ref|XP_008291531.1|  PREDICTED: eukaryotic translation initiation...    214   3e-63    Stegastes partitus
ref|XP_003447252.1|  PREDICTED: eukaryotic translation initiation...    214   3e-63    Oreochromis niloticus
ref|XP_008283264.1|  PREDICTED: eukaryotic translation initiation...    214   3e-63    Stegastes partitus
ref|XP_004566824.1|  PREDICTED: eukaryotic translation initiation...    214   3e-63    Maylandia zebra
ref|XP_006794910.1|  PREDICTED: eukaryotic translation initiation...    214   4e-63    Neolamprologus brichardi [lyretail cichlid]
ref|XP_007543239.1|  PREDICTED: eukaryotic translation initiation...    214   5e-63    Poecilia formosa
emb|CAJ82304.1|  eukaryotic translation initiation factor 3, subu...    214   5e-63    Xenopus tropicalis [western clawed frog]
ref|NP_989147.1|  eukaryotic translation initiation factor 3 subu...    214   5e-63    Xenopus tropicalis [western clawed frog]
gb|ADO28016.1|  eukaryotic translation initiation factor 3 subuni...    214   5e-63    Ictalurus furcatus
ref|XP_005815573.1|  PREDICTED: eukaryotic translation initiation...    214   5e-63    
ref|XP_005042453.1|  PREDICTED: eukaryotic translation initiation...    214   5e-63    Ficedula albicollis
ref|XP_003453516.1|  PREDICTED: eukaryotic translation initiation...    214   7e-63    Oreochromis niloticus
ref|XP_006113078.1|  PREDICTED: eukaryotic translation initiation...    214   8e-63    
ref|NP_001089321.1|  eukaryotic translation initiation factor 3 s...    213   9e-63    Xenopus laevis [clawed frog]
ref|NP_001082486.1|  eukaryotic translation initiation factor 3 s...    213   1e-62    Xenopus laevis [clawed frog]
ref|XP_001636266.1|  predicted protein                                  213   1e-62    Nematostella vectensis
emb|CDQ75537.1|  unnamed protein product                                213   1e-62    Oncorhynchus mykiss
emb|CAF92057.1|  unnamed protein product                                213   1e-62    Tetraodon nigroviridis
emb|CDQ64768.1|  unnamed protein product                                213   1e-62    Oncorhynchus mykiss
emb|CEP11876.1|  hypothetical protein                                   212   2e-62    Parasitella parasitica
gb|AAF80474.1|AF162775_1  Int-6 protein                                 213   2e-62    Xenopus laevis [clawed frog]
ref|XP_005150980.1|  PREDICTED: eukaryotic translation initiation...    212   2e-62    Melopsittacus undulatus
ref|XP_009061036.1|  hypothetical protein LOTGIDRAFT_126234             212   2e-62    Lottia gigantea
ref|XP_009454078.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    213   2e-62    
ref|XP_010790694.1|  PREDICTED: eukaryotic translation initiation...    212   3e-62    Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001233255.1|  Eukaryotic translation initiation factor 3 s...    213   3e-62    Oncorhynchus mykiss
ref|NP_001006349.1|  eukaryotic translation initiation factor 3 s...    212   3e-62    Gallus gallus [bantam]
ref|XP_006735494.1|  PREDICTED: eukaryotic translation initiation...    210   3e-62    Leptonychotes weddellii
ref|XP_006735493.1|  PREDICTED: eukaryotic translation initiation...    210   3e-62    Leptonychotes weddellii
ref|NP_001135167.1|  eukaryotic translation initiation factor 3 s...    211   4e-62    Salmo salar
ref|NP_001038416.1|  eukaryotic translation initiation factor 3 s...    210   6e-62    
ref|XP_010903799.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    213   8e-62    
ref|XP_007563199.1|  PREDICTED: eukaryotic translation initiation...    211   1e-61    Poecilia formosa
ref|XP_006735492.1|  PREDICTED: eukaryotic translation initiation...    210   1e-61    Leptonychotes weddellii
ref|XP_001369627.1|  PREDICTED: eukaryotic translation initiation...    210   1e-61    Monodelphis domestica
ref|XP_002735030.1|  PREDICTED: eukaryotic translation initiation...    210   2e-61    Saccoglossus kowalevskii
gb|ACO08955.1|  Eukaryotic translation initiation factor 3 subunit 6    210   2e-61    Osmerus mordax
ref|XP_010742024.1|  PREDICTED: eukaryotic translation initiation...    209   3e-61    
gb|EFX82001.1|  hypothetical protein DAPPUDRAFT_302804                  209   3e-61    Daphnia pulex
ref|XP_007254559.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    209   3e-61    
ref|XP_007543240.1|  PREDICTED: eukaryotic translation initiation...    208   4e-61    
ref|XP_011399162.1|  Eukaryotic translation initiation factor 3 s...    209   4e-61    Auxenochlorella protothecoides
gb|ACO08499.1|  Eukaryotic translation initiation factor 3 subunit 6    209   5e-61    Oncorhynchus mykiss
gb|AAC51917.1|  mammary tumor-associated protein INT6                   208   6e-61    Homo sapiens [man]
gb|AAT68096.1|  eukaryotic translation initiation factor 3 subunit 6    208   8e-61    Danio rerio [leopard danio]
ref|NP_957133.1|  eukaryotic translation initiation factor 3 subu...    208   9e-61    Danio rerio [leopard danio]
ref|XP_003219492.1|  PREDICTED: eukaryotic translation initiation...    207   2e-60    Anolis carolinensis [Carolina anole]
ref|XP_002609740.1|  hypothetical protein BRAFLDRAFT_114473             206   3e-60    Branchiostoma floridae
ref|XP_008640866.1|  PREDICTED: eukaryotic translation initiation...    206   1e-59    
ref|XP_011454873.1|  PREDICTED: eukaryotic translation initiation...    205   1e-59    Crassostrea gigas
ref|XP_009140765.1|  PREDICTED: eukaryotic translation initiation...    197   2e-59    
ref|XP_782397.3|  PREDICTED: eukaryotic translation initiation fa...    204   3e-59    
gb|KIJ53523.1|  hypothetical protein M422DRAFT_64535                    204   4e-59    Sphaerobolus stellatus SS14
gb|EHB17733.1|  Eukaryotic translation initiation factor 3 subunit E    198   1e-58    Heterocephalus glaber [naked mole rat]
ref|XP_005507309.1|  PREDICTED: eukaryotic translation initiation...    202   1e-58    
ref|XP_010575299.1|  PREDICTED: eukaryotic translation initiation...    202   1e-58    Haliaeetus leucocephalus
ref|XP_002130084.2|  PREDICTED: eukaryotic translation initiation...    202   2e-58    Ciona intestinalis [sea vase]
ref|XP_004340264.1|  eukaryotic translation initiation factor 3 s...    202   2e-58    Acanthamoeba castellanii str. Neff
ref|XP_004226360.1|  PREDICTED: eukaryotic translation initiation...    202   2e-58    
ref|XP_005662958.1|  PREDICTED: eukaryotic translation initiation...    201   1e-57    
ref|XP_007427485.1|  PREDICTED: eukaryotic translation initiation...    200   1e-57    Python bivittatus
ref|XP_005098426.1|  PREDICTED: eukaryotic translation initiation...    197   3e-57    
gb|EPS98504.1|  eukaryotic translation initiation factor 3 subunit 6    199   5e-57    Fomitopsis pinicola FP-58527 SS1
gb|ELT88021.1|  hypothetical protein CAPTEDRAFT_159549                  198   5e-57    Capitella teleta
gb|EMD40030.1|  hypothetical protein CERSUDRAFT_112256                  198   6e-57    Gelatoporia subvermispora B
gb|ACJ05177.1|  eIF3e                                                   197   1e-56    Aplysia kurodai
emb|CDS13833.1|  hypothetical protein LRAMOSA06007                      196   3e-56    Lichtheimia ramosa
ref|XP_004457646.1|  PREDICTED: eukaryotic translation initiation...    196   3e-56    Dasypus novemcinctus
ref|XP_005022996.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    194   1e-55    
ref|XP_007271405.1|  eukaryotic translation initiation factor 3, ...    194   2e-55    Fomitiporia mediterranea MF3/22
gb|KDR09513.1|  Eukaryotic translation initiation factor 3 subunit E    193   3e-55    Zootermopsis nevadensis
ref|XP_008045609.1|  eukaryotic translation initiation factor 3 s...    192   9e-55    Trametes versicolor FP-101664 SS1
gb|KIM56914.1|  hypothetical protein SCLCIDRAFT_131622                  192   1e-54    Scleroderma citrinum Foug A
ref|XP_007380641.1|  eukaryotic translation initiation factor 3 s...    191   2e-54    Punctularia strigosozonata HHB-11173 SS5
ref|XP_007370584.1|  eukaryotic translation initiation factor 3 s...    192   2e-54    Dichomitus squalens LYAD-421 SS1
ref|XP_001819838.1|  eukaryotic translation initiation factor 3 s...    191   2e-54    Aspergillus oryzae RIB40
sp|B0XXL3.1|EIF3E_ASPFC  RecName: Full=Eukaryotic translation ini...    191   2e-54    Aspergillus fumigatus A1163
ref|XP_001271137.1|  eukaryotic translation initiation factor 3 s...    191   3e-54    Aspergillus clavatus NRRL 1
ref|XP_754483.1|  eukaryotic translation initiation factor 3 subu...    191   3e-54    Aspergillus fumigatus Af293
gb|KIO14572.1|  hypothetical protein M404DRAFT_5840                     191   4e-54    Pisolithus tinctorius Marx 270
ref|XP_007870566.1|  eukaryotic translation initiation factor 3, ...    190   5e-54    Gloeophyllum trabeum ATCC 11539
gb|KIK22614.1|  hypothetical protein PISMIDRAFT_680018                  188   5e-54    Pisolithus microcarpus 441
gb|KIL62667.1|  hypothetical protein M378DRAFT_752252                   191   8e-54    Amanita muscaria Koide BX008
ref|XP_001244252.1|  conserved hypothetical protein                     190   8e-54    Coccidioides immitis RS
gb|KFH64442.1|  translation initiation factor eIF-3 subunit 6           190   8e-54    Mortierella verticillata NRRL 6337
ref|XP_001263327.1|  eukaryotic translation initiation factor 3 s...    190   9e-54    Aspergillus fischeri NRRL 181
emb|CDO70814.1|  hypothetical protein BN946_scf184801.g5                190   1e-53    Trametes cinnabarina
gb|ACO10725.1|  Eukaryotic translation initiation factor 3 subunit E    189   1e-53    Caligus rogercresseyi
ref|XP_010755910.1|  eukaryotic translation initiation factor 3 s...    189   1e-53    Paracoccidioides brasiliensis Pb18
gb|KIJ62789.1|  hypothetical protein HYDPIDRAFT_113890                  189   1e-53    Hydnomerulius pinastri MD-312
gb|KII86561.1|  hypothetical protein PLICRDRAFT_177325                  189   2e-53    Plicaturopsis crispa FD-325 SS-3
ref|XP_008322011.1|  PREDICTED: eukaryotic translation initiation...    188   2e-53    
gb|EEH04833.1|  eukaryotic translation initiation factor 3 subunit 6    189   2e-53    Histoplasma capsulatum G186AR
ref|XP_001399846.1|  eukaryotic translation initiation factor 3 s...    188   3e-53    
gb|EER37177.1|  eukaryotic translation initiation factor 3 subunit 6    188   3e-53    
ref|XP_003068564.1|  Eukaryotic translation initiation factor 3 s...    188   4e-53    
ref|XP_007311553.1|  eukaryotic translation initiation factor 3 s...    188   4e-53    
ref|XP_009545957.1|  hypothetical protein HETIRDRAFT_474704             188   5e-53    
ref|XP_002582679.1|  conserved hypothetical protein                     187   7e-53    
ref|XP_007399905.1|  hypothetical protein PHACADRAFT_262607             187   9e-53    
gb|EEH39762.2|  eukaryotic translation initiation factor 3 subunit E    187   1e-52    
ref|XP_002532670.1|  eukaryotic translation initiation factor 3 s...    184   1e-52    
ref|XP_002796063.1|  eukaryotic translation initiation factor 3 s...    187   1e-52    
gb|KDE07964.1|  hypothetical protein MVLG_01870                         188   1e-52    
ref|XP_001880025.1|  predicted protein                                  187   2e-52    
ref|XP_001542998.1|  conserved hypothetical protein                     186   2e-52    
ref|XP_001213849.1|  conserved hypothetical protein                     186   2e-52    
ref|XP_007855428.1|  eukaryotic translation initiation factor 3 s...    186   2e-52    
gb|KFM67912.1|  Eukaryotic translation initiation factor 3 subuni...    186   3e-52    
gb|EUC67326.1|  eukaryotic translation initiation factor 3 subunit E    186   3e-52    
gb|KIM49934.1|  hypothetical protein M413DRAFT_439055                   186   3e-52    
emb|CCO26313.1|  Eukaryotic translation initiation factor 3 subun...    184   3e-52    
gb|KIJ14312.1|  hypothetical protein PAXINDRAFT_79632                   186   4e-52    
gb|KIK36736.1|  hypothetical protein CY34DRAFT_811023                   186   4e-52    
gb|KEP54865.1|  eukaryotic translation initiation factor 3 subunit E    185   5e-52    
gb|KIK09505.1|  hypothetical protein K443DRAFT_82516                    186   5e-52    
gb|KDQ51240.1|  hypothetical protein JAAARDRAFT_41302                   185   6e-52    
gb|KIK63228.1|  hypothetical protein GYMLUDRAFT_41553                   185   7e-52    
gb|KDR83300.1|  hypothetical protein GALMADRAFT_58133                   186   8e-52    
gb|KIO23249.1|  hypothetical protein M407DRAFT_244841                   185   1e-51    
dbj|GAD99024.1|  eukaryotic translation initiation factor 3 subun...    184   1e-51    
gb|KIY66765.1|  eukaryotic translation initiation factor 3, subun...    184   1e-51    
gb|KIP06870.1|  hypothetical protein PHLGIDRAFT_106524                  184   1e-51    
emb|CEL52136.1|  Eukaryotic translation initiation factor 3 subun...    184   1e-51    
ref|XP_002623456.1|  eukaryotic translation initiation factor 3 s...    184   2e-51    
gb|ACU17653.1|  unknown                                                 181   2e-51    
gb|EEQ83954.1|  eukaryotic translation initiation factor 3 subunit 6    184   2e-51    
gb|EPE02612.1|  eukaryotic translation initiation factor 3 subunit e    183   2e-51    
ref|XP_660511.1|  hypothetical protein AN2907.2                         183   3e-51    
ref|XP_007513712.1|  eukaryotic translation initiation factor 3 s...    184   3e-51    
gb|KIK96150.1|  hypothetical protein PAXRUDRAFT_25206                   183   3e-51    
emb|CCX09811.1|  Similar to eukaryotic translation initiation fac...    183   3e-51    
emb|CDM30578.1|  Eukaryotic translation initiation factor 3 subun...    183   3e-51    
gb|EPS29810.1|  hypothetical protein PDE_04760                          183   3e-51    
ref|XP_007318752.1|  hypothetical protein SERLADRAFT_415728             183   3e-51    
gb|KIY51730.1|  eukaryotic translation initiation factor 3, subun...    183   4e-51    
gb|KIM31100.1|  hypothetical protein M408DRAFT_276325                   184   4e-51    
gb|ACO13187.1|  Eukaryotic translation initiation factor 3 subunit E    182   4e-51    
ref|XP_002559386.1|  Pc13g09630                                         182   4e-51    
gb|AAD29969.1|AF117648_1  Int6                                          184   5e-51    
ref|NP_595367.1|  eukaryotic translation initiation factor 3 subu...    184   5e-51    
gb|KJA24411.1|  hypothetical protein HYPSUDRAFT_38862                   183   5e-51    
ref|XP_007765706.1|  eukaryotic translation initiation factor 3 s...    182   6e-51    
ref|XP_007875217.1|  hypothetical protein PNEG_03155                    182   7e-51    
emb|CCF36539.1|  eukaryotic translation initiation factor 3 subun...    181   9e-51    
emb|CCJ28469.1|  unnamed protein product                                182   1e-50    
gb|ABM55547.1|  putative eukaryotic translation initiation factor...    181   1e-50    
gb|EGE06497.1|  eukaryotic translation initiation factor 3 subunit 6    179   2e-50    
gb|AAH45079.1|  Eif3e-a protein                                         180   2e-50    
gb|KGO72996.1|  Eukaryotic translation initiation factor 3 (eIF3)...    181   2e-50    
gb|KGO36581.1|  Eukaryotic translation initiation factor 3 (eIF3)...    181   2e-50    
ref|XP_009221645.1|  eukaryotic translation initiation factor 3 s...    181   3e-50    
ref|XP_007597179.1|  eIF3 subunit 6 N terminal domain-containing ...    182   3e-50    
gb|KDQ20948.1|  hypothetical protein BOTBODRAFT_26961                   181   4e-50    
gb|EPX74339.1|  eIF3e subunit Int6                                      181   4e-50    
gb|EWC43517.1|  eukaryotic translation initiation factor 3 subunit E    180   4e-50    
gb|ENH76775.1|  eukaryotic translation initiation factor 3 subunit      179   5e-50    
ref|XP_003005479.1|  eukaryotic translation initiation factor 3 s...    179   6e-50    
ref|XP_002143536.1|  eukaryotic translation initiation factor 3 s...    180   6e-50    
ref|XP_008187098.1|  PREDICTED: eukaryotic translation initiation...    179   6e-50    
gb|EKV05936.1|  Eukaryotic translation initiation factor 3 subuni...    179   7e-50    
ref|XP_006680298.1|  hypothetical protein BATDEDRAFT_20238              179   7e-50    
gb|KIM73513.1|  hypothetical protein PILCRDRAFT_829097                  179   8e-50    
ref|XP_008594862.1|  eIF3 subunit 6 N terminal domain-containing ...    179   9e-50    
gb|ERS98818.1|  eukaryotic translation initiation factor 3 subunit E    179   1e-49    
ref|XP_011406112.1|  PREDICTED: eukaryotic translation initiation...    178   1e-49    
gb|KDN63983.1|  putative eIF3 subunit 6 N terminal domain-contain...    179   1e-49    
gb|EGD98371.1|  eukaryotic translation initiation factor 3 subunit E    179   1e-49    
gb|EFQ35664.1|  eIF3 subunit 6 N terminal domain-containing protein     178   1e-49    
gb|EYE94655.1|  eukaryotic translation initiation factor 3 subunit E    179   1e-49    
ref|XP_001952525.1|  PREDICTED: eukaryotic translation initiation...    178   1e-49    
gb|EZF30486.1|  eukaryotic translation initiation factor 3 subunit E    179   2e-49    
gb|KIN00908.1|  hypothetical protein OIDMADRAFT_41596                   178   2e-49    
ref|XP_011125666.1|  hypothetical protein AOL_s00169g7                  179   2e-49    
gb|KDQ24117.1|  hypothetical protein PLEOSDRAFT_1114236                 179   2e-49    
ref|XP_003238179.1|  eukaryotic translation initiation factor 3 s...    178   2e-49    
gb|EZF70061.1|  eukaryotic translation initiation factor 3 subunit E    178   2e-49    
ref|XP_001619654.1|  hypothetical protein NEMVEDRAFT_v1g223968          171   2e-49    
dbj|GAM83243.1|  hypothetical protein ANO11243_012290                   178   2e-49    
ref|XP_001839554.1|  eukaryotic translation initiation factor 3 s...    179   2e-49    
gb|KFQ45087.1|  Eukaryotic translation initiation factor 3 subunit E    175   2e-49    
ref|XP_003011817.1|  hypothetical protein ARB_02046                     178   2e-49    
ref|XP_007835063.1|  Eukaryotic translation initiation factor 3 s...    177   3e-49    
gb|KGQ10900.1|  Eukaryotic translation initiation factor 3 subunit E    177   3e-49    
ref|XP_008556331.1|  PREDICTED: eukaryotic translation initiation...    177   3e-49    
emb|CCA70641.1|  related to eIF3e-eukaryotic initiation factor 3 ...    178   3e-49    
dbj|GAM39725.1|  translation initiation factor                          178   3e-49    
ref|XP_007274502.1|  eukaryotic translation initiation factor 3 s...    177   3e-49    
gb|KID78614.1|  eukaryotic translation initiation factor 3 subunit 6    177   4e-49    
ref|XP_003020101.1|  hypothetical protein TRV_05874                     178   4e-49    
gb|EYB33107.1|  hypothetical protein FG05_06073                         177   4e-49    
ref|XP_004899370.1|  PREDICTED: eukaryotic translation initiation...    177   5e-49    
ref|XP_003177254.1|  eukaryotic translation initiation factor 3 s...    177   5e-49    
gb|ERE52456.1|  eukaryotic translation initiation factor 3 subuni...    177   6e-49    
gb|ELU44452.1|  eukaryotic translation initiation factor 3 subunit 6    177   6e-49    
gb|ERE52457.1|  eukaryotic translation initiation factor 3 subuni...    177   6e-49    
ref|XP_002479861.1|  eukaryotic translation initiation factor 3 s...    177   7e-49    
ref|XP_007673414.1|  hypothetical protein BAUCODRAFT_358059             177   7e-49    
dbj|BAM19236.1|  eukaryotic translation initiation factor 3 subun...    177   7e-49    
ref|XP_005924385.1|  PREDICTED: eukaryotic translation initiation...    177   8e-49    
gb|KFY14956.1|  hypothetical protein V491_05842                         173   9e-49    
gb|ESZ96823.1|  eukaryotic translation initiation factor 3 subunit E    176   1e-48    
gb|EOA98832.1|  Eukaryotic translation initiation factor 3 subunit E    175   1e-48    
gb|KFP91969.1|  Eukaryotic translation initiation factor 3 subunit E    175   1e-48    
gb|EMT68284.1|  Eukaryotic translation initiation factor 3 subunit E    175   1e-48    
ref|XP_002173582.2|  eIF3e subunit Int6                                 177   1e-48    
ref|XP_011324696.1|  hypothetical protein FGSG_06073                    176   1e-48    
gb|EMC86397.1|  Eukaryotic translation initiation factor 3 subunit E    175   1e-48    
gb|EXM33868.1|  eukaryotic translation initiation factor 3 subunit E    176   2e-48    
gb|EMT68285.1|  Eukaryotic translation initiation factor 3 subunit E    176   2e-48    
gb|EWZ02270.1|  eukaryotic translation initiation factor 3 subunit E    176   2e-48    
ref|XP_007330306.1|  hypothetical protein AGABI1DRAFT_114186            176   2e-48    
gb|EWZ93426.1|  eukaryotic translation initiation factor 3 subunit E    176   2e-48    
gb|AEE61882.1|  unknown                                                 176   2e-48    
gb|ENN70923.1|  hypothetical protein YQE_12325                          176   2e-48    
ref|XP_006463000.1|  hypothetical protein AGABI2DRAFT_194041            176   2e-48    
ref|XP_007820940.1|  eukaryotic translation initiation factor 3 s...    175   2e-48    
ref|XP_007815822.1|  eukaryotic translation initiation factor 3 s...    175   2e-48    
gb|KFG87380.1|  eukaryotic translation initiation factor 3 subunit 6    175   2e-48    
ref|XP_001547625.1|  hypothetical protein BC1G_13956                    175   3e-48    
ref|XP_009255621.1|  hypothetical protein FPSE_04228                    174   4e-48    
gb|EPY54297.1|  eIF3e subunit Int6                                      176   4e-48    
ref|XP_002415393.1|  translation initiation factor 3, subunit E, ...    172   5e-48    
gb|EWG43088.1|  eukaryotic translation initiation factor 3 subunit E    174   5e-48    
emb|CCT67084.1|  probable Int-6 protein                                 174   6e-48    
ref|XP_002850523.1|  eukaryotic translation initiation factor 3 s...    174   6e-48    
gb|KFV81170.1|  Eukaryotic translation initiation factor 3 subunit E    173   7e-48    
gb|ETE65778.1|  Eukaryotic translation initiation factor 3 subunit E    173   8e-48    
gb|KFY04754.1|  hypothetical protein O988_00547                         174   1e-47    
gb|KFX88616.1|  hypothetical protein V490_07514                         174   1e-47    
ref|XP_007916777.1|  putative eukaryotic translation initiation f...    173   1e-47    
ref|XP_004162816.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    171   1e-47    
gb|KIL91535.1|  hypothetical protein FAVG1_05152                        173   1e-47    
ref|XP_005706874.1|  translation initiation factor eIF-3 subunit 6      174   1e-47    
gb|KFY81930.1|  hypothetical protein V500_10960                         173   1e-47    
ref|XP_003334895.1|  hypothetical protein PGTG_16063                    174   1e-47    
gb|KFY70141.1|  hypothetical protein V499_09427                         173   1e-47    
ref|XP_003393296.1|  PREDICTED: eukaryotic translation initiation...    173   1e-47    
ref|NP_001037404.1|  eukaryotic translation initiation factor 3 s...    173   2e-47    
gb|EQB44601.1|  hypothetical protein CGLO_16644                         172   2e-47    
ref|XP_010195161.1|  PREDICTED: eukaryotic translation initiation...    165   2e-47    
gb|ELR03852.1|  eukaryotic translation initiation factor 3 subunit E    172   2e-47    
ref|XP_011153275.1|  PREDICTED: eukaryotic translation initiation...    172   3e-47    
ref|XP_008666148.1|  PREDICTED: eukaryotic translation initiation...    166   3e-47    
ref|XP_011111893.1|  hypothetical protein H072_6091                     173   3e-47    
gb|KFY34703.1|  hypothetical protein V494_06544                         172   3e-47    
ref|XP_969967.1|  PREDICTED: eukaryotic translation initiation fa...    172   3e-47    
ref|XP_011153266.1|  PREDICTED: eukaryotic translation initiation...    172   3e-47    
gb|EGU77995.1|  hypothetical protein FOXB_11472                         172   3e-47    
gb|KHN97164.1|  eukaryotic translation initiation factor 3 subunit 6    172   4e-47    
gb|KFY14929.1|  hypothetical protein V492_02317                         172   4e-47    
gb|KFZ16774.1|  hypothetical protein V501_02073                         172   6e-47    
ref|XP_001586827.1|  hypothetical protein SS1G_11856                    172   6e-47    
gb|KDB13816.1|  eukaryotic translation initiation factor 3 subunit 6    171   7e-47    
ref|XP_007796230.1|  putative eukaryotic translation initiation f...    171   7e-47    
ref|XP_009516737.1|  hypothetical protein PHYSODRAFT_552766             171   7e-47    
ref|XP_003716642.1|  eukaryotic translation initiation factor 3 s...    171   7e-47    
gb|KFY50756.1|  hypothetical protein V496_09187                         172   7e-47    
emb|CCF54114.1|  related to eukaryotic initiation factor 3e subunit     173   8e-47    
gb|EFZ21185.1|  hypothetical protein SINV_09055                         171   9e-47    
gb|KFY90845.1|  hypothetical protein V498_05796                         172   1e-46    
ref|XP_003051640.1|  predicted protein                                  171   1e-46    
ref|XP_011176003.1|  PREDICTED: eukaryotic translation initiation...    171   1e-46    
gb|EFX03392.1|  eukaryotic translation initiation factor 3 subunit      171   1e-46    
ref|XP_011176002.1|  PREDICTED: eukaryotic translation initiation...    171   1e-46    
ref|XP_011062618.1|  PREDICTED: eukaryotic translation initiation...    171   1e-46    
gb|KEQ93557.1|  hypothetical protein AUEXF2481DRAFT_41795               171   1e-46    
ref|XP_011062617.1|  PREDICTED: eukaryotic translation initiation...    171   1e-46    
ref|XP_006608307.1|  PREDICTED: eukaryotic translation initiation...    170   2e-46    
ref|XP_003695661.1|  PREDICTED: eukaryotic translation initiation...    170   2e-46    
ref|XP_006571750.1|  PREDICTED: eukaryotic translation initiation...    170   2e-46    
gb|EGI60377.1|  Eukaryotic translation initiation factor 3 subunit E    170   2e-46    
ref|XP_005821626.1|  translation initiation factor 3, subunit E         170   3e-46    
ref|XP_009013291.1|  hypothetical protein HELRODRAFT_74899              170   3e-46    
ref|XP_003706056.1|  PREDICTED: eukaryotic translation initiation...    170   3e-46    
ref|XP_623637.3|  PREDICTED: eukaryotic translation initiation fa...    170   3e-46    
ref|XP_005786803.1|  hypothetical protein EMIHUDRAFT_426559             169   3e-46    
emb|CCE27126.1|  probable Int-6 protein                                 169   3e-46    
ref|XP_008657107.1|  PREDICTED: eukaryotic translation initiation...    163   3e-46    
ref|XP_002423197.1|  eukaryotic translation initiation factor 3 s...    169   3e-46    
ref|XP_011311912.1|  PREDICTED: eukaryotic translation initiation...    169   4e-46    
ref|XP_008660036.1|  PREDICTED: eukaryotic translation initiation...    162   4e-46    
gb|EMS20326.1|  translation initiation factor eIF-3 subunit 6           171   4e-46    
ref|XP_007584419.1|  putative eukaryotic translation initiation f...    169   7e-46    
gb|KEQ77372.1|  eukaryotic translation initiation factor 3, subun...    168   8e-46    
gb|KFV47267.1|  Eukaryotic translation initiation factor 3 subunit E    168   8e-46    
ref|XP_003841873.1|  similar to eukaryotic translation initiation...    168   1e-45    
gb|EPQ66193.1|  eIF3 subunit                                            168   1e-45    
ref|XP_007882093.1|  hypothetical protein PFL1_06361                    169   1e-45    
ref|XP_002901722.1|  eukaryotic translation initiation factor 3, ...    168   2e-45    
gb|KFY24090.1|  hypothetical protein V493_05454                         167   2e-45    
emb|CCU75798.1|  Eukaryotic translation initiation factor 3 subun...    167   2e-45    
ref|XP_007696375.1|  hypothetical protein COCSADRAFT_79107              167   2e-45    
ref|XP_007687079.1|  hypothetical protein COCMIDRAFT_4532               167   2e-45    
ref|XP_505760.1|  YALI0F22671p                                          167   2e-45    
gb|EMD97494.1|  hypothetical protein COCHEDRAFT_1125087                 167   2e-45    
gb|AFW62910.1|  putative eukaryotic translation initiation factor...    162   2e-45    
gb|KEQ67437.1|  eukaryotic translation initiation factor 3, subun...    167   2e-45    
gb|KEQ82712.1|  eukaryotic translation initiation factor 3, subun...    167   3e-45    
ref|XP_007403632.1|  hypothetical protein MELLADRAFT_32535              167   3e-45    
ref|XP_008087326.1|  Winged helix DNA-binding protein                   167   3e-45    
ref|XP_003027106.1|  hypothetical protein SCHCODRAFT_70798              167   3e-45    
gb|EHJ71134.1|  eukaryotic translation initiation factor 3 subunit E    167   4e-45    
gb|EGU12876.1|  Eukaryotic translation initiation factor 3 subunit 6    172   4e-45    
dbj|GAC73599.1|  translation initiation factor 3, subunit e             167   4e-45    
ref|XP_011252698.1|  PREDICTED: eukaryotic translation initiation...    167   4e-45    
ref|XP_007722267.1|  eukaryotic translation initiation factor 3 s...    166   4e-45    
ref|XP_011252697.1|  PREDICTED: eukaryotic translation initiation...    166   4e-45    
ref|NP_001144240.1|  uncharacterized protein LOC100277107               160   5e-45    
gb|EHK23492.1|  hypothetical protein TRIVIDRAFT_74050                   166   6e-45    
ref|XP_002838485.1|  hypothetical protein                               159   6e-45    
gb|ETS63620.1|  hypothetical protein PaG_01919                          167   8e-45    
ref|XP_008656891.1|  PREDICTED: eukaryotic translation initiation...    160   8e-45    
gb|KHJ33431.1|  putative eukaryotic translation initiation factor...    166   9e-45    



>ref|XP_009782891.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Nicotiana sylvestris]
Length=438

 Score =   393 bits (1010),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAAKYDLTPRIAPQLDRHLVFPLLEFLQER LY DED+LKAKIELLN TNMVDYAMDIHK
Sbjct  1    MAAKYDLTPRIAPQLDRHLVFPLLEFLQERTLYPDEDMLKAKIELLNHTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLYHTEDVPQEM++RR EVVARLKALEEAAAPL+ FLQN++AVQELRADKQHNLQLL +R
Sbjct  61   SLYHTEDVPQEMMERRAEVVARLKALEEAAAPLINFLQNSSAVQELRADKQHNLQLLQER  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS+SALWGKLAAEILMQN
Sbjct  121  YQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSVSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFSTPL+
Sbjct  181  WDIALEELNRLKEIIDSKSFSTPLN  205



>ref|XP_009630704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E {ECO:0000255|HAMAP-Rule:MF_03004} [Nicotiana tomentosiformis]
Length=438

 Score =   392 bits (1006),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAAKYDLTPRIAPQLDRHLVFPLLEFLQER LY DED+LKAKIELLN TNMVD+AMDIHK
Sbjct  1    MAAKYDLTPRIAPQLDRHLVFPLLEFLQERTLYPDEDMLKAKIELLNHTNMVDFAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLYHTEDVPQEM++RR EVVARLKALEEAAAPL+ FLQN++AVQELRADKQHNLQLL +R
Sbjct  61   SLYHTEDVPQEMMERRAEVVARLKALEEAAAPLINFLQNSSAVQELRADKQHNLQLLQER  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS+SALWGKLAAEILMQN
Sbjct  121  YQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSVSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFSTPL+
Sbjct  181  WDIALEELNRLKEIIDSKSFSTPLN  205



>ref|XP_002308015.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
 gb|ABK95989.1| unknown [Populus trichocarpa]
 gb|EEE91538.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
Length=437

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+M++RRVEVVARLKALEEAA PLV FLQNA+AVQELRADKQ+NLQ+L+DRYQ
Sbjct  62   YHTEDVPQDMIERRVEVVARLKALEEAATPLVSFLQNASAVQELRADKQYNLQMLHDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGK+AAE+LMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKMAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFSTPL+
Sbjct  182  IALEELNRLKEIIDSKSFSTPLN  204



>ref|XP_011015723.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X1 [Populus euphratica]
Length=437

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+M++RRVEVVARLKALEEAA PLV FLQNA+AVQELRADKQ+NLQ+L+DRYQ
Sbjct  62   YHTEDVPQDMIERRVEVVARLKALEEAATPLVAFLQNASAVQELRADKQYNLQMLHDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGK+AAE+LMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKMAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFSTPL+
Sbjct  182  IALEELNRLKEIIDSKSFSTPLN  204



>ref|XP_011048096.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Populus euphratica]
Length=437

 Score =   386 bits (991),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 196/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+M++RRVEVVARLKALEEAA PLV FLQNA+AVQELRADKQ+NLQ+L+DRYQ
Sbjct  62   YHTEDVPQDMIERRVEVVARLKALEEAATPLVAFLQNASAVQELRADKQYNLQMLHDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGK+AAE+LMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKMAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFSTPL+
Sbjct  182  IALEELNRLKEIIDSKSFSTPLN  204



>gb|KHG29832.1| Eukaryotic translation initiation factor 3 subunit E [Gossypium 
arboreum]
Length=359

 Score =   383 bits (983),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRI P LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIGPSLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHT+DVPQ+MV+RRVEVVARLKALE+AAAPLV FLQN NAVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTDDVPQDMVERRVEVVARLKALEDAAAPLVTFLQNPNAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>gb|KHG29831.1| Eukaryotic translation initiation factor 3 subunit E [Gossypium 
arboreum]
Length=437

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRI P LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIGPSLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHT+DVPQ+MV+RRVEVVARLKALE+AAAPLV FLQN NAVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTDDVPQDMVERRVEVVARLKALEDAAAPLVTFLQNPNAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>gb|KJB46273.1| hypothetical protein B456_007G355800 [Gossypium raimondii]
Length=437

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/203 (91%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRI P LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIGPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVPQ+MVDRRVEVVARLKALE+AAAPLV FLQN NAVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YRTDDVPQDMVDRRVEVVARLKALEDAAAPLVTFLQNPNAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_007202066.1| hypothetical protein PRUPE_ppa005923mg [Prunus persica]
 gb|EMJ03265.1| hypothetical protein PRUPE_ppa005923mg [Prunus persica]
Length=437

 Score =   382 bits (980),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPRIAP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MV+RRVEVVARLKALEE+AAPLV FLQNA AVQELRADKQ+NLQ+L++RYQ
Sbjct  62   YHTEDVPQDMVERRVEVVARLKALEESAAPLVNFLQNAAAVQELRADKQYNLQMLHERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGPQQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+P++
Sbjct  182  IALEELNRLKEIIDSKSFSSPMN  204



>ref|XP_008244286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Prunus mume]
Length=437

 Score =   381 bits (979),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 197/203 (97%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPRIAP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MV+RRVEVVARLKALEE+AAPLV FLQNA AVQELRADKQ+NLQ+L++RYQ
Sbjct  62   YHTEDVPQDMVERRVEVVARLKALEESAAPLVNFLQNAAAVQELRADKQYNLQMLHERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGPQQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+P++
Sbjct  182  IALEELNRLKEIIDSKSFSSPMN  204



>ref|XP_009363228.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363229.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X3 [Pyrus x bretschneideri]
Length=437

 Score =   380 bits (976),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVP +MVDRRVEVVARLKALEE+AAPLV FLQNA A QEL+ADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPHDMVDRRVEVVARLKALEESAAPLVNFLQNAAAFQELKADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR+LSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRNLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+P++
Sbjct  182  IALEELNRLKEIIDSKSFSSPMN  204



>ref|XP_009363227.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVP +MVDRRVEVVARLKALEE+AAPLV FLQNA A QEL+ADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPHDMVDRRVEVVARLKALEESAAPLVNFLQNAAAFQELKADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR+LSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRNLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+P++
Sbjct  182  IALEELNRLKEIIDSKSFSSPMN  204



>ref|XP_008464598.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cucumis melo]
Length=437

 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ADYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MVDRR EVVARLKALEE+AAPLV FLQN  AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPQDMVDRRAEVVARLKALEESAAPLVAFLQNPAAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAE+LMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IA+EELNRLKEIIDSK+FS+P++
Sbjct  182  IAVEELNRLKEIIDSKNFSSPMN  204



>ref|XP_004142652.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Cucumis sativus]
 gb|KGN54509.1| hypothetical protein Csa_4G343070 [Cucumis sativus]
Length=437

 Score =   379 bits (974),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ADYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MVDRR EVVARLKALEE+AAPLV FLQN  AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPQDMVDRRAEVVARLKALEESAAPLVAFLQNPAAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAE+LMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IA+EELNRLKEIIDSK+FS+P++
Sbjct  182  IAVEELNRLKEIIDSKNFSSPMN  204



>gb|KJB46272.1| hypothetical protein B456_007G355700 [Gossypium raimondii]
Length=437

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRI P LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIGPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVPQ+MV+RRVEVVARLKALE+AAAPLV FLQN NAVQELR+DKQ+NLQ+LNDRYQ
Sbjct  62   YRTDDVPQDMVERRVEVVARLKALEDAAAPLVTFLQNPNAVQELRSDKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_011075359.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Sesamum indicum]
Length=438

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAAKYDLT RIAPQLDRHLVFPLLEFLQER LY +EDILKAKIELLNDTNMVDYAMDIHK
Sbjct  1    MAAKYDLTQRIAPQLDRHLVFPLLEFLQERGLYPEEDILKAKIELLNDTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLY ++DVPQEMV+RR EVV RLKALEE AAPL+ FL N NA QELRADKQ+NLQ+L+DR
Sbjct  61   SLYRSDDVPQEMVERRAEVVGRLKALEEGAAPLIAFLHNPNAFQELRADKQYNLQMLSDR  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN
Sbjct  121  YQIGPQQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            W+IALEELNRLKEIIDSKSFS+PL+
Sbjct  181  WEIALEELNRLKEIIDSKSFSSPLN  205



>ref|XP_006351291.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Solanum tuberosum]
Length=438

 Score =   377 bits (969),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MA+KYDLTPRIA QLD HL+FPLLEFLQE+ LY DE ILKAKIELLN TNMVDYAMDIHK
Sbjct  1    MASKYDLTPRIAQQLDIHLIFPLLEFLQEQGLYPDEYILKAKIELLNHTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLYHT+DVPQEM++RR EVVARLKALEEAAAPL+ FLQN++AVQELRADKQHNLQLL +R
Sbjct  61   SLYHTDDVPQEMMERRAEVVARLKALEEAAAPLITFLQNSSAVQELRADKQHNLQLLQER  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS+SALWGKLAAEILMQN
Sbjct  121  YQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSVSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFSTPL+
Sbjct  181  WDIALEELNRLKEIIDSKSFSTPLN  205



>ref|XP_008351631.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Malus domestica]
Length=437

 Score =   377 bits (969),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ MVDRRVEVVARLKALEE+AAPLV FLQNA A QEL+ADKQ+NL +LNDRYQ
Sbjct  62   YHTEDVPQXMVDRRVEVVARLKALEESAAPLVNFLQNAAAFQELKADKQYNLHMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR+LSALWGKLAAEILMQNWD
Sbjct  122  IGPHQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRNLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+P++
Sbjct  182  IALEELNRLKEIIDSKSFSSPMN  204



>ref|XP_007030845.1| Eukaryotic translation initiation factor 3E [Theobroma cacao]
 gb|EOY11347.1| Eukaryotic translation initiation factor 3E [Theobroma cacao]
Length=437

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQL+ DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ASYDLTPRIAPNLDRHLVFPLLEFLQERQLHPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHT+DVPQ+M++RRVEVVARLKALE+AAAPLV FLQN NAVQELRADK +NLQ+LNDRY 
Sbjct  62   YHTDDVPQDMIERRVEVVARLKALEDAAAPLVTFLQNPNAVQELRADKHYNLQMLNDRYL  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_004249215.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Solanum lycopersicum]
Length=438

 Score =   377 bits (968),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MA+KYDLTPR+A QLD HL+FPLLEFLQE+ LY DE ILKAKIELLN TNMVDYAMDIHK
Sbjct  1    MASKYDLTPRVAQQLDIHLIFPLLEFLQEQGLYPDEYILKAKIELLNHTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLYHT+DVPQEM++RR EVVARLKALEEAAAPL+ FLQN++AVQELRADKQHNLQLL +R
Sbjct  61   SLYHTDDVPQEMMERRAEVVARLKALEEAAAPLITFLQNSSAVQELRADKQHNLQLLQER  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS+SALWGKLAAEILMQN
Sbjct  121  YQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSVSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFSTPL+
Sbjct  181  WDIALEELNRLKEIIDSKSFSTPLN  205



>ref|XP_002284533.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Vitis vinifera]
Length=437

 Score =   376 bits (966),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A +DLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATHDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MV+RR EVVARLKALEEAAAPLV FLQN NAVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPQDMVERRAEVVARLKALEEAAAPLVSFLQNPNAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGQEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             A EELNRLKEIIDSKS+++PL+
Sbjct  182  TAFEELNRLKEIIDSKSYASPLN  204



>ref|XP_007145575.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris]
 gb|ESW17569.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris]
Length=437

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPR+AP LDRHLVFPLLEFLQERQLY D+ ILKAKI+LLN+TNMVDYAMDIHKSL
Sbjct  2    ADYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDDHILKAKIDLLNNTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVP +MV+RR EVVARLK+LEEAAAPLV FLQNA+AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPHDMVERRAEVVARLKSLEEAAAPLVSFLQNASAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPAQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSF++PL+
Sbjct  182  IALEELNRLKEIIDSKSFASPLN  204



>gb|KDP26094.1| hypothetical protein JCGZ_21127 [Jatropha curcas]
Length=435

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPR+AP LDRHLVFPLLEFLQERQLY ++ I K+KIELLN TNMVDYAMDIHKSL
Sbjct  2    ANYDLTPRMAPHLDRHLVFPLLEFLQERQLYPEDQIFKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MV+RR EVVARLKALEE AAPLV FLQNA+AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPQDMVERRAEVVARLKALEEGAAPLVAFLQNASAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGTEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_011078923.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Sesamum indicum]
Length=438

 Score =   376 bits (965),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MA+KYDLT RIAPQLDRHLVFPLLEFLQER LY +ED+LKAKIELLN+TNMVDYAMDIHK
Sbjct  1    MASKYDLTQRIAPQLDRHLVFPLLEFLQERGLYPEEDLLKAKIELLNNTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLY ++DVP EMV+RR EVV RLKALEEAAAPL+ FLQN NAVQELRADKQ+NLQ+LNDR
Sbjct  61   SLYRSDDVPTEMVERRAEVVGRLKALEEAAAPLITFLQNPNAVQELRADKQYNLQMLNDR  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTN++R+LSALWGKLAAEILMQN
Sbjct  121  YQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNNERNLSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFS+PL+
Sbjct  181  WDIALEELNRLKEIIDSKSFSSPLN  205



>gb|KCW90114.1| hypothetical protein EUGRSUZ_A02306 [Eucalyptus grandis]
Length=316

 Score =   370 bits (951),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFP+LEFLQERQLY DE+ILK+KIELL+ TNMVDYAMDIHKSL
Sbjct  2    ASYDLTPRIAPNLDRHLVFPMLEFLQERQLYPDEEILKSKIELLSQTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+M++RR EVVARLKALEEAA PLV FLQN +AVQELRAD+ +NLQ+L DR+Q
Sbjct  62   YHTEDVPQDMMERRAEVVARLKALEEAATPLVNFLQNPSAVQELRADRSYNLQMLQDRHQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R+LSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERNLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_003535892.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Glycine max]
Length=437

 Score =   374 bits (960),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQLY D+ ILKAKI+LLN+TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDDHILKAKIDLLNNTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVP +MVDRR EVVARLK+LEEAAAPLV FLQN  AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPNDMVDRRAEVVARLKSLEEAAAPLVAFLQNEAAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPAQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKNFASPLN  204



>ref|XP_010523678.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tarenaya hassleriana]
Length=444

 Score =   373 bits (958),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +2

Query  44   QSASMAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAM  223
            +S +  A YDLTPRIAP LDRHLVFP+LEFLQERQLY D+ ILK KIELLN TNMVDYAM
Sbjct  3    ESGANMANYDLTPRIAPNLDRHLVFPMLEFLQERQLYPDDQILKWKIELLNKTNMVDYAM  62

Query  224  DIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL  403
            DIHKSLYHT+D PQ+MV+RR EVVARLK+LEEAAAPLV FLQN NAVQELRADKQ+NLQ+
Sbjct  63   DIHKSLYHTDDAPQDMVERRAEVVARLKSLEEAAAPLVAFLQNPNAVQELRADKQYNLQM  122

Query  404  LNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEI  583
            L +RYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYR LCTNS+RSLSALWGK A+EI
Sbjct  123  LKERYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRTLCTNSERSLSALWGKFASEI  182

Query  584  LMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            LMQNWDIALEELNRLKEIIDSKSFS+PL+
Sbjct  183  LMQNWDIALEELNRLKEIIDSKSFSSPLN  211



>ref|XP_004303635.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Fragaria vesca subsp. vesca]
Length=437

 Score =   372 bits (956),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLTPRIAP LDRHLVFPL+EFLQERQLY DE ILK KI+LLN TNMVDYAMDIHKSL
Sbjct  2    AEHDLTPRIAPNLDRHLVFPLMEFLQERQLYPDELILKCKIDLLNRTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHT+DVPQEMV+ R EVVARLKALEE+AAPLV FLQNA+AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTDDVPQEMVEMRAEVVARLKALEESAAPLVNFLQNASAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+FS+P++
Sbjct  182  IALEELNRLKEIIDSKNFSSPMN  204



>ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Glycine max]
Length=437

 Score =   372 bits (956),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQLY D  ILKAKI+LLN+TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDNHILKAKIDLLNNTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VP +MVDRR EVVARLK+LEEAAAPLV FLQNA AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEEVPHDMVDRRAEVVARLKSLEEAAAPLVAFLQNAAAVQELRADKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQY+KFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPAQIEALYQYSKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKNFASPLN  204



>ref|XP_011033185.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Populus euphratica]
 ref|XP_011033187.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Populus euphratica]
Length=439

 Score =   372 bits (955),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQE QLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIAPNLDRHLVFPLLEFLQESQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TE+VPQ+M+DRR EVVARLKALEEAAAPLV+FLQNA+AVQELRADKQ+NLQ+L+DRYQ
Sbjct  62   YRTEEVPQDMIDRRAEVVARLKALEEAAAPLVEFLQNASAVQELRADKQYNLQMLHDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIEALYQYAKFQFECGNYSGAADYLYQYR LC NS+RS+SALWGK+AAEILMQNWD
Sbjct  122  IGQEQIEALYQYAKFQFECGNYSGAADYLYQYRGLCNNSERSMSALWGKMAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_010056741.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Eucalyptus grandis]
 gb|KCW90113.1| hypothetical protein EUGRSUZ_A02306 [Eucalyptus grandis]
Length=437

 Score =   371 bits (952),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFP+LEFLQERQLY DE+ILK+KIELL+ TNMVDYAMDIHKSL
Sbjct  2    ASYDLTPRIAPNLDRHLVFPMLEFLQERQLYPDEEILKSKIELLSQTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+M++RR EVVARLKALEEAA PLV FLQN +AVQELRAD+ +NLQ+L DR+Q
Sbjct  62   YHTEDVPQDMMERRAEVVARLKALEEAATPLVNFLQNPSAVQELRADRSYNLQMLQDRHQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R+LSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERNLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_008806586.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Phoenix dactylifera]
Length=435

 Score =   370 bits (951),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 195/203 (96%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLYAD++ILKAKIELL+ TNMVDYAMDIHK+L
Sbjct  2    ANYDLTPRIAPHLDRHLVFPLLEFLQERQLYADDEILKAKIELLSQTNMVDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQEM+DRRV+VVARLK+LEE+AAPL+ FLQNA  VQELR DKQ+N+Q+L+DR+Q
Sbjct  62   YHTEEVPQEMIDRRVDVVARLKSLEESAAPLISFLQNATLVQELRPDKQYNIQMLSDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG +QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGVDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKNFASPLN  204



>ref|XP_002322658.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
 gb|EEF04419.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
Length=437

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQE QLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTPRIAPNLDRHLVFPLLEFLQESQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TE+VPQ+M+DRR EVVARLKALEEAAAPLV+FLQNA+A+QELRADKQ+NLQ+L++RYQ
Sbjct  62   YRTEEVPQDMIDRRAEVVARLKALEEAAAPLVEFLQNASAMQELRADKQYNLQMLHERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIEALYQYAKFQFECGNYSGAADYLYQYR LC NS+RSLSALWGK+AAEILMQNWD
Sbjct  122  IGQEQIEALYQYAKFQFECGNYSGAADYLYQYRGLCNNSERSLSALWGKMAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+PL+
Sbjct  182  IALEELNRLKEIIDSKSFSSPLN  204



>ref|XP_010554805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Tarenaya hassleriana]
Length=445

 Score =   369 bits (948),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDIHK+L
Sbjct  9    ASYDLTPRVAPNLDRHLVFPMLEFLQERQLYPDEQILKWKIELLNKTNMVDYAMDIHKNL  68

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHT+D PQ+MV+RR EVVARLK+LEEAAAPLV FLQN NAVQELRADKQ+NLQ+L +RYQ
Sbjct  69   YHTDDAPQDMVERRAEVVARLKSLEEAAAPLVAFLQNPNAVQELRADKQYNLQVLKERYQ  128

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAADYLYQYR LCTNS+RSLSALWGK A+EILMQNWD
Sbjct  129  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRTLCTNSERSLSALWGKFASEILMQNWD  188

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSFS+P++
Sbjct  189  IALEELNRLKEIIDSKSFSSPIN  211



>gb|EYU18691.1| hypothetical protein MIMGU_mgv1a006587mg [Erythranthe guttata]
Length=438

 Score =   369 bits (947),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAAKYDLT RIAPQLDRHLVFPLLEFLQE+ LYA+EDILKAKI+LLN TNMVDYAMDIHK
Sbjct  1    MAAKYDLTQRIAPQLDRHLVFPLLEFLQEKGLYAEEDILKAKIDLLNQTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLY ++DVPQ+MVDRR EVV RLKALEE AAPL+ FLQN +A QELRADKQ+NLQ+LNDR
Sbjct  61   SLYRSDDVPQDMVDRRAEVVGRLKALEEGAAPLMAFLQNPSAYQELRADKQYNLQMLNDR  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIG EQIEALYQYAKFQFECGNYSGAADYLYQYRAL TNSDRSLSALWGKLAAEILMQN
Sbjct  121  YQIGTEQIEALYQYAKFQFECGNYSGAADYLYQYRALSTNSDRSLSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSK+FS+P++
Sbjct  181  WDIALEELNRLKEIIDSKNFSSPMN  205



>gb|ACJ84967.1| unknown [Medicago truncatula]
Length=211

 Score =   360 bits (925),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQLY D  ILKAKIELLN+TNMVDYAMDI K+L
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDNHILKAKIELLNNTNMVDYAMDIFKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+MV+RR +VVARLK+LE+AAAPLV FLQN  AVQELRADK +NLQ+LND+YQ
Sbjct  62   YQTEDVPQDMVERRADVVARLKSLEDAAAPLVAFLQNPAAVQELRADKHYNLQMLNDKYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSL+ALWGKLAAE+LMQNWD
Sbjct  122  IGPAQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLNALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+FS+PL+
Sbjct  182  IALEELNRLKEIIDSKNFSSPLN  204



>gb|EYU20768.1| hypothetical protein MIMGU_mgv1a006585mg [Erythranthe guttata]
Length=438

 Score =   369 bits (946),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MA+KYDLT RI PQLDRHLVFPLLEFLQER +Y +EDILKAKI+LLN TNMVDYAMDIHK
Sbjct  1    MASKYDLTQRIGPQLDRHLVFPLLEFLQERGMYPEEDILKAKIDLLNHTNMVDYAMDIHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            SLY ++DVPQEMV+RR EVV RLKALEE AAPLV FLQ+++AVQELRADKQ+NLQ+LNDR
Sbjct  61   SLYRSDDVPQEMVERRSEVVGRLKALEEGAAPLVTFLQDSSAVQELRADKQYNLQMLNDR  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIG EQIEALYQYAKFQFECGNYSGAADYLYQYRAL TNS+RSLSALWGKLAAEILMQN
Sbjct  121  YQIGSEQIEALYQYAKFQFECGNYSGAADYLYQYRALSTNSERSLSALWGKLAAEILMQN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFS+P++
Sbjct  181  WDIALEELNRLKEIIDSKSFSSPMN  205



>ref|XP_010931576.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Elaeis guineensis]
Length=436

 Score =   367 bits (943),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIAP LDRHLVFPLLEFLQERQLYA+++ILKAKIELL+ TNMVDYAMDIHK+L
Sbjct  2    ANYDLTSRIAPHLDRHLVFPLLEFLQERQLYAEDEILKAKIELLSQTNMVDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQEMVDRRV+VVARLK+LEE+ APL+ FLQNA  VQELR DKQ+N+Q+LNDR+Q
Sbjct  62   YHTEEVPQEMVDRRVQVVARLKSLEESVAPLISFLQNATLVQELRPDKQYNIQMLNDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG +QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGVDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKNFASPLN  204



>ref|XP_010672915.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Beta vulgaris subsp. vulgaris]
Length=437

 Score =   366 bits (939),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAPQLDRHLVFPLLEFLQERQ Y +E +LKAKIELL+ TNMVDYAMDIHK+L
Sbjct  2    ANYDLTPRIAPQLDRHLVFPLLEFLQERQFYPEEQLLKAKIELLSKTNMVDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHT+DVPQ+MV RRVEVVA LKALEE AAPLV FLQN + VQELRADKQ+NLQ+L +RYQ
Sbjct  62   YHTDDVPQDMVGRRVEVVASLKALEEGAAPLVIFLQNEDKVQELRADKQYNLQMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIEALYQYAKFQFECGNYSGAAD+LYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIEALYQYAKFQFECGNYSGAADFLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKAFTSPLN  204



>ref|XP_004516371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Cicer arietinum]
Length=437

 Score =   365 bits (936),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQLY D  ILKAKI+LLN+TNMVDYAMDIHK+L
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDNHILKAKIDLLNNTNMVDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+MV+RRV+VVARLK+LE+AAAPLV FLQN  AVQELRADK +NLQ+LND+YQ
Sbjct  62   YQTEDVPQDMVERRVDVVARLKSLEDAAAPLVAFLQNPAAVQELRADKHYNLQMLNDKYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAE+LMQNWD
Sbjct  122  IGPAQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+FS+P++
Sbjct  182  IALEELNRLKEIIDSKNFSSPIN  204



>gb|AFK46442.1| unknown [Medicago truncatula]
Length=437

 Score =   364 bits (935),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPRIAP LDRHLVFPLLEFLQERQLY D  ILKAKI+LLN+TNMVDYAMDIHK+L
Sbjct  2    AEYDLTPRIAPNLDRHLVFPLLEFLQERQLYNDNHILKAKIDLLNNTNMVDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+M++RR +VVARLK+LE+AAAPLV FLQNA+AVQEL+ADK +NLQLLND+YQ
Sbjct  62   YQTEDVPQDMIERRADVVARLKSLEDAAAPLVAFLQNASAVQELKADKHYNLQLLNDKYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQY KFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAE+LMQNWD
Sbjct  122  IGPAQIEALYQYGKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKE+IDSK+FS+P++
Sbjct  182  IALEELNRLKEMIDSKNFSSPMN  204



>gb|KEH38776.1| eukaryotic translation initiation factor 3E [Medicago truncatula]
Length=437

 Score =   364 bits (935),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPRIAP LDRHLVFPLLEFLQERQLY D  ILKAKI+LLN+TNMVDYAMDIHK+L
Sbjct  2    AEYDLTPRIAPNLDRHLVFPLLEFLQERQLYNDNHILKAKIDLLNNTNMVDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+M++RR +VVARLK+LE+AAAPLV FLQNA+AVQEL+ADK +NLQLLND+YQ
Sbjct  62   YQTEDVPQDMIERRADVVARLKSLEDAAAPLVAFLQNASAVQELKADKHYNLQLLNDKYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQY KFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAE+LMQNWD
Sbjct  122  IGPAQIEALYQYGKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKE+IDSK+FS+P++
Sbjct  182  IALEELNRLKEMIDSKNFSSPMN  204



>ref|XP_010090220.1| Eukaryotic translation initiation factor 3 subunit E [Morus notabilis]
 gb|EXB39089.1| Eukaryotic translation initiation factor 3 subunit E [Morus notabilis]
Length=435

 Score =   363 bits (931),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    ADYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MV+RRVEVVA+LKALE+AAAPLV FLQN  AVQELRADKQ+NL +LN+RYQ
Sbjct  62   YHTEDVPQDMVERRVEVVAKLKALEDAAAPLVTFLQNPAAVQELRADKQYNLHMLNERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQI+ALYQYAKFQFECGNYSGAADYLYQYRALCTNS++SLSALWGKLAAEILMQNWD
Sbjct  122  IGTEQIDALYQYAKFQFECGNYSGAADYLYQYRALCTNSEKSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             A EEL RL+EIIDSK+FS+P++
Sbjct  182  TAQEELTRLREIIDSKNFSSPMN  204



>ref|XP_009410425.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E {ECO:0000255|HAMAP-Rule:MF_03004} [Musa acuminata subsp. 
malaccensis]
Length=440

 Score =   362 bits (930),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIAP LDRHLVFPLLEFLQER+LYAD++ILKAKI+LL+ TNMVDYAMDIHK+L
Sbjct  2    ADYDLTSRIAPHLDRHLVFPLLEFLQERELYADDEILKAKIQLLSQTNMVDYAMDIHKAL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQEMV RRVEVVARLK+LEE AAPL+ FLQNA+ VQELR DKQ+N+Q+L+DR+Q
Sbjct  62   YHTEDVPQEMVGRRVEVVARLKSLEELAAPLISFLQNASLVQELRPDKQYNIQMLHDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG +QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGADQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             ALEELNRLKEIIDSKSF++PL+
Sbjct  182  TALEELNRLKEIIDSKSFASPLN  204



>gb|ABR16601.1| unknown [Picea sitchensis]
Length=409

 Score =   362 bits (928),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IAP LDRHLVFPLLEFLQE+QLY D+ ILK+KI+LL+ TNMVDYAMDIHKSL
Sbjct  2    AEYDLTSKIAPHLDRHLVFPLLEFLQEKQLYPDDQILKSKIDLLSKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+M DRRVEVVARLK+LEE AAPL+ FLQN + VQELR+DKQ+NLQ+LNDRYQ
Sbjct  62   YRTEDVPQDMTDRRVEVVARLKSLEEMAAPLISFLQNPSLVQELRSDKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAAD+LYQYR  CTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGPNQIEALYQYAKFQFECGNYSGAADFLYQYRTFCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+FS+PL+
Sbjct  182  IALEELNRLKEIIDSKNFSSPLN  204



>gb|ACN40777.1| unknown [Picea sitchensis]
Length=441

 Score =   362 bits (930),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IAP LDRHLVFPLLEFLQE+QLY D+ ILK+KI+LL+ TNMVDYAMDIHKSL
Sbjct  2    AEYDLTSKIAPHLDRHLVFPLLEFLQEKQLYPDDQILKSKIDLLSKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+M DRRVEVVARLK+LEE AAPL+ FLQN + VQELR+DKQ+NLQ+LNDRYQ
Sbjct  62   YRTEDVPQDMTDRRVEVVARLKSLEEMAAPLISFLQNPSLVQELRSDKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAAD+LYQYR  CTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGPNQIEALYQYAKFQFECGNYSGAADFLYQYRTFCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+FS+PL+
Sbjct  182  IALEELNRLKEIIDSKNFSSPLN  204



>ref|NP_567047.1| eukaryotic translation initiation factor 3E [Arabidopsis thaliana]
 gb|AAG53613.1|AF285832_1 eukaryotic initiation factor 3E subunit [Arabidopsis thaliana]
 gb|AAK64017.1| putative translation initiation factor 3 [Arabidopsis thaliana]
 gb|AAL85088.1| putative translation initiation factor 3 [Arabidopsis thaliana]
 gb|AEE79636.1| eukaryotic translation initiation factor 3E [Arabidopsis thaliana]
Length=441

 Score =   362 bits (930),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTP IAP LDRHLVFP+ EFLQERQLY DE ILK+KI+LLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPLIAPNLDRHLVFPIFEFLQERQLYPDEQILKSKIQLLNQTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQEMV+RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQEMVERRTEVVARLKSLEEAAAPLVSFLLNPNAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSFS+PL+
Sbjct  188  LEELNRLKEIIDSKSFSSPLN  208



>gb|AAF67757.1|AF255679_1 eIF3e [Arabidopsis thaliana]
Length=441

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTP IAP LDRHLVFP+ EFLQERQLY DE ILK+KI+LLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPLIAPNLDRHLVFPIFEFLQERQLYPDEQILKSKIQLLNQTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQEMV+RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQEMVERRTEVVARLKSLEEAAAPLVSFLLNPNAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSFS+PL+
Sbjct  188  LEELNRLKEIIDSKSFSSPLN  208



>ref|XP_002878144.1| hypothetical protein ARALYDRAFT_486171 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54403.1| hypothetical protein ARALYDRAFT_486171 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNQTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQ+MV+RR EVVARLK+LEEAAAPLV FL N  AVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQDMVERRAEVVARLKSLEEAAAPLVSFLLNPTAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSFS+PL+
Sbjct  188  LEELNRLKEIIDSKSFSSPLN  208



>gb|KFK34965.1| hypothetical protein AALP_AA5G216900 [Arabis alpina]
Length=443

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTPRIAP LDRHLVFP+LEFLQER LY DE ILK KIELLN+TNMVDYAMDIHKSLYH
Sbjct  10   YDLTPRIAPNLDRHLVFPILEFLQERVLYPDEQILKKKIELLNNTNMVDYAMDIHKSLYH  69

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQ+MV+RR EVVARLK+LEEAAAPLV FL N NA+QELRADKQ+NLQ+L +RYQIG
Sbjct  70   TEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPNALQELRADKQYNLQMLKERYQIG  129

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  130  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  189

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSFS+PL+
Sbjct  190  LEELNRLKEIIDSKSFSSPLN  210



>emb|CDY30993.1| BnaC04g24310D [Brassica napus]
Length=441

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQ+MV+RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPNAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNR+KEIIDSKSF++PL+
Sbjct  188  LEELNRVKEIIDSKSFASPLN  208



>emb|CDX88939.1| BnaA04g02470D [Brassica napus]
Length=441

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQ+MV+RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPNAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNR+KEIIDSKSF++PL+
Sbjct  188  LEELNRVKEIIDSKSFASPLN  208



>ref|XP_009139041.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Brassica rapa]
Length=441

 Score =   362 bits (928),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/201 (86%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQ+MV+RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPNAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNR+KEIIDSKSF++PL+
Sbjct  188  LEELNRVKEIIDSKSFASPLN  208



>ref|XP_010269659.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Nelumbo nucifera]
Length=439

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/202 (86%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIA  LDRHLVFPLLEFLQERQLY D++ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ANYDLTRRIAAHLDRHLVFPLLEFLQERQLYPDDEILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQ+MVDRRVEVVARLK+LEE+AAPL+ FLQN N+ QELR DKQ+NLQ+LNDRYQ
Sbjct  62   YHTEEVPQDMVDRRVEVVARLKSLEESAAPLISFLQNPNSFQELRPDKQYNLQMLNDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG +QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGSDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPL  667
            IALEELN+L+EIIDS++F +PL
Sbjct  182  IALEELNQLREIIDSRNFVSPL  203



>gb|KEH41514.1| eukaryotic translation initiation factor 3E [Medicago truncatula]
Length=437

 Score =   361 bits (926),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQLY D  ILKAKIELLN+TNMVDYAMDI K+L
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDNHILKAKIELLNNTNMVDYAMDIFKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVPQ+MV+RR +VVARLK+LE+AAAPLV FLQN  AVQELRADK +NLQ+LND+YQ
Sbjct  62   YQTEDVPQDMVERRADVVARLKSLEDAAAPLVAFLQNPAAVQELRADKHYNLQMLNDKYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSL+ALWGKLAAE+LMQNWD
Sbjct  122  IGPAQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLNALWGKLAAEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+FS+PL+
Sbjct  182  IALEELNRLKEIIDSKNFSSPLN  204



>ref|XP_008786889.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Phoenix dactylifera]
Length=436

 Score =   360 bits (924),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIAPQLDRHLVFPLLEFLQE QLYA+++ILKAKIELL+ TNM+DYAMDIHK+L
Sbjct  2    ANYDLTSRIAPQLDRHLVFPLLEFLQEHQLYAEDEILKAKIELLSQTNMIDYAMDIHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQEMVDRRV+VVARLK+LEE+AAPL+ FLQNA+ VQELR DKQ+N+Q+LNDR+Q
Sbjct  62   YHTEEVPQEMVDRRVQVVARLKSLEESAAPLISFLQNASLVQELRPDKQYNIQMLNDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG + IEALYQYAKFQFECGNYS AA YLYQYRALCTNSDRSLSALWGKLAAEILMQNWD
Sbjct  122  IGADHIEALYQYAKFQFECGNYSDAAVYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKNFASPLN  204



>ref|XP_010922234.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Elaeis guineensis]
Length=435

 Score =   360 bits (923),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = +2

Query  71   DLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYHT  250
            D T RIAP LDRHLVFPLLEFLQER+LYAD++ILKAKIELL+ TNMVDYAMDIHK+LYHT
Sbjct  5    DFTSRIAPHLDRHLVFPLLEFLQERELYADDEILKAKIELLSQTNMVDYAMDIHKTLYHT  64

Query  251  EDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGP  430
            E VPQEMVDRRVEVVARLK+LEE+AAPL+ FLQNA  VQELR DKQ+N+Q+LNDR+QIG 
Sbjct  65   EQVPQEMVDRRVEVVARLKSLEESAAPLMSFLQNATLVQELRPDKQYNIQMLNDRFQIGV  124

Query  431  EQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIAL  610
            +QIEALYQYAKFQFECGNYS AADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIAL
Sbjct  125  DQIEALYQYAKFQFECGNYSRAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIAL  184

Query  611  EELNRLKEIIDSKSFSTPLH  670
            EELNRLKEIIDSK+F++PL+
Sbjct  185  EELNRLKEIIDSKNFASPLN  204



>ref|XP_006837958.1| hypothetical protein AMTR_s00102p00062980 [Amborella trichopoda]
 gb|ERN00527.1| hypothetical protein AMTR_s00102p00062980 [Amborella trichopoda]
Length=438

 Score =   358 bits (919),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            ++YDLT +IAP LDRHLVFPLLEFLQER LYADE+ILKAKIELLN+TNMVDYAMD+HK+L
Sbjct  2    SEYDLTSKIAPHLDRHLVFPLLEFLQERHLYADEEILKAKIELLNETNMVDYAMDMHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y ++DVPQEM+DRRVEVVARLK+LEE+AAPLV FLQN   +QELR DKQ+NLQ+LNDR+Q
Sbjct  62   YRSDDVPQEMIDRRVEVVARLKSLEESAAPLVSFLQNPALLQELRPDKQYNLQMLNDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYS AAD+LYQYRALCTNSDRSLSALWGKLAAEILMQ+W+
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSAAADFLYQYRALCTNSDRSLSALWGKLAAEILMQSWE  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSK+F++PL+
Sbjct  182  IALEELNRLKEIIDSKNFASPLN  204



>emb|CDY06117.1| BnaA09g36630D [Brassica napus]
Length=441

 Score =   358 bits (918),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +2

Query  50   ASMAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDI  229
            A     YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDI
Sbjct  2    AETKENYDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMDI  61

Query  230  HKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLN  409
            HKSLYHTED PQ+MV+RR EVVARLK+LEEAAAPLV FL N  AVQELRADKQ+NLQ+L 
Sbjct  62   HKSLYHTEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPAAVQELRADKQYNLQMLK  121

Query  410  DRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILM  589
            +RYQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILM
Sbjct  122  ERYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILM  181

Query  590  QNWDIALEELNRLKEIIDSKSFSTPLH  670
            QNWDIA EELNR+K+IIDSKSF++PL+
Sbjct  182  QNWDIAFEELNRVKDIIDSKSFASPLN  208



>ref|XP_009116433.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Brassica rapa]
Length=441

 Score =   357 bits (917),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +2

Query  50   ASMAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDI  229
            A     YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDI
Sbjct  2    AETKENYDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMDI  61

Query  230  HKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLN  409
            HKSLYHTED PQ+MV+RR EVVARLK+LEEAAAPLV FL N  AVQELRADKQ+NLQ+L 
Sbjct  62   HKSLYHTEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPAAVQELRADKQYNLQMLK  121

Query  410  DRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILM  589
            +RYQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILM
Sbjct  122  ERYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILM  181

Query  590  QNWDIALEELNRLKEIIDSKSFSTPLH  670
            QNWDIA EELNR+K+IIDSKSF++PL+
Sbjct  182  QNWDIAFEELNRVKDIIDSKSFASPLN  208



>ref|XP_006402894.1| hypothetical protein EUTSA_v10005924mg [Eutrema salsugineum]
 gb|ESQ44347.1| hypothetical protein EUTSA_v10005924mg [Eutrema salsugineum]
Length=484

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 191/210 (91%), Gaps = 3/210 (1%)
 Frame = +2

Query  50   ASMAAK---YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYA  220
            A+MA     YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYA
Sbjct  42   ATMAESKENYDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYA  101

Query  221  MDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQ  400
            MDIHKSLYHTE+ P +M++RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ
Sbjct  102  MDIHKSLYHTEEAPPDMMERRGEVVARLKSLEEAAAPLVTFLLNPNAVQELRADKQYNLQ  161

Query  401  LLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAE  580
            +L +RYQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+E
Sbjct  162  MLKERYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASE  221

Query  581  ILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            ILMQNWDIALEELNRLKEIIDSKSF++PL+
Sbjct  222  ILMQNWDIALEELNRLKEIIDSKSFASPLN  251



>ref|XP_010279582.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Nelumbo nucifera]
Length=442

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 188/203 (93%), Gaps = 2/203 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT  IAP LDRHLVFPLLEFLQERQLY D++ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ANYDLTRIIAPHLDRHLVFPLLEFLQERQLYPDDEILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQ+MVDRRVEV  RLK+ E  AAPL+ FLQN N VQELR DKQ+NLQ+LNDR+Q
Sbjct  62   YHTEEVPQDMVDRRVEVFERLKSPE--AAPLISFLQNPNLVQELRHDKQYNLQMLNDRFQ  119

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTN+DRSLSALWGKLAAEILMQNWD
Sbjct  120  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNTDRSLSALWGKLAAEILMQNWD  179

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRL+EIIDSK+F++PL+
Sbjct  180  IALEELNRLREIIDSKNFTSPLN  202



>emb|CAB68135.1| translation initiation factor 3-like protein [Arabidopsis thaliana]
Length=418

 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTP IAP LDRHLVFP+ EFLQERQLY DE ILK+KI+LLN TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPLIAPNLDRHLVFPIFEFLQERQLYPDEQILKSKIQLLNQTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            TED PQEMV+RR EVVARLK+LEEAAAPLV FL N NAVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   TEDAPQEMVERRTEVVARLKSLEEAAAPLVSFLLNPNAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSF  655
            LEELNRLKEIIDSK F
Sbjct  188  LEELNRLKEIIDSKFF  203



>emb|CDX72053.1| BnaC08g28210D [Brassica napus]
Length=441

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +2

Query  50   ASMAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDI  229
            A +   YDLTPR+AP LDRHLVFP+LEFLQERQLY DE ILK KIELLN TNMVDYAMDI
Sbjct  2    AEIKENYDLTPRVAPNLDRHLVFPILEFLQERQLYPDEQILKFKIELLNKTNMVDYAMDI  61

Query  230  HKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLN  409
            HKSLYHTED PQ+MV+RR EVVARLK+LEEAAAPLV FL N  AVQELRADK +NLQ+L 
Sbjct  62   HKSLYHTEDAPQDMVERRAEVVARLKSLEEAAAPLVTFLLNPAAVQELRADKHYNLQMLK  121

Query  410  DRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILM  589
            +RYQIGP+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILM
Sbjct  122  ERYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILM  181

Query  590  QNWDIALEELNRLKEIIDSKSFSTPLH  670
            QNWDIA EELN +K+IIDSKSF++PL+
Sbjct  182  QNWDIAFEELNHVKDIIDSKSFASPLN  208



>ref|XP_006421164.1| hypothetical protein CICLE_v10004983mg [Citrus clementina]
 gb|AEI72270.1| eukaryotic translation initiation factor protein [Citrus trifoliata]
 gb|ESR34404.1| hypothetical protein CICLE_v10004983mg [Citrus clementina]
Length=439

 Score =   353 bits (906),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 189/205 (92%), Gaps = 2/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIAP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTQRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQH-NLQLLNDRY  418
            YHTEDVPQ+MV+RRVEVVARLKALEE AAP+V FLQN N+ Q+LRA+ QH NLQ+LNDRY
Sbjct  62   YHTEDVPQDMVERRVEVVARLKALEERAAPIVSFLQNPNSFQDLRANDQHYNLQMLNDRY  121

Query  419  QIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNW  598
            QIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R LSALWGK+AAEILMQNW
Sbjct  122  QIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERRLSALWGKMAAEILMQNW  181

Query  599  DIALEELNRLKEIIDS-KSFSTPLH  670
            DIALEELN+LKE +D  KSF++PL+
Sbjct  182  DIALEELNQLKEKVDDPKSFTSPLN  206



>gb|AIZ68193.1| eukaryotic translation initiation factor 3 subunit E-like protein 
[Ornithogalum saundersiae]
Length=438

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            AKYDLT +IAP LDRHLVFPLLEFLQER  Y D+DILKAKIELL+ TNMVDYAMDIHKSL
Sbjct  2    AKYDLTSQIAPHLDRHLVFPLLEFLQERGFYKDDDILKAKIELLSKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQEM DRR EVV+RLK+LEE+AAPL+ FLQN + V ELR DKQ+N+Q+LNDR++
Sbjct  62   YHTEEVPQEMFDRRAEVVSRLKSLEESAAPLISFLQNPSLVLELRPDKQYNVQMLNDRFK  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYS AADYLYQYRALCTNS+RSLSALWGKLAAE+LMQNW+
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSAAADYLYQYRALCTNSERSLSALWGKLAAEVLMQNWE  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             ALEELN LKEIIDSK+FS+PL+
Sbjct  182  TALEELNHLKEIIDSKNFSSPLN  204



>ref|XP_010427598.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelina sativa]
Length=441

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTP +AP LDRHLVFP+LEFLQE QLY +E ILK KIELL+ TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPLVAPNLDRHLVFPILEFLQEHQLYPEEQILKFKIELLSKTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            +ED PQ+MV+RR EVVARLK+LEEAAAPLV FL N +AVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   SEDAPQDMVERRAEVVARLKSLEEAAAPLVSFLLNPSAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSF++PL+
Sbjct  188  LEELNRLKEIIDSKSFASPLN  208



>ref|XP_010516342.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelina sativa]
Length=441

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTP +AP LDRHLVFP+LEFLQE QLY +E ILK KIELL+ TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPLVAPNLDRHLVFPILEFLQEHQLYPEEQILKFKIELLSKTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            +ED PQ+MV+RR EVVARLK+LEEAAAPLV FL N +AVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   SEDAPQDMVERRAEVVARLKSLEEAAAPLVSFLLNPSAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSF++PL+
Sbjct  188  LEELNRLKEIIDSKSFASPLN  208



>ref|XP_010504654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelina sativa]
Length=441

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = +2

Query  68   YDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYH  247
            YDLTP +AP LDRHLVFP+LEFLQE QLY +E ILK KIELL+ TNMVDYAMDIHKSLYH
Sbjct  8    YDLTPLVAPNLDRHLVFPILEFLQEHQLYPEEQILKFKIELLSKTNMVDYAMDIHKSLYH  67

Query  248  TEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIG  427
            +ED PQ+MV+RR EVVARLK+LEEAAAPLV FL N +AVQELRADKQ+NLQ+L +RYQIG
Sbjct  68   SEDAPQDMVERRAEVVARLKSLEEAAAPLVSFLLNPSAVQELRADKQYNLQMLKERYQIG  127

Query  428  PEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIA  607
            P+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWDIA
Sbjct  128  PDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWDIA  187

Query  608  LEELNRLKEIIDSKSFSTPLH  670
            LEELNRLKEIIDSKSF++PL+
Sbjct  188  LEELNRLKEIIDSKSFASPLN  208



>ref|XP_006491490.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Citrus sinensis]
 gb|KDO48230.1| hypothetical protein CISIN_1g013640mg [Citrus sinensis]
Length=439

 Score =   350 bits (899),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 189/205 (92%), Gaps = 2/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIAP LDRHLVFPLLEFLQERQ+Y DE ILK+KIELLN TNMVDYAMDIHKSL
Sbjct  2    ATYDLTQRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQH-NLQLLNDRY  418
            YHTEDVPQ+MV+RRVEVVARLKALEE AAP+V FLQN N+ Q+LRA+ QH NLQ+L+DRY
Sbjct  62   YHTEDVPQDMVERRVEVVARLKALEERAAPIVSFLQNPNSFQDLRANDQHYNLQMLHDRY  121

Query  419  QIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNW  598
            QIGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R LSALWGK+AAEILMQNW
Sbjct  122  QIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERRLSALWGKMAAEILMQNW  181

Query  599  DIALEELNRLKEIIDS-KSFSTPLH  670
            DIALEELN+LKE +D  KSF++PL+
Sbjct  182  DIALEELNQLKEKVDDPKSFTSPLN  206



>ref|XP_001783391.1| predicted protein [Physcomitrella patens]
 gb|EDQ51785.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT R+AP LDRHLVFPLLEFLQ++QLY+D+ ILK+KIELL  TNMVDYAMDIHKSL
Sbjct  2    AQYDLTARVAPFLDRHLVFPLLEFLQDKQLYSDDQILKSKIELLAKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MVDRR EVV RLK LEE+AAPL+ FLQN   VQELR+DKQ+NLQ+L +RYQ
Sbjct  62   YHTEDVPQDMVDRRAEVVGRLKVLEESAAPLISFLQNPALVQELRSDKQYNLQMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIEALYQYAKFQFECGNYSGA+DYLY+YRALCTNS+RS+SALWGKLA E+LMQNWD
Sbjct  122  IGSEQIEALYQYAKFQFECGNYSGASDYLYEYRALCTNSERSISALWGKLACEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             A +ELNRLKE IDSK+F++PL+
Sbjct  182  TATDELNRLKEFIDSKNFASPLN  204



>ref|XP_001765099.1| predicted protein [Physcomitrella patens]
 gb|EDQ70094.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   345 bits (885),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT  +AP LDRHLVFPLLEFLQE QLY+D+ ILKAKIELL  TNMVDYAMDIHKSL
Sbjct  2    AQYDLTAAVAPFLDRHLVFPLLEFLQENQLYSDDQILKAKIELLAKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MVDRR EVV RLK LEE+AAPL+ FLQN   VQELR+D+Q+NLQ+L +RYQ
Sbjct  62   YHTEDVPQDMVDRRAEVVGRLKVLEESAAPLISFLQNPALVQELRSDQQYNLQMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG +QIEALYQYAKFQFECGNYSGA+DYLYQYR LCTNS+RS+SALWGKLA EILMQNWD
Sbjct  122  IGSDQIEALYQYAKFQFECGNYSGASDYLYQYRTLCTNSERSISALWGKLACEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPL  667
            +A EE+NRLKE IDSKSF++PL
Sbjct  182  VATEEVNRLKETIDSKSFASPL  203



>ref|XP_001753385.1| predicted protein [Physcomitrella patens]
 gb|EDQ81608.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT ++AP LDRHLVFPLLEFLQ++Q+Y+D+ ILKAKIELL  TNMVDYAMDIHKSL
Sbjct  2    AQFDLTAKVAPFLDRHLVFPLLEFLQDKQIYSDDQILKAKIELLGKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTE+VPQ+MVDRRVEVV RLK LEE+A+PL+ FLQN   VQELR+DK +NLQ+L +R+Q
Sbjct  62   YHTEEVPQDMVDRRVEVVGRLKMLEESASPLISFLQNPALVQELRSDKHYNLQMLQERHQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIEALY YAKFQFECGNYSGA+DYLYQYR LCTNSDRS+SALWGKLA E+LMQNWD
Sbjct  122  IGSEQIEALYHYAKFQFECGNYSGASDYLYQYRTLCTNSDRSISALWGKLACEVLMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +A EELNRLKEIIDSK+F++PL+
Sbjct  182  VATEELNRLKEIIDSKNFASPLN  204



>ref|XP_004955814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Setaria italica]
Length=439

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT  +A Q+DRHLVFPLLEFLQERQ Y++ +IL+AKI LL+ TNMVDYAMDIHKSL
Sbjct  2    AEHDLTALLAAQMDRHLVFPLLEFLQERQFYSEPEILEAKIRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T+DVP++MV RR EVV+RL++LEEAAAPLV FLQN   VQELR DKQ+N+ +L DRYQ
Sbjct  62   HGTDDVPEDMVRRRTEVVSRLRSLEEAAAPLVTFLQNPQLVQELRPDKQYNIHMLQDRYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RS+SALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSVSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  182  VALEELNRLKEIIDSKNFSSPLN  204



>tpg|DAA39490.1| TPA: putative eukaryotic translation initiation factor 3E subunit 
family protein [Zea mays]
Length=369

 Score =   336 bits (861),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            +++DLT  +A QLDRHLVFPLLEFLQERQLY++ +IL+AKI LL+ TNMVDYAMDIHKSL
Sbjct  2    SEHDLTALMAAQLDRHLVFPLLEFLQERQLYSESEILEAKIRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP++MV RR EVV+RL++LEEAAAPLV FLQN   VQE R DKQ+N+ +L +RYQ
Sbjct  62   YGTDDVPEDMVKRRAEVVSRLRSLEEAAAPLVAFLQNPQLVQEFRPDKQYNIHMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R++SALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERNVSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  182  VALEELNRLKEIIDSKNFSSPLN  204



>ref|NP_001150632.1| eukaryotic translation initiation factor 3 subunit 6 [Zea mays]
 gb|ACG39836.1| eukaryotic translation initiation factor 3 subunit 6 [Zea mays]
Length=436

 Score =   337 bits (865),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            +++DLT  +A QLDRHLVFPLLEFLQERQLY++ +IL+AKI LL+ TNMVDYAMDIHKSL
Sbjct  2    SEHDLTALMAAQLDRHLVFPLLEFLQERQLYSESEILEAKIRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP++MV RR EVV+RL++LEEAAAPLV FLQN   VQE R DKQ+N+ +L +RYQ
Sbjct  62   YGTDDVPEDMVKRRAEVVSRLRSLEEAAAPLVAFLQNPQLVQEFRPDKQYNIHMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R++SALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERNVSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  182  VALEELNRLKEIIDSKNFSSPLN  204



>gb|ACN28978.1| unknown [Zea mays]
 tpg|DAA39489.1| TPA: putative eukaryotic translation initiation factor 3E subunit 
family protein [Zea mays]
Length=436

 Score =   337 bits (865),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            +++DLT  +A QLDRHLVFPLLEFLQERQLY++ +IL+AKI LL+ TNMVDYAMDIHKSL
Sbjct  2    SEHDLTALMAAQLDRHLVFPLLEFLQERQLYSESEILEAKIRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP++MV RR EVV+RL++LEEAAAPLV FLQN   VQE R DKQ+N+ +L +RYQ
Sbjct  62   YGTDDVPEDMVKRRAEVVSRLRSLEEAAAPLVAFLQNPQLVQEFRPDKQYNIHMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+R++SALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERNVSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  182  VALEELNRLKEIIDSKNFSSPLN  204



>ref|XP_006291150.1| hypothetical protein CARUB_v10017266mg [Capsella rubella]
 gb|EOA24048.1| hypothetical protein CARUB_v10017266mg [Capsella rubella]
Length=441

 Score =   337 bits (864),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
              YDLTP IAP LDRHLVFPLLEFLQE QLY DE ILK KIELLN TNMVDYAMDIHKSL
Sbjct  6    TNYDLTPLIAPNLDRHLVFPLLEFLQELQLYPDEQILKFKIELLNKTNMVDYAMDIHKSL  65

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTED PQ+MV+RR EVVARLK+LEEAAAPLV FL N +AVQELRADKQ+NLQ+L +RYQ
Sbjct  66   YHTEDAPQDMVERRAEVVARLKSLEEAAAPLVSFLLNPSAVQELRADKQYNLQMLKERYQ  125

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAADYLYQYR LC+N +RSLSALWGKLA+EILMQNWD
Sbjct  126  IGPDQIEALYQYAKFQFECGNYSGAADYLYQYRTLCSNLERSLSALWGKLASEILMQNWD  185

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            IALEELNRLKEIIDSKSF++PL+
Sbjct  186  IALEELNRLKEIIDSKSFASPLN  208



>gb|EPS73624.1| hypothetical protein M569_01130, partial [Genlisea aurea]
Length=438

 Score =   332 bits (851),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MA+ YDLT RIA  LDRH+VFPLL++LQER LY +EDILKAKIELLN TNMVDYA+D+HK
Sbjct  1    MASDYDLTQRIAAHLDRHMVFPLLQWLQERGLYPEEDILKAKIELLNATNMVDYAVDMHK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            +LYHTE+V QEMV+RR +VVAR+K LE+AA+P+ +FLQN NA QELR DKQ++LQLL+D+
Sbjct  61   ALYHTEEVSQEMVERRAQVVARMKQLEDAASPITKFLQNPNATQELRNDKQYSLQLLHDK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQIGPEQIEALY   KFQFECGNY+ AADYLYQYR  CTN ++SL+ALWGKLAAEILM++
Sbjct  121  YQIGPEQIEALYHCGKFQFECGNYTTAADYLYQYRTFCTNPEKSLTALWGKLAAEILMKH  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WDIALEELNRLKEIIDSKSFS+PL+
Sbjct  181  WDIALEELNRLKEIIDSKSFSSPLN  205



>ref|XP_003557378.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Brachypodium distachyon]
Length=440

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A Q+D HLVFPLLEFLQERQLYAD+ IL+AKI LL+ TNMVDYAMDIHKSL
Sbjct  2    AEHDLTARMAAQMDCHLVFPLLEFLQERQLYADDQILEAKIRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T+DVP +MV RR EVVARL+ L+EAAAPLV FL N   VQELR DKQ+N+ +L +RYQ
Sbjct  62   HGTDDVPADMVARRSEVVARLRTLDEAAAPLVGFLSNPQLVQELRPDKQYNIHMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYSGAAD+LYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSGAADFLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +A EELNRLKE+IDSK+FS+P++
Sbjct  182  VAQEELNRLKELIDSKNFSSPIN  204



>ref|NP_001131771.1| uncharacterized protein LOC100193141 [Zea mays]
 gb|ACF80330.1| unknown [Zea mays]
 tpg|DAA60023.1| TPA: putative eukaryotic translation initiation factor 3E subunit 
family protein [Zea mays]
Length=436

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A +DLT  +A QLDRHLVFPLLEFLQERQLY+  +IL+AKI LL+ TNMVDYAMDIHKSL
Sbjct  2    ADHDLTALMAAQLDRHLVFPLLEFLQERQLYSRPEILEAKIRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T+DVP++MV RR EVV+RL++L+EAAAPLV FLQN   VQELR DKQ+N+ +L +RYQ
Sbjct  62   HGTDDVPEDMVKRRSEVVSRLRSLDEAAAPLVAFLQNPQLVQELRPDKQYNIHMLQERYQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQFECGNYS AA+YLYQYRALCT+++RS+SALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQFECGNYSWAAEYLYQYRALCTDTERSVSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEE NRLKEIIDSK+FS+PL+
Sbjct  182  VALEEFNRLKEIIDSKNFSSPLN  204



>ref|XP_006657560.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Oryza brachyantha]
Length=439

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A  +D HLVFPLLEFLQER+LYA+++IL AK+ LL  TNMVDYAMDIHKSL
Sbjct  2    ARHDLTARMAGHMDCHLVFPLLEFLQERELYANKEILDAKLRLLRGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T+DVP +MV RR EVV+RL+AL+EA AP+V FLQN   VQELR DKQ+NL +L +R+Q
Sbjct  62   HDTDDVPDDMVRRRTEVVSRLRALDEATAPIVSFLQNPQLVQELRPDKQYNLHMLQERFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIE LYQYAKFQF+CGNYS AA YLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIETLYQYAKFQFDCGNYSDAAVYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  182  VALEELNRLKEIIDSKNFSSPLN  204



>gb|ABK34475.1| eukaryotic initiation factor 3e [Oryza sativa Indica Group]
 gb|EEC81741.1| hypothetical protein OsI_25391 [Oryza sativa Indica Group]
Length=439

 Score =   322 bits (825),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A Q+D HLVFPLLEFLQER LYA+++IL+AK+ LL+ TNMVDYAMDIHKSL
Sbjct  2    AEHDLTARMAGQMDCHLVFPLLEFLQERALYANKEILEAKLRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T++VP +MV RR +VV+RL+AL+EA AP+V FLQN   VQELR DKQ+NL +L DR+Q
Sbjct  62   HDTDEVPDDMVRRRTDVVSRLRALDEATAPIVSFLQNQQLVQELRPDKQYNLHMLQDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIE LYQYAKFQF+CGNYS AA YLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIETLYQYAKFQFDCGNYSDAAVYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +AL+ELNRLKEIIDSK+FS+PL+
Sbjct  182  VALDELNRLKEIIDSKNFSSPLN  204



>ref|NP_001059202.1| Os07g0222300 [Oryza sativa Japonica Group]
 dbj|BAC45186.1| putative eIF3e (subunits of eukaryotic translation initiation 
factor 3) [Oryza sativa Japonica Group]
 dbj|BAF21116.1| Os07g0222300 [Oryza sativa Japonica Group]
 gb|EEE66816.1| hypothetical protein OsJ_23573 [Oryza sativa Japonica Group]
Length=439

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A Q+D HLVFPLLEFLQER LYA+++IL+AK+ LL+ TNMVDYAMDIHKSL
Sbjct  2    AEHDLTARMAGQMDCHLVFPLLEFLQERALYANKEILEAKLRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T++VP +MV RR +VV+RL+AL+EA AP+V FLQN   VQELR DKQ+NL +L DR+Q
Sbjct  62   HDTDEVPDDMVRRRTDVVSRLRALDEATAPIVSFLQNQQLVQELRPDKQYNLHMLQDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQIE LYQ+AKFQF+CGNYS AA YLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPEQIETLYQFAKFQFDCGNYSDAAVYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +AL+ELNRLKEIIDSK+FS+PL+
Sbjct  182  VALDELNRLKEIIDSKNFSSPLN  204



>gb|ABK34467.1| eukaryotic initiation factor 3e [Oryza sativa Japonica Group]
Length=439

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A Q+D HLVFPLLEFLQER LYA+++IL+AK+ LL+ TNMVDYAMDIHKSL
Sbjct  2    AEHDLTARMAGQMDCHLVFPLLEFLQERALYANKEILEAKLRLLSGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T++VP +MV RR +VV+RL+AL+EA AP+V FLQN   VQELR DKQ+NL +L DR+Q
Sbjct  62   HDTDEVPDDMVRRRTDVVSRLRALDEATAPIVSFLQNQQLVQELRPDKQYNLHMLQDRFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IG EQIE LYQYAKFQF+CGNYS AA YLYQYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGTEQIETLYQYAKFQFDCGNYSDAAVYLYQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +AL+ELNRLKEIIDSK+FS+PL+
Sbjct  182  VALDELNRLKEIIDSKNFSSPLN  204



>gb|EMT06719.1| hypothetical protein F775_27177 [Aegilops tauschii]
Length=557

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 170/200 (85%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT  +A  +D HLV P+LEFLQER +YADE+IL+ KI LL  TNMVDYAMDIHKSL
Sbjct  2    AEHDLTASVAAWMDPHLVLPVLEFLQERGVYADEEILRGKIRLLAGTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            + T+DVP +MV RR EVV RL+AL+EA AP+V FL +   VQEL ADKQ+NL +L +R+Q
Sbjct  62   HGTDDVPADMVARRSEVVERLRALQEAVAPIVAFLSSPQLVQELHADKQYNLHMLQERHQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIEALYQYAKFQ+ECG YS AAD+L QYRALCTNS+RSLSALWGKLAAEILMQNWD
Sbjct  122  IGPDQIEALYQYAKFQYECGMYSDAADFLSQYRALCTNSERSLSALWGKLAAEILMQNWD  181

Query  602  IALEELNRLKEIIDSKSFST  661
            +A EELNRLKE+IDS SF++
Sbjct  182  VAQEELNRLKEMIDSSSFTS  201



>gb|EMS48036.1| Eukaryotic translation initiation factor 3 subunit E [Triticum 
urartu]
Length=428

 Score =   289 bits (740),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +2

Query  98   LDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYHTEDVPQEMVD  277
            +D HLV P+LEFLQER +YADE+IL+ KI LL  TNMVDYAMDIHKSL+ T+DVP +MV 
Sbjct  1    MDPHLVLPVLEFLQERGVYADEEILRGKIRLLGGTNMVDYAMDIHKSLHGTDDVPADMVA  60

Query  278  RRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQIEALYQY  457
            RR EVV RL+AL+EA AP+V FL +   VQEL ADKQ+NL +L +R+QIGP+QIEALYQY
Sbjct  61   RRSEVVERLRALQEAVAPIVAFLSSPQLVQELHADKQYNLHMLQERHQIGPDQIEALYQY  120

Query  458  AKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEELNRLKEI  637
            AKFQ+ECG YS AAD+L QYRALCTNS+RSLSALWGKLAAEILMQNWD+A EELNRLKE+
Sbjct  121  AKFQYECGMYSDAADFLSQYRALCTNSERSLSALWGKLAAEILMQNWDVAQEELNRLKEM  180

Query  638  IDSKSF-STPLH  670
            IDS SF S+P++
Sbjct  181  IDSSSFTSSPVN  192



>gb|KHN41695.1| Eukaryotic translation initiation factor 3 subunit E [Glycine 
soja]
Length=448

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 166/214 (78%), Gaps = 11/214 (5%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLTPR+AP LDRHLVFPLLEFLQERQLY D  ILKAKI+LLN+TNMVDYAMDIHKSL
Sbjct  2    AEYDLTPRMAPNLDRHLVFPLLEFLQERQLYDDNHILKAKIDLLNNTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQ--------NANAVQELRADKQHNL  397
            YHTE+VP +MVDRR EVVA         +      +         +     +    Q  L
Sbjct  62   YHTEEVPHDMVDRRAEVVASRSRRPPPPSSPSSRTRLLCRSSERTSTTFGLMFGLLQLVL  121

Query  398  QLLNDRY---QIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGK  568
             L+N  +   QIGP QIEALYQY+KFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGK
Sbjct  122  FLVNSFWGLPQIGPAQIEALYQYSKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGK  181

Query  569  LAAEILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            LAAEILMQNWDIALEELNRLKEIIDSK+F++PL+
Sbjct  182  LAAEILMQNWDIALEELNRLKEIIDSKNFASPLN  215



>ref|XP_002992749.1| hypothetical protein SELMODRAFT_269977 [Selaginella moellendorffii]
 ref|XP_002993572.1| hypothetical protein SELMODRAFT_272327 [Selaginella moellendorffii]
 gb|EFJ05347.1| hypothetical protein SELMODRAFT_272327 [Selaginella moellendorffii]
 gb|EFJ06230.1| hypothetical protein SELMODRAFT_269977 [Selaginella moellendorffii]
Length=434

 Score =   286 bits (732),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++D T +IAP LDRHLVFPLLEFLQ++ +Y ++ ILKAKIELL  TNMVDY MDIH+SL
Sbjct  2    AQFDQTLKIAPFLDRHLVFPLLEFLQDKGIYPNDQILKAKIELLAKTNMVDYMMDIHRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y  ++VP+EM+DRR EVV RLKALE+ AAPL+ FLQN     EL+ ++Q NLQ+L+DRYQ
Sbjct  62   Y--DEVPKEMMDRRAEVVNRLKALEDLAAPLIAFLQNPQMTAELKPERQANLQMLHDRYQ  119

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPE I+ALYQYAKFQFECGNYSGAAD+LYQYR L  NS+++ SA+WGK AAEILMQNW 
Sbjct  120  IGPEHIDALYQYAKFQFECGNYSGAADFLYQYRTLTINSEKAYSAMWGKFAAEILMQNWS  179

Query  602  IALEELNRLKEIIDSKSFSTPL  667
             A  EL +LKE +DSK+FS+PL
Sbjct  180  GAEYELGKLKEAMDSKNFSSPL  201



>emb|CBI33382.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  MDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQ  400
            MDIHKSLYHTEDVPQ+MV+RR EVVARLKALEEAAAPLV FLQN NAVQELRADKQ+NLQ
Sbjct  1    MDIHKSLYHTEDVPQDMVERRAEVVARLKALEEAAAPLVSFLQNPNAVQELRADKQYNLQ  60

Query  401  LLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAE  580
            +LNDRYQIG EQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGKLAAE
Sbjct  61   MLNDRYQIGQEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKLAAE  120

Query  581  ILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            ILMQNWD A EELNRLKEIIDSKS+++PL+
Sbjct  121  ILMQNWDTAFEELNRLKEIIDSKSYASPLN  150



>emb|CDP21587.1| unnamed protein product, partial [Coffea canephora]
Length=370

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  MDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQ  400
            MDIH++ YH EDVPQ+MVDRR EVVARLKALEE A+PLV FLQN NA QELRA+KQ+NLQ
Sbjct  1    MDIHRAFYHAEDVPQDMVDRRAEVVARLKALEEGASPLVNFLQNENAYQELRAEKQYNLQ  60

Query  401  LLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAE  580
            +LN+RYQIGPEQIEALYQYAKFQFECGNYSGAADYLY YR LCTNS+RSLSALWGKLAAE
Sbjct  61   MLNERYQIGPEQIEALYQYAKFQFECGNYSGAADYLYLYRTLCTNSERSLSALWGKLAAE  120

Query  581  ILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            ILMQNWDIALEELNR+KEIIDSKSFS+PL+
Sbjct  121  ILMQNWDIALEELNRVKEIIDSKSFSSPLN  150



>emb|CDP14171.1| unnamed protein product [Coffea canephora]
 emb|CDP14172.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  221  MDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQ  400
            MDIH++ YH EDVPQ+MVDRR EVVARLKALEE A+PLV FLQN NA QELRA+KQ+NLQ
Sbjct  1    MDIHRAFYHAEDVPQDMVDRRAEVVARLKALEEGASPLVNFLQNENAYQELRAEKQYNLQ  60

Query  401  LLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAE  580
            +LN+RYQIGPEQIEALYQYAKFQFECGNYSGAADYLY YR LCTNS+RSLSALWGKLAAE
Sbjct  61   MLNERYQIGPEQIEALYQYAKFQFECGNYSGAADYLYLYRTLCTNSERSLSALWGKLAAE  120

Query  581  ILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            ILMQNWDIALEELNR+KEIIDSKSFS+PL+
Sbjct  121  ILMQNWDIALEELNRVKEIIDSKSFSSPLN  150



>ref|XP_004955815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Setaria italica]
Length=437

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 164/206 (80%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A +DLT R+AP LDRHLVFPLLE LQER LY +E+IL AK++LL  TNMVDYAM IH+SL
Sbjct  2    AAHDLTARLAPHLDRHLVFPLLESLQERGLYPEEEILAAKLDLLGGTNMVDYAMAIHRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEA---AAPLVQFLQNANAVQELRADKQHNLQLLND  412
            + T++VP  MV RR EVV RL AL++    A PL  FL++   VQ LR DK++N+ +L +
Sbjct  62   HGTDEVPGGMVARRAEVVDRLVALQQTGPPALPLYAFLRDPQLVQLLRPDKEYNVHMLQE  121

Query  413  RYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQ  592
            R+QIGP+QIEALY  AKF FECG+YS AA YLYQYR L TNS+RS+ ALWG LA+EIL +
Sbjct  122  RFQIGPDQIEALYDDAKFLFECGSYSDAAAYLYQYRVLSTNSERSVRALWGMLASEILNR  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD ALEELNRLKEIIDSK+FS+PL+
Sbjct  182  NWDAALEELNRLKEIIDSKNFSSPLN  207



>dbj|BAD30375.1| putative eIF3e [Oryza sativa Japonica Group]
 gb|EAZ02898.1| hypothetical protein OsI_25031 [Oryza sativa Indica Group]
 gb|EAZ38814.1| hypothetical protein OsJ_23219 [Oryza sativa Japonica Group]
Length=415

 Score =   262 bits (669),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 154/203 (76%), Gaps = 24/203 (12%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A  LD HLV PLLEFLQER LY +E+IL+AKI LL  TNMVDYAMDIHKS 
Sbjct  2    AEHDLTARMAGHLDCHLVLPLLEFLQERHLYPEEEILEAKIRLLRGTNMVDYAMDIHKSR  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP++MV RR EVV+RL +L EA                   D  H  Q      Q
Sbjct  62   YGTDDVPEDMVKRRAEVVSRLTSLGEAI------------------DNIHQNQ------Q  97

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIE LYQYAKFQF+CGNYS AA YL+QYRALCTN +RSLSALWGKLAAEILMQNWD
Sbjct  98   IGPDQIETLYQYAKFQFDCGNYSFAAQYLHQYRALCTNIERSLSALWGKLAAEILMQNWD  157

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  158  VALEELNRLKEIIDSKNFSSPLN  180



>gb|KJB67152.1| hypothetical protein B456_010G177900 [Gossypium raimondii]
Length=183

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  269  MVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQIEAL  448
            MVDRRVEVVARLKALE+AAAPLV FLQNANA+QELRADKQ+NL +LNDRY+IGP+QIEAL
Sbjct  1    MVDRRVEVVARLKALEDAAAPLVTFLQNANAIQELRADKQYNLHMLNDRYEIGPDQIEAL  60

Query  449  YQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEELNRL  628
            YQYAKFQFECGNYS AADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWDIALEELNRL
Sbjct  61   YQYAKFQFECGNYSCAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWDIALEELNRL  120

Query  629  KEIIDSKSFSTPLH  670
            KEIIDSK FS+PL+
Sbjct  121  KEIIDSKRFSSPLN  134



>gb|KJB67153.1| hypothetical protein B456_010G177900 [Gossypium raimondii]
Length=197

 Score =   253 bits (645),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +2

Query  269  MVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQIEAL  448
            MVDRRVEVVARLKALE+AAAPLV FLQNANA+QELRADKQ+NL +LNDRY+IGP+QIEAL
Sbjct  1    MVDRRVEVVARLKALEDAAAPLVTFLQNANAIQELRADKQYNLHMLNDRYEIGPDQIEAL  60

Query  449  YQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEELNRL  628
            YQYAKFQFECGNYS AADYLYQYRALCTNS+RSLSALWGKLAAEILMQNWDIALEELNRL
Sbjct  61   YQYAKFQFECGNYSCAADYLYQYRALCTNSERSLSALWGKLAAEILMQNWDIALEELNRL  120

Query  629  KEIIDSKSFSTPLH  670
            KEIIDSK FS+PL+
Sbjct  121  KEIIDSKRFSSPLN  134



>ref|XP_011015724.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X2 [Populus euphratica]
Length=380

 Score =   258 bits (660),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = +2

Query  257  VPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQ  436
            V  +M++RRVEVVARLKALEEAA PLV FLQNA+AVQELRADKQ+NLQ+L+DRYQIGPEQ
Sbjct  10   VALDMIERRVEVVARLKALEEAATPLVAFLQNASAVQELRADKQYNLQMLHDRYQIGPEQ  69

Query  437  IEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEE  616
            IEALYQYAKFQFECGNYSGAADYLYQYRALCTNS+RSLSALWGK+AAE+LMQNWDIALEE
Sbjct  70   IEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERSLSALWGKMAAEVLMQNWDIALEE  129

Query  617  LNRLKEIIDSKSFSTPLH  670
            LNRLKEIIDSKSFSTPL+
Sbjct  130  LNRLKEIIDSKSFSTPLN  147



>ref|XP_005651050.1| eukaryotic translation initiation factor 3, subunit 6 [Coccomyxa 
subellipsoidea C-169]
 gb|EIE26506.1| eukaryotic translation initiation factor 3, subunit 6 [Coccomyxa 
subellipsoidea C-169]
Length=422

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/203 (60%), Positives = 157/203 (77%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A +DLT  +   LDRHL FPLLEFL  ++LY++ DI KAKI+LL  TNMVDYA +I+ +L
Sbjct  2    ADHDLTQELCKNLDRHLAFPLLEFLSNKELYSETDIQKAKIDLLQKTNMVDYAAEIYTAL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP+EM  RR EVVA+LK L+  A  +V FL + + V++L+ DK +NL  L + +Q
Sbjct  62   YKTDDVPEEMNSRRKEVVAKLKTLQAQAESIVSFLSSEDKVKQLKQDKAYNLAFLQEEFQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QI+ALY +AKFQFECGNYSGAA++LY YR L TNS+R LSALWGKLAAEILMQ W+
Sbjct  122  IGPQQIDALYNFAKFQFECGNYSGAAEFLYHYRTLATNSERVLSALWGKLAAEILMQQWE  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             AL++L +LKEIID+ +F+  L 
Sbjct  182  TALDDLTKLKEIIDANTFAPILQ  204



>ref|XP_004349023.1| eukaryotic translation initiation factor 3 subunit E [Capsaspora 
owczarzaki ATCC 30864]
Length=432

 Score =   253 bits (645),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 155/202 (77%), Gaps = 0/202 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDL+  +   LDRHLV PLL+FLQ R +YADE+I + K++L++ TNMVD+A+DI+K++
Sbjct  2    AAYDLSTVLGQHLDRHLVLPLLDFLQTRGIYADEEIARGKLDLISSTNMVDFAIDIYKTI  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
              TE+ P ++V++R   VARLK L  +A P++   QN   +++LR DKQHNLQ L   +Q
Sbjct  62   QQTEEAPADLVEKRESTVARLKVLHNSAEPVLNLFQNEEVIKQLRQDKQHNLQYLQQHHQ  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
              PE ++ LY+YAKFQF+CGNY+GAADYLY +  L T+++R+ SALWGKLA EIL+ NW+
Sbjct  122  FQPEMLDTLYEYAKFQFDCGNYTGAADYLYHFNLLSTDTERTFSALWGKLACEILLHNWE  181

Query  602  IALEELNRLKEIIDSKSFSTPL  667
             ALEE+ RLKEIIDS++F+TPL
Sbjct  182  TALEEMTRLKEIIDSRTFATPL  203



>gb|KIY98828.1| putative Eukaryotic translation initiation factor 3 subunit E 
[Monoraphidium neglectum]
Length=425

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 155/203 (76%), Gaps = 0/203 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+++L+  ++  LDRHL+FPLLEFLQ++ +YA++D+LKAKI LL  TNMVD+AMDIHK L
Sbjct  2    AQHELSRTLSKYLDRHLIFPLLEFLQDKGIYAEDDLLKAKIALLQKTNMVDFAMDIHKDL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y TEDVP EM +RR EVV RL+ L++A  P++  L N N ++  R D+  NLQ L + + 
Sbjct  62   YQTEDVPPEMTERRSEVVGRLRHLQKAVDPIIACLSNQNVIRNFRQDRSFNLQFLKEEFD  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQ++ALYQYAKFQF+CGNYS A++ L  YR L T S+R++S LWGKLAA+ILM ++D
Sbjct  122  IGPEQVDALYQYAKFQFDCGNYSSASELLQAYRPLVTTSERNMSVLWGKLAADILMVDYD  181

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
             A E++ RL+E ID+  F TPL 
Sbjct  182  AATEDIARLREAIDNAPFLTPLQ  204



>ref|XP_002503313.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64571.1| predicted protein [Micromonas sp. RCC299]
Length=428

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 157/207 (76%), Gaps = 0/207 (0%)
 Frame = +2

Query  47   SASMAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMD  226
            +AS A+K+DLT  +   LDRHLVFPLLEFLQ +++Y + +IL+AKI LL  TNM+D+A D
Sbjct  2    AASDASKHDLTSELGKFLDRHLVFPLLEFLQAKKVYPEAEILEAKIALLQKTNMLDFAAD  61

Query  227  IHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLL  406
            I+KSL++ +DVP EM  RR EV+A L  L+  A  +V FL +   V++LR+DK +N+  L
Sbjct  62   IYKSLHNAKDVPPEMTKRREEVIANLTELQAKAEKVVTFLSDPTLVKQLRSDKAYNINFL  121

Query  407  NDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEIL  586
             + + IG E I+AL+ YAKFQFECGNY+ AA++LY YR+LCTN ++  SALWGK A++IL
Sbjct  122  KENHGIGEEDIDALFHYAKFQFECGNYAAAAEFLYHYRSLCTNGEKGGSALWGKFASDIL  181

Query  587  MQNWDIALEELNRLKEIIDSKSFSTPL  667
             Q+W+ A+E++NRLK+ ++++ + +PL
Sbjct  182  QQDWNAAVEDMNRLKDAVENRQYPSPL  208



>ref|XP_003058422.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56877.1| predicted protein [Micromonas pusilla CCMP1545]
Length=431

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 148/203 (73%), Gaps = 0/203 (0%)
 Frame = +2

Query  59   AAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKS  238
            A  +DLT  +   LDRHLVFPLLEFLQ +++Y + ++L+AKI LLN TNM+D+A DI+KS
Sbjct  6    AKTHDLTSELGKYLDRHLVFPLLEFLQAKRVYPENEVLEAKIALLNKTNMLDFAADIYKS  65

Query  239  LYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRY  418
            L++  DVP  M  RR EV+A L  L   A  +V FL +   V++LR+DK  NL  L + +
Sbjct  66   LHNKSDVPAAMQQRREEVIANLTELSVKAEKVVNFLSDPTLVKQLRSDKAFNLAFLQESH  125

Query  419  QIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNW  598
             +GPE I+AL+ YAKFQFECGNY  A ++L  YR LCTNS+R  SALWGK A++IL+Q W
Sbjct  126  GVGPEDIDALFHYAKFQFECGNYQAAGEFLSHYRGLCTNSERGASALWGKFASDILLQQW  185

Query  599  DIALEELNRLKEIIDSKSFSTPL  667
            D A+E+L RLK+ ++++++S+PL
Sbjct  186  DAAVEDLTRLKDAVENRAYSSPL  208



>dbj|BAD30374.1| putative eIF3e [Oryza sativa Japonica Group]
Length=397

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 140/203 (69%), Gaps = 42/203 (21%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A  LD HLV PLLEFLQER LY +E+IL+AKI LL  TNMVDYAMDIHKS 
Sbjct  2    AEHDLTARMAGHLDCHLVLPLLEFLQERHLYPEEEILEAKIRLLRGTNMVDYAMDIHKSR  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP+ +                                    D  H  Q      Q
Sbjct  62   YGTDDVPEAI------------------------------------DNIHQNQ------Q  79

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIE LYQYAKFQF+CGNYS AA YL+QYRALCTN +RSLSALWGKLAAEILMQNWD
Sbjct  80   IGPDQIETLYQYAKFQFDCGNYSFAAQYLHQYRALCTNIERSLSALWGKLAAEILMQNWD  139

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  140  VALEELNRLKEIIDSKNFSSPLN  162



>ref|NP_001058974.2| Os07g0167000 [Oryza sativa Japonica Group]
 dbj|BAF20888.2| Os07g0167000, partial [Oryza sativa Japonica Group]
Length=404

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 140/203 (69%), Gaps = 42/203 (21%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+A  LD HLV PLLEFLQER LY +E+IL+AKI LL  TNMVDYAMDIHKS 
Sbjct  9    AEHDLTARMAGHLDCHLVLPLLEFLQERHLYPEEEILEAKIRLLRGTNMVDYAMDIHKSR  68

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y T+DVP+ +                                    D  H  Q      Q
Sbjct  69   YGTDDVPEAI------------------------------------DNIHQNQ------Q  86

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGP+QIE LYQYAKFQF+CGNYS AA YL+QYRALCTN +RSLSALWGKLAAEILMQNWD
Sbjct  87   IGPDQIETLYQYAKFQFDCGNYSFAAQYLHQYRALCTNIERSLSALWGKLAAEILMQNWD  146

Query  602  IALEELNRLKEIIDSKSFSTPLH  670
            +ALEELNRLKEIIDSK+FS+PL+
Sbjct  147  VALEELNRLKEIIDSKNFSSPLN  169



>ref|XP_001702351.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDO96971.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=428

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = +2

Query  59   AAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKS  238
            A  Y+L+ ++   LD HL  P++E+LQER LY ++DIL+AK+ LL+ TNMVD+AMDI+K 
Sbjct  3    ATNYELSSKLVQYLDLHLTLPIMEYLQERGLYNEDDILRAKLALLDKTNMVDFAMDIYKG  62

Query  239  LYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRY  418
            L   ++VP EM DRR +VVARL+ L+    P+++ LQN + V++ R DK  NLQ L + +
Sbjct  63   LNGVDEVPAEMKDRRSQVVARLRQLQADVDPIIKCLQNRHVVEKFRQDKSFNLQFLQEEF  122

Query  419  QIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQ--  592
            QIG E +EALYQYA+FQF CGNYS AA+ L  YR LCTNS+R++SALWGKLAAEILM   
Sbjct  123  QIGAEHVEALYQYARFQFNCGNYSLAAELLQSYRTLCTNSERNISALWGKLAAEILMHEA  182

Query  593  -NWDIALEELNRLKEIIDSKSFSTPL  667
             N   A E++ +LKE+ID+++F+ PL
Sbjct  183  VNIQEAREDVFKLKEVIDNQTFAPPL  208



>tpg|DAA54572.1| TPA: putative eukaryotic translation initiation factor 3E subunit 
family protein [Zea mays]
Length=377

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 134/198 (68%), Gaps = 50/198 (25%)
 Frame = +2

Query  77   TPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYHTED  256
            T +   QLDRHLVFPLLEFLQERQ Y++ +IL+AKI LLN TNMVDYAMDIHKSLY T+D
Sbjct  126  TGKGKAQLDRHLVFPLLEFLQERQFYSESEILEAKIRLLNGTNMVDYAMDIHKSLYDTDD  185

Query  257  VPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQ  436
            V ++M                                                  I P+Q
Sbjct  186  VLEDM--------------------------------------------------IVPDQ  195

Query  437  IEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEE  616
            IE +YQYAKFQFECGNYSGA DYLYQYRALCTNS+R++SALWGKLAAEILMQNWD+ALEE
Sbjct  196  IEVVYQYAKFQFECGNYSGAVDYLYQYRALCTNSERNVSALWGKLAAEILMQNWDVALEE  255

Query  617  LNRLKEIIDSKSFSTPLH  670
            LN LKEIIDSK+FS+PL+
Sbjct  256  LNCLKEIIDSKNFSSPLN  273



>gb|KDD74800.1| eIF3 subunit 6 N terminal domain-containing protein [Helicosporidium 
sp. ATCC 50920]
Length=437

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 4/211 (2%)
 Frame = +2

Query  38   NLQSASMAA----KYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTN  205
            N+ S S AA    +YDLT  +A  LDRHLVFPLLEFL +++LY+  +I  AK+EL++ T+
Sbjct  5    NMASPSGAAVDPTQYDLTFVMAKSLDRHLVFPLLEFLSQKELYSHREIETAKLELISRTH  64

Query  206  MVDYAMDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADK  385
            MVDYA+DI +S+  TE+VP  +V RR EVV+RLK LE    P+  FL   N V+ L+ DK
Sbjct  65   MVDYAVDIWQSVNQTEEVPASLVTRRAEVVSRLKTLEAQVKPITDFLSAENNVKLLKQDK  124

Query  386  QHNLQLLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWG  565
              N   L   + IGPEQI+ALY +AK+ FECGNY+ AA+YLY YR L TN++R  SALWG
Sbjct  125  TQNQAFLAREFGIGPEQIDALYHFAKWNFECGNYTAAAEYLYHYRMLSTNAERGASALWG  184

Query  566  KLAAEILMQNWDIALEELNRLKEIIDSKSFS  658
            KLAA +L+Q+++ A+E+L +LKE+ID  +F+
Sbjct  185  KLAAGVLLQDFESAMEDLLKLKELIDLDTFA  215



>ref|XP_004170682.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like, partial [Cucumis sativus]
Length=121

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLTPRIAP LDRHLVFPLLEFLQERQLY DE ILKAKIELLN TNMVDYAMDIHKSL
Sbjct  2    ADYDLTPRIAPNLDRHLVFPLLEFLQERQLYPDEQILKAKIELLNKTNMVDYAMDIHKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            YHTEDVPQ+MVDRR EVVARLKALEE+AAPLV FLQN  AVQELRADKQ+NLQ+LNDRYQ
Sbjct  62   YHTEDVPQDMVDRRAEVVARLKALEESAAPLVAFLQNPAAVQELRADKQYNLQMLNDRYQ  121



>emb|CEG79386.1| Putative Eukaryotic translation initiation factor 3 subunit E 
[Rhizopus microsporus]
Length=327

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA +DLT ++ P LDRHLVFPL+EFL+ +++Y  ED+LKAK +L  ++NMVD+ +D++K
Sbjct  1    MAATHDLTMKMIPFLDRHLVFPLIEFLELKEVYVAEDLLKAKYDLFKNSNMVDFVVDLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L  TE+ P+E  ++R  V+AR++ L   A  +++ LQ    +  LR DK  ++Q L D 
Sbjct  61   KLNKTEETPKEFAEKRESVLARMEDLRTKAQKVMEVLQKPEVIAVLRQDKAESIQYLKDN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQ   + I  LY++ +FQ+ CG+Y GAADYLY YR L ++ +RSLSA WGK+AAEIL  N
Sbjct  121  YQFTDDSINILYEFGQFQYNCGDYGGAADYLYHYRVLSSDPERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E ID KSF +PL 
Sbjct  181  WDGALEEIQKLREAIDQKSFVSPLQ  205



>ref|XP_007124479.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Physeter catodon]
Length=241

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>emb|CDY70248.1| BnaAnng33080D [Brassica napus]
Length=296

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 128/182 (70%), Gaps = 41/182 (23%)
 Frame = +2

Query  104  RHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYHTEDVPQEMVDRR  283
            RHLVFP+LEFLQE QLY DE ILK KIELLN TNMVDYAMDIHKSL+HTED PQ+M    
Sbjct  5    RHLVFPILEFLQEHQLYPDEQILKFKIELLNKTNMVDYAMDIHKSLHHTEDAPQDM----  60

Query  284  VEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQIEALYQYAK  463
                      EEAAA LV FL N NAVQELR DK++NLQ+L +RYQIGP+QIEAL QYAK
Sbjct  61   ----------EEAAALLVTFLLNPNAVQELRGDKKYNLQMLKERYQIGPDQIEALNQYAK  110

Query  464  FQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEELNRLKEIID  643
            FQFECGNYS                           A+EILMQNWDIALEELNRLK+IID
Sbjct  111  FQFECGNYS---------------------------ASEILMQNWDIALEELNRLKDIID  143

Query  644  SK  649
            SK
Sbjct  144  SK  145



>emb|CEJ01650.1| Putative Eukaryotic translation initiation factor 3 subunit E 
[Rhizopus microsporus]
Length=433

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA +DLT ++ P LDRHLVFPL+EFL+ +++Y  ED+LKAK +L  ++NMVD+ +D++K
Sbjct  1    MAATHDLTMKMIPFLDRHLVFPLIEFLELKEVYVAEDLLKAKYDLFKNSNMVDFVVDLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L  TE+ P+E  ++R  V+AR++ L   A  +++ LQ    +  LR DK  ++Q L D 
Sbjct  61   KLNKTEETPKEFAEKRESVLARMEDLRTKAQKVMEVLQKPEVIAVLRQDKAESIQYLKDN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQ   + I  LY++ +FQ+ CG+Y GAADYLY YR L ++ +RSLSA WGK+AAEIL  N
Sbjct  121  YQFTDDSINILYEFGQFQYNCGDYGGAADYLYHYRVLSSDPERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E ID KSF +PL 
Sbjct  181  WDGALEEIQKLREAIDQKSFVSPLQ  205



>emb|CEG66950.1| Putative Eukaryotic translation initiation factor 3 subunit E 
[Rhizopus microsporus]
Length=349

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA +DLT ++ P LDRHLVFPL+EFL+ +++Y  E++LKAK +L  ++NMVD+ +D++K
Sbjct  1    MAATHDLTMKMIPFLDRHLVFPLIEFLELKEVYVAENLLKAKYDLFKNSNMVDFVVDLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L  TE+ P+E  ++R  V+AR++ L   A  +++ LQ    +  LR DK  ++Q L D 
Sbjct  61   KLNKTEETPKEFAEKRESVLARMEDLRTKAQKVMEVLQKPEVIAVLRQDKAESIQYLKDN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQ   + I  LY++ +FQ+ CG+Y GAADYLY YR L ++ +RSLSA WGK+AAEIL  N
Sbjct  121  YQFTDDSINILYEFGQFQYNCGDYGGAADYLYHYRVLSSDPERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E ID KSF +PL 
Sbjct  181  WDGALEEIQKLREAIDQKSFVSPLQ  205



>gb|KJE91084.1| eukaryotic translation initiation factor 3 subunit E [Capsaspora 
owczarzaki ATCC 30864]
Length=448

 Score =   221 bits (563),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = +2

Query  134  LQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYHTEDVPQEMVDRRVEVVARLKAL  313
            L   Q+YADE+I + K++L++ TNMVD+A+DI+K++  TE+ P ++V++R   VARLK L
Sbjct  42   LNHCQIYADEEIARGKLDLISSTNMVDFAIDIYKTIQQTEEAPADLVEKRESTVARLKVL  101

Query  314  EEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQIEALYQYAKFQFECGNYSG  493
              +A P++   QN   +++LR DKQHNLQ L   +Q  PE ++ LY+YAKFQF+CGNY+G
Sbjct  102  HNSAEPVLNLFQNEEVIKQLRQDKQHNLQYLQQHHQFQPEMLDTLYEYAKFQFDCGNYTG  161

Query  494  AADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDIALEELNRLKEIIDSKSFSTPL  667
            AADYLY +  L T+++R+ SALWGKLA EIL+ NW+ ALEE+ RLKEIIDS++F+TPL
Sbjct  162  AADYLYHFNLLSTDTERTFSALWGKLACEILLHNWETALEEMTRLKEIIDSRTFATPL  219



>gb|EPB84383.1| translation initiation factor 3 subunit E [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=434

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 147/205 (72%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA  DLT R+ P LDRHLVFPL+EFL+ +++YA E++L+AK +L   +NMVD+ +D++K
Sbjct  1    MAASQDLTMRMIPFLDRHLVFPLIEFLELKEVYAPEELLQAKYDLFKGSNMVDFVLDLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L+ TE+ P+E  ++R  V+++++ L   A  ++  L+    +  LR DK  NLQ L + 
Sbjct  61   KLHKTEEAPKEFTEKRENVLSKMEDLRTKAQKVMDVLEKPEVIAALRQDKAQNLQYLKEN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            Y+   + I  LY++ +FQ+ CG+Y GAADYLY +R L T+++RSLSA WGK+AAEIL  N
Sbjct  121  YKFTDDSINILYEFGQFQYNCGDYGGAADYLYHFRVLSTDAERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E IDSK+F++PL 
Sbjct  181  WDAALEEMQKLREAIDSKNFTSPLQ  205



>emb|CEG66948.1| Putative Eukaryotic translation initiation factor 3 subunit E 
[Rhizopus microsporus]
 emb|CEI94325.1| Putative Eukaryotic translation initiation factor 3 subunit E 
[Rhizopus microsporus]
Length=433

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA +DLT ++ P LDRHLVFPL+EFL+ +++Y  E++LKAK +L  ++NMVD+ +D++K
Sbjct  1    MAATHDLTMKMIPFLDRHLVFPLIEFLELKEVYVAENLLKAKYDLFKNSNMVDFVVDLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L  TE+ P+E  ++R  V+AR++ L   A  +++ LQ    +  LR DK  ++Q L D 
Sbjct  61   KLNKTEETPKEFAEKRESVLARMEDLRTKAQKVMEVLQKPEVIAVLRQDKAESIQYLKDN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQ   + I  LY++ +FQ+ CG+Y GAADYLY YR L ++ +RSLSA WGK+AAEIL  N
Sbjct  121  YQFTDDSINILYEFGQFQYNCGDYGGAADYLYHYRVLSSDPERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E ID KSF +PL 
Sbjct  181  WDGALEEIQKLREAIDQKSFVSPLQ  205



>ref|NP_001059730.1| Os07g0503700 [Oryza sativa Japonica Group]
 dbj|BAC83992.1| putative eukaryotic initiation factor 3E [Oryza sativa Japonica 
Group]
 dbj|BAF21644.1| Os07g0503700 [Oryza sativa Japonica Group]
 gb|EEE67231.1| hypothetical protein OsJ_24367 [Oryza sativa Japonica Group]
Length=436

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 162/211 (77%), Gaps = 13/211 (6%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQER--QLYADEDILKAKIELL-NDTNMVDYAMDIH  232
            A++DLT R+A  ++ HLVFPLLEFLQ R  ++YA E+IL+AK+ LL   TNMVDYAMD H
Sbjct  2    AEHDLTARMAAHMNCHLVFPLLEFLQWRPGRVYAVEEILQAKLRLLIQGTNMVDYAMDTH  61

Query  233  KSLY------HTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHN  394
            K L+          VP +MV+RR EVV RL AL   AAP+V  L+N      L  DK+HN
Sbjct  62   KLLHGDTDDDVVVPVPDDMVERRHEVVTRLGALAAPAAPIVSALKN----HHLGPDKEHN  117

Query  395  LQLLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLA  574
            +++L++R+QIGP+QIEALYQYAKFQF+CGNY  AA+ L++YRALCT+S+RSLSA WGKL+
Sbjct  118  IRMLHERFQIGPDQIEALYQYAKFQFDCGNYPDAAENLHRYRALCTSSERSLSAQWGKLS  177

Query  575  AEILMQNWDIALEELNRLKEIIDSKSFSTPL  667
            AEIL  NWD+ALEELN LKE+IDSK+ S+PL
Sbjct  178  AEILNNNWDVALEELNCLKEMIDSKNSSSPL  208



>emb|CEG66949.1| Putative Eukaryotic translation initiation factor 3 subunit E 
[Rhizopus microsporus]
Length=443

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/204 (50%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA +DLT ++ P LDRHLVFPL+EFL+ +++Y  E++LKAK +L  ++NMVD+ +D++K
Sbjct  1    MAATHDLTMKMIPFLDRHLVFPLIEFLELKEVYVAENLLKAKYDLFKNSNMVDFVVDLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L  TE+ P+E  ++R  V+AR++ L   A  +++ LQ    +  LR DK  ++Q L D 
Sbjct  61   KLNKTEETPKEFAEKRESVLARMEDLRTKAQKVMEVLQKPEVIAVLRQDKAESIQYLKDN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQ   + I  LY++ +FQ+ CG+Y GAADYLY YR L ++ +RSLSA WGK+AAEIL  N
Sbjct  121  YQFTDDSINILYEFGQFQYNCGDYGGAADYLYHYRVLSSDPERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPL  667
            WD ALEE+ +L+E ID KSF +PL
Sbjct  181  WDGALEEIQKLREAIDQKSFVSPL  204



>ref|XP_008430171.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Poecilia reticulata]
Length=445

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y +E++L+ K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEEELLRGKLDLLSDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y+  ++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YNDTEIPHTLREKRTEVVAQLKQLQGETEPIVKMFEDPETTRQMQSSRDGRMLFDYLEEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            Y    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  YNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPLQ  207



>gb|EXX57549.1| hypothetical protein RirG_206150 [Rhizophagus irregularis DAOM 
197198w]
Length=433

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA YDLTP++ P LDRHLVFPLLEFL   ++Y + D+LKAK ELL  TNMVD+   ++K
Sbjct  1    MAATYDLTPKLIPYLDRHLVFPLLEFLSMHKIYPEIDLLKAKYELLAKTNMVDFISMLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            +++ TE+VP E   +R EV+  L+ L+  A  ++  ++N   +  LR DK  NL  L ++
Sbjct  61   TIHDTEEVPNEFSTKRDEVLQTLENLQSEAQKVLDIIENPEVISALRQDKLQNLNFLKEK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            Y +  + +  LYQ+ +FQ+ CGNY GA+D LY +R L T+ + ++SALWGKLA++IL  N
Sbjct  121  YGLTDKMLNTLYQFGQFQYNCGNYGGASDMLYHFRVLSTDHELNVSALWGKLASDILDSN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +LKE ID K+F++PLH
Sbjct  181  WDGALEEVQKLKETIDQKNFTSPLH  205



>ref|XP_007563282.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Poecilia formosa]
Length=445

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y +E++L+ K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEEELLRGKLDLLSDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y+  ++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YNDTEIPHTLREKRTEVVAQLKQLQGETEPIVKMFEDPETTRQMQSSRDGRMLFDYLEEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            Y    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  YNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPLQ  207



>ref|XP_005844652.1| hypothetical protein CHLNCDRAFT_138996 [Chlorella variabilis]
 gb|EFN52550.1| hypothetical protein CHLNCDRAFT_138996 [Chlorella variabilis]
Length=422

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 145/199 (73%), Gaps = 0/199 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
             +YDLTP I+  LD+HL+FPLLEFL  + LY   DI  AK+ L+  TNMVDYA+DI++ L
Sbjct  2    TQYDLTPAISKHLDKHLIFPLLEFLGSKGLYDVADIEAAKLALIEKTNMVDYAVDIYQQL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
              T++VP+ +  RR EVVA+LK+LE A  P+  FL N   V+ L+ DK  N+  L   + 
Sbjct  62   NQTDEVPESLRQRRGEVVAKLKSLEGAVKPITDFLSNEENVKLLKQDKTQNMTFLQKEFN  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            IGPEQ++ALY +AK+ FECGNYS AA+YLY YR L T+ +R++++LWGK+AA++L+Q + 
Sbjct  122  IGPEQVDALYHFAKWNFECGNYSAAAEYLYHYRTLSTHPERTIASLWGKVAADVLLQEFG  181

Query  602  IALEELNRLKEIIDSKSFS  658
             A++++ +LKE++D  +F+
Sbjct  182  SAMDDILKLKEMLDVDTFA  200



>ref|XP_006005204.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Latimeria chalumnae]
Length=446

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L+D+
Sbjct  62   YPDKEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSDK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  182  NWDAAMEDLTRLKETIDNNSVSSPLQ  207



>ref|XP_006250447.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Rattus norvegicus]
Length=399

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>gb|ESA16451.1| hypothetical protein GLOINDRAFT_156542 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX57550.1| hypothetical protein RirG_206150 [Rhizophagus irregularis DAOM 
197198w]
Length=456

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA YDLTP++ P LDRHLVFPLLEFL   ++Y + D+LKAK ELL  TNMVD+   ++K
Sbjct  1    MAATYDLTPKLIPYLDRHLVFPLLEFLSMHKIYPEIDLLKAKYELLAKTNMVDFISMLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
            +++ TE+VP E   +R EV+  L+ L+  A  ++  ++N   +  LR DK  NL  L ++
Sbjct  61   TIHDTEEVPNEFSTKRDEVLQTLENLQSEAQKVLDIIENPEVISALRQDKLQNLNFLKEK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            Y +  + +  LYQ+ +FQ+ CGNY GA+D LY +R L T+ + ++SALWGKLA++IL  N
Sbjct  121  YGLTDKMLNTLYQFGQFQYNCGNYGGASDMLYHFRVLSTDHELNVSALWGKLASDILDSN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +LKE ID K+F++PLH
Sbjct  181  WDGALEEVQKLKETIDQKNFTSPLH  205



>dbj|BAB27621.1| unnamed protein product [Mus musculus]
Length=422

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>gb|EFB25663.1| hypothetical protein PANDA_007264 [Ailuropoda melanoleuca]
Length=433

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>pdb|3J8B|E Chain E, Model Of The Human Eif3 Pci-mpn Octamer Docked Into 
The 43s-hcv Ires Em Map
 pdb|3J8C|E Chain E, Model Of The Human Eif3 Pci-mpn Octamer Docked Into 
The 43s Em Map
Length=422

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|XP_005613308.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Equus caballus]
Length=460

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|NP_001279788.1| eukaryotic translation initiation factor 3, subunit E [Callorhinchus 
milii]
 gb|AFK11304.1| eukaryotic translation initiation factor 3 subunit E-A [Callorhinchus 
milii]
Length=445

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    ADYDLTMKIANFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++PQ + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   YSDKEIPQALREKRTTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RLKE ID+ S S+PL 
Sbjct  182  NWEAAMEDLTRLKETIDNNSVSSPLQ  207



>ref|XP_010614025.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Fukomys damarensis]
Length=445

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYKYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_008400652.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like isoform X2 [Poecilia reticulata]
Length=332

 Score =   214 bits (545),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L+++
Sbjct  62   YPDKEIPHSLREKRSNVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E +D+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETVDNNSVSSPL  206



>gb|AAX36482.1| eukaryotic translation initiation factor 3 subunit 6 [synthetic 
construct]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_004796181.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Mustela putorius furo]
Length=456

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|XP_006830704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Chrysochloris asiatica]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|NP_001126100.1| eukaryotic translation initiation factor 3 subunit E [Pongo abelii]
 emb|CAH91901.1| hypothetical protein [Pongo abelii]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>emb|CAG33310.1| EIF3S6 [Homo sapiens]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_007188837.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Balaenoptera acutorostrata scammoni]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>gb|AAX29771.1| eukaryotic translation initiation factor 3 subunit 6 48kDa [synthetic 
construct]
 gb|AAX36929.1| eukaryotic translation initiation factor 3 subunit 6, partial 
[synthetic construct]
 gb|AAX42668.1| eukaryotic translation initiation factor 3 subunit 6, partial 
[synthetic construct]
Length=446

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_007075896.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Panthera tigris altaica]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_005799084.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Xiphophorus maculatus]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y +E++L+ K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEEELLRGKLDLLSDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y   ++P  + ++R EVVA+LK L+    P+V+  ++  A +++++ +   +    L ++
Sbjct  62   YSDTEIPHTLREKRTEVVAQLKQLQGETEPIVKMFEDPEATRQIQSTRDGRMLFDYLEEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPLQ  207



>ref|XP_005869124.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Myotis brandtii]
 ref|XP_006085268.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Myotis lucifugus]
 gb|EPQ09502.1| Eukaryotic translation initiation factor 3 subunit E [Myotis 
brandtii]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>dbj|BAG36003.1| unnamed protein product [Homo sapiens]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_005170108.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X1 [Danio rerio]
Length=446

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL++TNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSETNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + D+R  VVA+LK L+    P+V+  ++    +++++  D +   + L D+
Sbjct  62   YPDKEIPHSLRDKRTTVVAQLKQLQSETEPIVKMFEDPETQRQMQSTRDGRMLFEYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_010369113.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Rhinopithecus roxellana]
Length=473

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  30   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  89

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  90   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  148

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  149  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  208

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  209  NWDAAMEDLTRLKETIDNNSVSSPLQ  234



>ref|XP_003903117.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Papio anubis]
 ref|XP_005563983.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Macaca fascicularis]
 ref|XP_008973473.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pan paniscus]
 ref|XP_010347573.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Saimiri boliviensis boliviensis]
Length=473

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  30   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  89

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  90   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  148

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  149  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  208

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  209  NWDAAMEDLTRLKETIDNNSVSSPLQ  234



>ref|NP_001559.1| eukaryotic translation initiation factor 3 subunit E [Homo sapiens]
 ref|NP_032414.1| eukaryotic translation initiation factor 3 subunit E [Mus musculus]
 ref|NP_001011990.1| eukaryotic translation initiation factor 3 subunit E [Rattus 
norvegicus]
 ref|NP_001245017.1| eukaryotic translation initiation factor 3, subunit E [Macaca 
mulatta]
 ref|NP_001288220.1| eukaryotic translation initiation factor 3, subunit E [Equus 
caballus]
 ref|XP_532304.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 2 [Canis lupus familiaris]
 ref|XP_002710778.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Oryctolagus cuniculus]
 ref|XP_002918756.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ailuropoda melanoleuca]
 ref|XP_003480039.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cavia porcellus]
 ref|XP_003782458.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Otolemur garnettii]
 ref|XP_004000105.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Felis catus]
 ref|XP_004047479.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004282986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Orcinus orca]
 ref|XP_004324100.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Tursiops truncatus]
 ref|XP_004403906.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Odobenus rosmarus divergens]
 ref|XP_004431317.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ceratotherium simum simum]
 ref|XP_004607728.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Sorex araneus]
 ref|XP_004771370.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Mustela putorius furo]
 ref|XP_004796182.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Mustela putorius furo]
 ref|XP_005072680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Mesocricetus auratus]
 ref|XP_005367570.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Microtus ochrogaster]
 ref|XP_005316305.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ictidomys tridecemlineatus]
 ref|XP_005382024.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Chinchilla lanigera]
 ref|XP_006189142.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelus ferus]
 ref|XP_006211631.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Vicugna pacos]
 ref|XP_006167984.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tupaia chinensis]
 ref|XP_006753964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Myotis davidii]
 ref|XP_006916674.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pteropus alecto]
 ref|XP_006978773.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Peromyscus maniculatus bairdii]
 ref|XP_007446593.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Lipotes vexillifer]
 ref|XP_007524298.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Erinaceus europaeus]
 ref|XP_007640052.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cricetulus griseus]
 ref|XP_007637828.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cricetulus griseus]
 ref|XP_008053552.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tarsius syrichta]
 ref|XP_008141617.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Eptesicus fuscus]
 ref|XP_008506418.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Equus przewalskii]
 ref|XP_008567955.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Galeopterus variegatus]
 ref|XP_008687479.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ursus maritimus]
 ref|XP_008849727.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Nannospalax galili]
 ref|XP_010954133.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Camelus bactrianus]
 ref|XP_010983434.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Camelus dromedarius]
 ref|XP_011367760.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pteropus vampyrus]
 sp|P60228.1|EIF3E_HUMAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=Viral integration 
site protein INT-6 homolog; AltName: Full=eIF-3 p48 [Homo sapiens]
 sp|P60229.1|EIF3E_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=MMTV integration site 
6; AltName: Full=Mammary tumor-associated protein INT-6; 
AltName: Full=Viral integration site protein INT-6; AltName: 
Full=eIF-3 p48 [Mus musculus]
 sp|Q4R6G8.1|EIF3E_MACFA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Macaca 
fascicularis]
 sp|Q641X8.1|EIF3E_RAT RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Rattus 
norvegicus]
 sp|Q5R8K9.2|EIF3E_PONAB RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Pongo abelii]
 gb|AAB58251.1| similar to mouse Int-6 [Homo sapiens]
 gb|AAC51760.1| eIF3-p48 [Homo sapiens]
 gb|AAB88873.1| Int-6 [Homo sapiens]
 gb|AAC51919.1| mammary tumor-associated protein INT6 [Homo sapiens]
 gb|AAH00734.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH08419.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH16706.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH21679.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH29177.1| Eukaryotic translation initiation factor 3, subunit E [Mus musculus]
 emb|CAG47071.1| EIF3S6 [Homo sapiens]
 gb|AAH82087.1| Eukaryotic translation initiation factor 3, subunit E [Rattus 
norvegicus]
 emb|CAH92644.1| hypothetical protein [Pongo abelii]
 gb|AAX41093.1| eukaryotic translation initiation factor 3 subunit 6 [synthetic 
construct]
 gb|AAX42420.1| eukaryotic translation initiation factor 3 subunit 6 48kDa [synthetic 
construct]
 dbj|BAE01307.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE38465.1| unnamed protein product [Mus musculus]
 dbj|BAE27546.1| unnamed protein product [Mus musculus]
 dbj|BAE36512.1| unnamed protein product [Mus musculus]
 dbj|BAE26211.1| unnamed protein product [Mus musculus]
 gb|EAW91918.1| eukaryotic translation initiation factor 3, subunit 6 48kDa, 
isoform CRA_a [Homo sapiens]
 gb|ABM83204.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [synthetic 
construct]
 gb|ABM86404.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [synthetic 
construct]
 gb|EDL08753.1| mCG16052, isoform CRA_a [Mus musculus]
 gb|EDM16318.1| rCG59689, isoform CRA_a [Rattus norvegicus]
 dbj|BAI45432.1| eukaryotic translation initiation factor 3, subunit E [synthetic 
construct]
 gb|EHH64366.1| Eukaryotic translation initiation factor 3 subunit E [Macaca 
fascicularis]
 gb|ELK08606.1| Eukaryotic translation initiation factor 3 subunit E [Pteropus 
alecto]
 gb|ELK37587.1| Eukaryotic translation initiation factor 3 subunit E [Myotis 
davidii]
 gb|AIC49071.1| EIF3E, partial [synthetic construct]
 gb|AIC63063.1| EIF3E, partial [synthetic construct]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|NP_001029775.1| eukaryotic translation initiation factor 3 subunit E [Bos taurus]
 ref|XP_004011834.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ovis aries]
 ref|XP_005689215.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Capra hircus]
 ref|XP_005963084.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pantholops hodgsonii]
 ref|XP_005963085.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pantholops hodgsonii]
 ref|XP_006075747.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Bubalus bubalis]
 ref|XP_010861761.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Bison bison bison]
 sp|Q3T102.1|EIF3E_BOVIN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Bos taurus]
 gb|AAI02189.1| Eukaryotic translation initiation factor 3, subunit E [Bos taurus]
 tpg|DAA22620.1| TPA: eukaryotic translation initiation factor 3 subunit E [Bos 
taurus]
Length=445

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_003256152.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 1 [Nomascus leucogenys]
Length=473

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  30   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  89

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  90   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  148

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  149  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  208

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  209  NWDAAMEDLTRLKETIDNNSVSSPLQ  234



>gb|AIC63065.1| EIF3E, partial [synthetic construct]
Length=446

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>gb|ABF57434.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [Bos 
taurus]
Length=444

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  1    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  60

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  61   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  119

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  120  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  179

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  180  NWDAAMEDLTRLKETIDNNSVSSPLQ  205



>ref|XP_004370748.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Trichechus manatus latirostris]
Length=473

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  30   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  89

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  90   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  148

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  149  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  208

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  209  NWDAAMEDLTRLKETIDNNSVSSPLQ  234



>ref|XP_006737590.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E, partial [Leptonychotes weddellii]
Length=444

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|XP_002759346.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Callithrix jacchus]
Length=473

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  30   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  89

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  90   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  148

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  149  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  208

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  209  NWDAAMEDLTRLKETIDNNSVSSPLQ  234



>ref|XP_003760371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Sarcophilus harrisii]
Length=445

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_007229269.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E-B-like [Astyanax mexicanus]
Length=445

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT  IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTNIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++PQ + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   YPEKEIPQSLREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPLQ  207



>ref|XP_003965946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Takifugu rubripes]
Length=445

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 154/206 (75%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y +E++L  K++LL++TNMVD+AMD+H+SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEEELLNGKLDLLSETNMVDFAMDVHRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +D+P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FPEKDIPYTLKEKRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPPTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S ++PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVTSPLQ  207



>ref|XP_004642297.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Octodon degus]
Length=445

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE +D+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETVDNNSVSSPL  205



>gb|KFO18524.1| Eukaryotic translation initiation factor 3 subunit E [Fukomys 
damarensis]
Length=480

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYKYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_007056150.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Chelonia mydas]
Length=445

 Score =   216 bits (551),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K+ELL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLELLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDEIPHALREKRTAVVAQLKQLQLETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE +D+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETVDNNSVSSPLQ  206



>ref|XP_004850341.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Heterocephalus glaber]
Length=445

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 154/205 (75%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  + +Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKGIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|XP_007999543.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Chlorocebus sabaeus]
Length=496

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  53   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  112

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  113  Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  171

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  172  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  231

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  232  NWDAAMEDLTRLKETIDNNSVSSPLQ  257



>sp|Q1LUA8.2|EI3EB_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-B; Short=eIF3e-B; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-B [Danio rerio]
Length=446

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL++TNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSETNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + D+R  VVA+LK L+    P+V+  ++    +++++  D +   + L D+
Sbjct  62   YPDKEIPHSLRDKRTTVVAQLKQLQSETEPIVKMFEDPETQRQMQSTRDGRMLFEYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ + S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPL  206



>gb|EIE75948.1| hypothetical protein RO3G_00652 [Rhizopus delemar RA 99-880]
Length=434

 Score =   216 bits (549),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 146/205 (71%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA +DLT ++ P LDRHLV+PLLEFL+ +++Y  ED+L+AK  L  +++MVD+ + ++K
Sbjct  1    MAATHDLTMKMIPFLDRHLVYPLLEFLELKEVYVAEDLLQAKYNLFQNSHMVDFVLSLYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L  TE+ P+E  ++R +V+++++ L   A  ++Q L+    +  L  DK  NLQ L D 
Sbjct  61   KLNKTEEAPKEFSEKREKVLSQMEELRTKAQKVMQVLEKPEVIATLCQDKAENLQYLRDN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            YQ   + I+ LY++ +FQ+ CG+Y GAADYLY YR L T+++RSLSA WGK+AAEIL  N
Sbjct  121  YQFTDDSIDILYEFGQFQYNCGDYGGAADYLYHYRVLSTDTERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E ID KSF++PL 
Sbjct  181  WDGALEEMQKLREAIDQKSFASPLQ  205



>ref|XP_008166528.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E [Chrysemys picta bellii]
Length=474

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K+ELL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLELLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDEIPHALREKRTAVVAQLKQLQLETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE +D+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETVDNNSVSSPLQ  206



>ref|XP_006794555.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Neolamprologus brichardi]
Length=408

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYKYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>gb|EMP39258.1| Eukaryotic translation initiation factor 3 subunit E [Chelonia 
mydas]
Length=472

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K+ELL+DTNMVD+AMD++K+L
Sbjct  29   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLELLSDTNMVDFAMDVYKNL  88

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  89   Y-SDEIPHALREKRTAVVAQLKQLQLETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  147

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  148  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  207

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE +D+ S S+PL 
Sbjct  208  NWDAAMEDLTRLKETVDNNSVSSPLQ  233



>ref|XP_004661452.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Jaculus jaculus]
Length=445

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +D+ +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDKNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>emb|CAG07918.1| unnamed protein product [Tetraodon nigroviridis]
Length=470

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  + +Y +E++L  K++LL+DTNMVD+AMD+H+SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKAIYNEEELLNGKLDLLSDTNMVDFAMDVHRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +D+P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FPEKDIPYTLKEKRTEVVAQLKQLQSETEPIVKIFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPPTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S ++PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVTSPL  206



>gb|AAH17887.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
Length=445

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 154/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD  +E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAVMEDLTRLKETIDNNSVSSPLQ  206



>gb|ACQ58587.1| Eukaryotic translation initiation factor 3 subunit E [Anoplopoma 
fimbria]
Length=445

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD+++SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLHGKLDLLSDTNMVDFAMDVYRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++PQ + +RR EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YLDKEIPQTLRERRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLAPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S ++PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVTSPLQ  207



>ref|XP_004679709.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Condylura cristata]
Length=472

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  29   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  88

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  ++ +R  VV++LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  89   Y-SDDIPHALIGKRATVVSQLKRLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  147

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L +  D+ +LS+LWGKLA+EILMQ
Sbjct  148  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVSAMDKNALSSLWGKLASEILMQ  207

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  208  NWDAAMEDLTRLKETIDNNSVSSPLQ  233



>ref|XP_005924386.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like isoform X2 [Haplochromis burtoni]
Length=445

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD+++SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLRGKLDLLSDTNMVDFAMDVYRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YAEKEIPHTLKEKRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ + S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPLQ  207



>ref|XP_010738667.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Larimichthys crocea]
Length=445

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD+H+SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLNGKLDLLSDTNMVDFAMDVHRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FPEKEIPHTLREKRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S ++PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVTSPLQ  207



>ref|XP_004850340.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Heterocephalus glaber]
Length=491

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 154/205 (75%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  + +Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKGIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|XP_006892391.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Elephantulus edwardii]
Length=445

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 153/205 (75%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSD-RSLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L T +D   LS +WGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVTATDLHYLSTIWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|XP_002113968.1| hypothetical protein TRIADDRAFT_50473 [Trichoplax adhaerens]
 gb|EDV23058.1| hypothetical protein TRIADDRAFT_50473 [Trichoplax adhaerens]
Length=443

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 146/202 (72%), Gaps = 5/202 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DL+ RIA +LDRHLVFPLLEFL   ++Y ++DILK K+ELL +T MVD+AMD+HK L
Sbjct  2    AEFDLSTRIASKLDRHLVFPLLEFLSVNKIYNEDDILKGKLELLKNTKMVDFAMDVHKKL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL---LND  412
            Y   +VP+   D+R EVV+ LK   E   P+V+   +     +L  D +    L   L+ 
Sbjct  62   YPEMEVPESFRDKRTEVVSELKNFREKCTPVVEVFSSDEDFMKLLQDHRDGRYLFDYLSR  121

Query  413  RYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSD--RSLSALWGKLAAEIL  586
            ++ I P+ ++ALY YAKFQ+ECGNYSGAA+YL+ +R L  N++  +  SALWGKLA+EIL
Sbjct  122  KHNIQPDTLDALYDYAKFQYECGNYSGAAEYLHFFRVLSPNANDQKGESALWGKLASEIL  181

Query  587  MQNWDIALEELNRLKEIIDSKS  652
            MQNWD+ALE+L+RL+E+ID+ +
Sbjct  182  MQNWDVALEDLHRLREVIDTNT  203



>ref|XP_008400651.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like isoform X1 [Poecilia reticulata]
Length=389

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSNVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E +D+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETVDNNSVSSPL  206



>dbj|GAN10003.1| eukaryotic translation initiation factor 3 subunit E [Mucor ambiguus]
Length=441

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 147/212 (69%), Gaps = 7/212 (3%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQL-------YADEDILKAKIELLNDTNMVD  214
            MAA  DLT R+ P LDRHLVFPL+EFL+ +++       YA E++L+AK +L   +NMVD
Sbjct  1    MAATQDLTMRMIPFLDRHLVFPLIEFLELKEVDIHIDNVYAPEELLQAKYDLFKGSNMVD  60

Query  215  YAMDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHN  394
            + +D++K L+ TE+ P+E  D+R  V+++++ L   A  ++  L+    +  LR DK  N
Sbjct  61   FVLDLYKKLHKTEEAPKEFTDKRENVLSKMEDLRTKAQKVMDVLEKPEVIAALRQDKTQN  120

Query  395  LQLLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLA  574
            LQ L + Y+   + I  LY++ +FQ+ CG+Y GAADYLY +R L T+++RSLSA WGK+A
Sbjct  121  LQYLKENYKFTDDSINILYEFGQFQYNCGDYGGAADYLYHFRVLSTDAERSLSATWGKMA  180

Query  575  AEILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            AEIL  NWD ALEE+ +L+E IDSK+F++PL 
Sbjct  181  AEILTGNWDAALEEMQKLREAIDSKNFTSPLQ  212



>ref|XP_006038115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Alligator sinensis]
 ref|XP_006269838.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Alligator mississippiensis]
Length=445

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDEIPHALREKRTSVVAQLKQLQLETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_004086680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Oryzias latipes]
Length=445

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEQELLHGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   FPDKEIPHTLREKRTEVVAQLKQLQSETEPIVKMFEDPETTKQMQSTRDGRMLFDYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++D+ +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDKNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_006635626.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Lepisosteus oculatus]
Length=446

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YPDKEIPHSLREKRTTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RLKE ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLKETIDNNSVSSPL  206



>gb|EHH28709.1| Eukaryotic translation initiation factor 3 subunit E [Macaca 
mulatta]
Length=445

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 154/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLL FL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLAFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_003408482.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Loxodonta africana]
Length=445

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R   VA+LK L+  + P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDDIPHALREKRTTAVAQLKQLQAESGPIVKMFEDPELPRQMQSSRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_006113079.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pelodiscus sinensis]
Length=445

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   Y-SDEIPHALREKRTAVVAQLKQLQLETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_004569303.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Maylandia zebra]
 ref|XP_005739838.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Pundamilia nyererei]
 ref|XP_005940978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Haplochromis burtoni]
Length=446

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYKYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_008291531.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B [Stegastes partitus]
Length=446

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_003447252.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Oreochromis niloticus]
Length=446

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYKYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_008283264.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Stegastes partitus]
Length=445

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD+++SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLHGKLDLLSDTNMVDFAMDVYRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FSEKEIPHTLREKRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_004566824.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Maylandia zebra]
 ref|XP_005741381.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Pundamilia nyererei]
Length=445

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD+++SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLRGKLDLLSDTNMVDFAMDVYRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FAEKEIPHTLKEKRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ + S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPLQ  207



>ref|XP_006794910.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Neolamprologus brichardi]
Length=445

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD+++SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLRGKLDLLSDTNMVDFAMDVYRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FADKEIPHTLKEKRTEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ + S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPLQ  207



>ref|XP_007543239.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X1 [Poecilia formosa]
Length=446

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSNVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E +D+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETVDNNSVSSPL  206



>emb|CAJ82304.1| eukaryotic translation initiation factor 3, subunit 6 [Xenopus 
(Silurana) tropicalis]
Length=440

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++ + K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELFQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YADKEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDHLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ + S+PL
Sbjct  182  NWDAAMEDLTRLKETIDNNTVSSPL  206



>ref|NP_989147.1| eukaryotic translation initiation factor 3 subunit E [Xenopus 
(Silurana) tropicalis]
 sp|Q6P7L9.1|EIF3E_XENTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Xenopus (Silurana) tropicalis]
 gb|AAH61611.1| eukaryotic translation initiation factor 3, subunit 6 [Xenopus 
(Silurana) tropicalis]
 gb|AAH80327.1| eukaryotic translation initiation factor 3, subunit 6 [Xenopus 
(Silurana) tropicalis]
Length=446

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++ + K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELFQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YADKEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDHLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ + S+PL
Sbjct  182  NWDAAMEDLTRLKETIDNNTVSSPL  206



>gb|ADO28016.1| eukaryotic translation initiation factor 3 subunit e-b [Ictalurus 
furcatus]
Length=446

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT +IA  LDRHLVFPLLEFL  +++Y D+++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    ADYDLTTKIAYFLDRHLVFPLLEFLSVKEIYNDKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y   ++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YADREIPHALREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ S S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPLQ  207



>ref|XP_005815573.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Xiphophorus maculatus]
Length=463

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 156/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSNVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E +D+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETVDNNSVSSPL  206



>ref|XP_005042453.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ficedula albicollis]
 ref|XP_005423539.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Geospiza fortis]
 ref|XP_005517019.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pseudopodoces humilis]
 ref|XP_008640867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Corvus brachyrhynchos]
 ref|XP_008921430.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Manacus vitellinus]
 ref|XP_009085840.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Serinus canaria]
 ref|XP_010403156.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Corvus cornix cornix]
 gb|KFO65885.1| Eukaryotic translation initiation factor 3 subunit E [Corvus 
brachyrhynchos]
 gb|KFW80352.1| Eukaryotic translation initiation factor 3 subunit E [Manacus 
vitellinus]
Length=445

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   Y-SDEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_003453516.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Oreochromis niloticus]
Length=445

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 156/206 (76%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD+++SL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEQELLRGKLDLLSDTNMVDFAMDVYRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FAEKEIPHTLKEKRSEVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ A+E+L RL+E ID+ + S+PL 
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPLQ  207



>ref|XP_006113078.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pelodiscus sinensis]
Length=473

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDEIPHALREKRTAVVAQLKQLQLETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ S S+PL
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPL  205



>ref|NP_001089321.1| eukaryotic translation initiation factor 3 subunit E-B [Xenopus 
laevis]
 sp|Q3B8M3.1|EI3EB_XENLA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-B; Short=eIF3e-B; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-B [Xenopus laevis]
 gb|AAI06219.1| Eif3e-b protein [Xenopus laevis]
Length=446

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YADKEIPLALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDHLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ + S+PL
Sbjct  182  NWDAAMEDLTRLKETIDNNTVSSPL  206



>ref|NP_001082486.1| eukaryotic translation initiation factor 3 subunit E-A [Xenopus 
laevis]
 sp|Q05AY2.1|EI3EA_XENLA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-A; Short=eIF3e-A; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-A [Xenopus laevis]
 gb|AAI23117.1| Eif3e-a protein [Xenopus laevis]
 gb|AAI28928.1| Eif3e-a protein [Xenopus laevis]
Length=446

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD++K+L
Sbjct  2    ADYDLTTKIAQFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YADKEIPLALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDHLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ + S+PL
Sbjct  182  NWDAAMEDLTRLKETIDNNTVSSPL  206



>ref|XP_001636266.1| predicted protein [Nematostella vectensis]
 sp|A7RWP6.1|EIF3E_NEMVE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Nematostella vectensis]
 gb|EDO44203.1| predicted protein [Nematostella vectensis]
Length=448

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 149/205 (73%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT ++   LDRHLVFPLLEFL  +++Y + ++LK K++LL++TNMVD+AMD++K L
Sbjct  2    AEHDLTSKMGCFLDRHLVFPLLEFLSVKEIYDEHELLKGKLDLLSNTNMVDFAMDVYKGL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  E+VP  +V++RVEVV  LK L+    P++    +     ++++  D +   + L   
Sbjct  62   YPDEEVPTSLVEKRVEVVKELKDLQAQTEPIINCFSDPEFTAQVQSTRDGRQLFEYLERN  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSD-RSLSALWGKLAAEILMQ  592
            + I PE ++ LY++AKFQ+ECGNYSGAA+YLY YRAL    D  SL+ALWGKLA+EILMQ
Sbjct  122  HDIKPEMLDVLYKFAKFQYECGNYSGAAEYLYFYRALAPGGDTNSLNALWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD ALE+LNRLK++I+S + +  L
Sbjct  182  NWDTALEDLNRLKDVIESNTSAGTL  206



>emb|CDQ75537.1| unnamed protein product [Oncorhynchus mykiss]
Length=450

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSETNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            +  +++P  + ++R+ VVA+LK L+    P+V+  ++    +++++  D Q     L ++
Sbjct  62   FPEKEIPATLKEKRITVVAQLKQLQGETEPIVKMFEDPETTKQMQSTRDGQALFNYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>emb|CAF92057.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=446

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 155/205 (76%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPLTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>emb|CDQ64768.1| unnamed protein product [Oncorhynchus mykiss]
Length=445

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSETNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            +  +++P  + ++R+ VVA+LK L+    P+V+  ++    +++++  D Q     L ++
Sbjct  62   FPEKEIPATLKEKRITVVAQLKQLQGETEPIVKMFEDPETTKQMQSTRDGQALFNYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>emb|CEP11876.1| hypothetical protein [Parasitella parasitica]
Length=434

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 144/205 (70%), Gaps = 0/205 (0%)
 Frame = +2

Query  56   MAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHK  235
            MAA  DLT R+ P LDRHLVFPL+EFL+ +++YA  ++L+AK +L   +NMVD+ ++++K
Sbjct  1    MAATQDLTMRMIPFLDRHLVFPLIEFLELKEVYAPGELLQAKYDLFQSSNMVDFVLELYK  60

Query  236  SLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDR  415
             L+ TE+ P+E  ++R  V+++++ L   A  ++  L+  + +  LR DK  NLQ L + 
Sbjct  61   KLHKTEEAPKEFTEKRENVLSKMEDLRSKAQKVMDILEKPDVIAALRQDKTQNLQYLKEN  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQN  595
            Y    + I  LY++ +FQ+ CG+Y GAADYLY +R L  +++RSLSA WGK+AAEIL  N
Sbjct  121  YNFTDDSINILYEFGQFQYNCGDYGGAADYLYHFRVLSIDAERSLSATWGKMAAEILTGN  180

Query  596  WDIALEELNRLKEIIDSKSFSTPLH  670
            WD ALEE+ +L+E ID K+F++PL 
Sbjct  181  WDAALEEMQKLREAIDQKNFTSPLQ  205



>gb|AAF80474.1|AF162775_1 Int-6 protein [Xenopus laevis]
Length=446

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL+DTNMVD+AMD++K+L
Sbjct  2    ADYDLTTKIAQFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YADKEIPLALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDHLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRMLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD A+E+L RLKE ID+ + S+PL
Sbjct  182  NWDAAMEDLTRLKETIDNNTVSSPL  206



>ref|XP_005150980.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Melopsittacus undulatus]
 ref|XP_005231024.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Falco peregrinus]
 ref|XP_005507310.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Columba livia]
 ref|XP_008500911.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Calypte anna]
 ref|XP_009280240.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Aptenodytes forsteri]
 ref|XP_009280241.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Aptenodytes forsteri]
 ref|XP_009896494.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Picoides pubescens]
 ref|XP_009890101.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Charadrius vociferus]
 ref|XP_010140722.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Buceros rhinoceros silvestris]
 ref|XP_010184634.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Mesitornis unicolor]
 ref|XP_010575300.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Haliaeetus leucocephalus]
 gb|KFM09320.1| Eukaryotic translation initiation factor 3 subunit E [Aptenodytes 
forsteri]
 gb|KFO93656.1| Eukaryotic translation initiation factor 3 subunit E [Buceros 
rhinoceros silvestris]
 gb|KFP07708.1| Eukaryotic translation initiation factor 3 subunit E [Calypte 
anna]
 gb|KFQ37519.1| Eukaryotic translation initiation factor 3 subunit E [Mesitornis 
unicolor]
 gb|KFV65557.1| Eukaryotic translation initiation factor 3 subunit E [Picoides 
pubescens]
 gb|KGL98673.1| Eukaryotic translation initiation factor 3 subunit E [Charadrius 
vociferus]
Length=445

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   Y-SDEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_009061036.1| hypothetical protein LOTGIDRAFT_126234 [Lottia gigantea]
 gb|ESO88323.1| hypothetical protein LOTGIDRAFT_126234 [Lottia gigantea]
Length=434

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 149/206 (72%), Gaps = 6/206 (3%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT R+   LDRHLVFPLLEFL  ++LY D+++LK K++LL++TNMVD+AMD+H++L
Sbjct  2    AEYDLTTRLGEYLDRHLVFPLLEFLSVKELYDDKEMLKGKLDLLSNTNMVDFAMDVHQNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y  + VP  + D+R +VV  LK L+     + +  ++    + ++   +   QL +  YQ
Sbjct  62   YPDQQVPPVLKDKRGKVVNELKTLQAETDVITKIFEDPEVTRTIQ--NRDGRQLCDFLYQ  119

Query  422  ---IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS-LSALWGKLAAEILM  589
                 PE +E LY YAKFQ+ECGNYSGAA+YLY  RAL T +D++ ++ALWGKLA+EILM
Sbjct  120  EKGFKPEMVETLYNYAKFQYECGNYSGAAEYLYFVRALVTPNDKNFMNALWGKLASEILM  179

Query  590  QNWDIALEELNRLKEIIDSKSFSTPL  667
            QNWD+ALE+LNRLK+IID  +F+  L
Sbjct  180  QNWDVALEDLNRLKDIIDHNTFAGDL  205



>ref|XP_009454078.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E [Pan troglodytes]
Length=496

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 154/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  53   AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  112

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  113  Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  171

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+E L+Q
Sbjct  172  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEXLLQ  231

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  232  NWDAAMEDLTRLKETIDNNSVSSPLQ  257



>ref|XP_010790694.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Notothenia coriiceps]
Length=446

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT +IA  LDRHLVFPLLEFL  +++Y D+++L+ K++LL++TNMVD+AMD++K+L
Sbjct  2    ADYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNDKELLQGKLDLLSETNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + ++R  VV +LK L+    P+V+  ++    +++++  D +     L+++
Sbjct  62   YADKEIPHSLREKRSSVVDQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|NP_001233255.1| Eukaryotic translation initiation factor 3 subunit 6 [Oncorhynchus 
mykiss]
 gb|ACO08186.1| Eukaryotic translation initiation factor 3 subunit 6 [Oncorhynchus 
mykiss]
Length=494

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSETNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            +  +++P  + ++R+ VVA+LK L+    P+V+  ++    +++++  D Q     L ++
Sbjct  62   FPEKEIPATLKEKRITVVAQLKQLQGETEPIVKMFEDPETTKQMQSTRDGQALFNYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|NP_001006349.1| eukaryotic translation initiation factor 3 subunit E [Gallus 
gallus]
 sp|Q5ZLA5.1|EIF3E_CHICK RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Gallus gallus]
 emb|CAG31488.1| hypothetical protein RCJMB04_6o19 [Gallus gallus]
Length=445

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   Y-SDEIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+E+LMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEVLMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_006735494.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X3 [Leptonychotes weddellii]
Length=385

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLL FL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLGFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P V+  ++    +++++  D       L D+
Sbjct  62   Y-SDDIPHALREKRPTVVAQLKQLQAETEPNVKMFEDPETTRQMQSTRDGWMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_006735493.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X2 [Leptonychotes weddellii]
Length=392

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLL FL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLGFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P V+  ++    +++++  D       L D+
Sbjct  62   Y-SDDIPHALREKRPTVVAQLKQLQAETEPNVKMFEDPETTRQMQSTRDGWMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|NP_001135167.1| eukaryotic translation initiation factor 3 subunit E [Salmo salar]
 sp|B5DGH9.1|EIF3E_SALSA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Salmo salar]
 gb|ACH70853.1| eukaryotic translation initiation factor 3, subunit E, a [Salmo 
salar]
Length=445

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSETNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            +  +++P  + ++R+ VV +LK L+    P+V+  ++    +++++  D Q     L ++
Sbjct  62   FPEKEIPATLREKRITVVGQLKQLQGETEPIVKMFEDPETTKQMQSTRDGQALFNYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|NP_001038416.1| eukaryotic translation initiation factor 3 subunit E-B [Danio 
rerio]
Length=401

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL++TNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSETNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + D+R  VVA+LK L+    P+V+  ++    +++++  D +   + L D+
Sbjct  62   YPDKEIPHSLRDKRTTVVAQLKQLQSETEPIVKMFEDPETQRQMQSTRDGRMLFEYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKS  652
            NW+ A+E+L RL+E ID+ S
Sbjct  182  NWEAAMEDLTRLRETIDNNS  201



>ref|XP_010903799.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E [Esox lucius]
Length=520

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 154/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSETNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            +  +++P  + ++R+ VVA+LK L+    P+V+  ++    +++++  D Q     L ++
Sbjct  62   FPEKEIPATLREKRITVVAQLKQLQGETEPIVKMFEDPETTRQMQSTRDGQALFNYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_007563199.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Poecilia formosa]
Length=454

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 156/215 (73%), Gaps = 12/215 (6%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y +E++L+ K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEEELLRGKLDLLSDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y+  ++P  + ++R EVVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   YNDTEIPHTLREKRTEVVAQLKQLQGETEPIVKMFEDPETTRQMQSSRDGRMLFDYLEEK  121

Query  416  YQ---------IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWG  565
            Y             E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +L++LWG
Sbjct  122  YNNLYNHLSSDFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALNSLWG  181

Query  566  KLAAEILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
            KLA+EILMQNW+ A+E+L RL+E ID+ S S+PL 
Sbjct  182  KLASEILMQNWEAAMEDLTRLRETIDNNSVSSPLQ  216



>ref|XP_006735492.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X1 [Leptonychotes weddellii]
Length=445

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLL FL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLGFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK L+    P V+  ++    +++++  D       L D+
Sbjct  62   Y-SDDIPHALREKRPTVVAQLKQLQAETEPNVKMFEDPETTRQMQSTRDGWMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_001369627.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Monodelphis domestica]
Length=445

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 154/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DT MVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTKMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++DVP  + ++R  VVA+LK L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDVPHALREKRQTVVAQLKQLQVEMEPVVKMFEDTETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ +Y+YAKFQFECGNY+ AA+YLY +R L  ++DR +L++LWGKLA+EILMQ
Sbjct  121  HDFRQEYLDTVYRYAKFQFECGNYTAAAEYLYFFRVLVPSTDRNALNSLWGKLASEILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_002735030.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Saccoglossus kowalevskii]
Length=446

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 150/207 (72%), Gaps = 5/207 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT RI   LDRHLVFPLLEFL  + +Y ++++L+ K++LL++TNMVD+AMD++K+L
Sbjct  2    AEFDLTSRIGQYLDRHLVFPLLEFLSVKAIYEEQEMLQGKLDLLSETNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANA---VQELRADKQHNLQLLND  412
            +   +VP ++ D+R EVV+ LK L+    P+V+   +      VQ  R D +     L  
Sbjct  62   HPEIEVPLQLRDKRQEVVSELKKLQGETEPIVKIFDDPEVNTQVQNTR-DGRQLFDYLAK  120

Query  413  RYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILM  589
             +   PE ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +D+ +LS+LWGKLA+EILM
Sbjct  121  SHGFVPEMLDTLYRYAKFQYECGNYSGAAEYLYFHRVLVLPNDKNALSSLWGKLASEILM  180

Query  590  QNWDIALEELNRLKEIIDSKSFSTPLH  670
            QNW+ ALE+LNRLK++IDS +F TPL 
Sbjct  181  QNWEAALEDLNRLKDVIDSNAFVTPLQ  207



>gb|ACO08955.1| Eukaryotic translation initiation factor 3 subunit 6 [Osmerus 
mordax]
Length=445

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L  K++LL++TNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLHGKLDLLSETNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L ++
Sbjct  62   FPDKEIPHSLREKRTTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNSVSSPL  206



>ref|XP_010742024.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Larimichthys crocea]
Length=441

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 151/200 (76%), Gaps = 3/200 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    ADYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YADKEIPHSLREKRSTVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKS  652
            NW+ A+E+L RL+E ID+ S
Sbjct  182  NWEAAMEDLTRLRETIDNNS  201



>gb|EFX82001.1| hypothetical protein DAPPUDRAFT_302804 [Daphnia pulex]
Length=440

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 149/205 (73%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT ++   LD+HLVFPL EFL  + +Y + ++L+AK++LL+ TNMVD+AMD+HK+L
Sbjct  2    AEHDLTSKLGNYLDQHLVFPLFEFLAVQGIYKENELLRAKLDLLSKTNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +++P  + D+R  VV +LK ++    P++    N    +++++  D +  L  L   
Sbjct  62   YPDQEIPPTLKDKRTVVVEQLKKMQAETEPILAMFMNPEVTRQIQSSRDSRQLLDYLTKN  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS-LSALWGKLAAEILMQ  592
            + + PE ++ LY +AKFQ+ECGNYSGAA+YL+ +R L T +D++ L+ LWGKLA+EILMQ
Sbjct  122  HGLKPEMLDKLYLFAKFQYECGNYSGAAEYLHFHRFLVTPNDKNYLNGLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD ALE+LNRLKE IDS +F+TPL
Sbjct  182  NWDTALEDLNRLKEYIDSNTFNTPL  206



>ref|XP_007254559.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E-A-like [Astyanax mexicanus]
Length=452

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 154/212 (73%), Gaps = 10/212 (5%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y + ++L  K++LL+DTNMVD+AMD++KSL
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNETELLHGKLDLLSDTNMVDFAMDVYKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADK-------QHNLQ  400
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +       Q  L 
Sbjct  62   YLDKEIPNSLREKRTAVVAQLKQLQSETEPIVKIFEDPETTRQMQSTRXAYITCXQIILS  121

Query  401  LLNDRYQIGPEQ--IEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKL  571
            L+N  + +   Q  ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKL
Sbjct  122  LINQSHSLAFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKL  181

Query  572  AAEILMQNWDIALEELNRLKEIIDSKSFSTPL  667
            A+EILMQNW+ A+E+L RL+E ID+ + S+PL
Sbjct  182  ASEILMQNWEAAMEDLTRLRETIDNNTVSSPL  213



>ref|XP_007543240.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X2 [Poecilia formosa]
Length=407

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L+++
Sbjct  62   YPDKEIPHSLREKRSNVVAQLKQLQSETEPIVKMFEDPETTRQMQSTRDGRMLFDYLSEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L  ++DR +LS+LWGKLA+EILMQ
Sbjct  122  HNFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPSTDRNALSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKS  652
            NW+ A+E+L RL+E +D+ S
Sbjct  182  NWEAAMEDLTRLRETVDNNS  201



>ref|XP_011399162.1| Eukaryotic translation initiation factor 3 subunit E [Auxenochlorella 
protothecoides]
 gb|KFM26266.1| Eukaryotic translation initiation factor 3 subunit E [Auxenochlorella 
protothecoides]
Length=438

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +2

Query  65   KYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLY  244
            +YDLT  +A  LDRHLVFPLLEFL ++QLY  EDI  AK+EL+  TNMVDYA+DI++ L 
Sbjct  19   QYDLTTVVAKSLDRHLVFPLLEFLSQKQLYPAEDIESAKLELIEKTNMVDYAVDIYQGLN  78

Query  245  HTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQI  424
             T++VP  +V RR EVV +L+ LE     +  FL NA+ V+ L+ DK  N   L   + I
Sbjct  79   QTDEVPDSLVARRQEVVNKLRTLEGQVKTITDFLSNADNVRLLKQDKTQNQAFLQSEFGI  138

Query  425  GPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWDI  604
            GP+Q++ALY  AK+ FECGNYS AA+YL+ YR+L T+ DR +SALWGK+AA+IL+Q+++ 
Sbjct  139  GPDQVDALYHLAKWNFECGNYSAAAEYLHHYRSLSTHPDRCVSALWGKVAADILLQDFEA  198

Query  605  ALE  613
            A+E
Sbjct  199  AME  201



>gb|ACO08499.1| Eukaryotic translation initiation factor 3 subunit 6 [Oncorhynchus 
mykiss]
Length=445

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 152/205 (74%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  ++ Y ++++L  K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKETYNEKELLHGKLDLLSETNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            +  +++P  + ++R+ VVA+LK L+    P+V+  ++    +++++  D Q     L ++
Sbjct  62   FPEKEIPATLKEKRITVVAQLKQLQGETEPIVKMFEDPETTKQMQSTRDGQALFNYLAEK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R     +DR +L++LWGKLA+EILMQ
Sbjct  122  HSFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVPVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ S S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNDSVSSPL  206



>gb|AAC51917.1| mammary tumor-associated protein INT6 [Homo sapiens]
Length=445

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 150/206 (73%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L  K++ L+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLXGKLDXLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+LK  +    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQXQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +LS+LWGKLA+  LMQ
Sbjct  121  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRXALSSLWGKLASXXLMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>gb|AAT68096.1| eukaryotic translation initiation factor 3 subunit 6 [Danio rerio]
Length=446

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 152/205 (74%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y + ++L  K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEHELLHGKLDLLSDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   FPDKEIPNSLREKRTTVVAQLKQLQSETEPIVKVFEDPETTRQMQSTRDGRMLFDYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ + S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPL  206



>ref|NP_957133.1| eukaryotic translation initiation factor 3 subunit E-A [Danio 
rerio]
 sp|Q6DRI1.2|EI3EA_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-A; Short=eIF3e-A; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-A [Danio rerio]
 gb|AAH61454.1| Eukaryotic translation initiation factor 3, subunit E, a [Danio 
rerio]
Length=446

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 152/205 (74%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y + ++L  K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEHELLHGKLDLLSDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            +  +++P  + ++R  VVA+LK L+    P+V+  ++    +++++ +   +    L D+
Sbjct  62   FPDKEIPNSLREKRTTVVAQLKQLQSETEPIVKVFEDPETTRQMQSTRDGRMLFDYLADK  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR +L++LWGKLA+EILMQ
Sbjct  122  HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ A+E+L RL+E ID+ + S+PL
Sbjct  182  NWEAAMEDLTRLRETIDNNTVSSPL  206



>ref|XP_003219492.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Anolis carolinensis]
Length=445

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 152/206 (74%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DT MVD+AMDI+K+L
Sbjct  2    ADYDLTTRIARFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTKMVDFAMDIYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y ++D+P  + ++R  VVA+L+ L+    P+V+  ++    +++++  D +     L D+
Sbjct  62   Y-SDDIPHALREKRTTVVAQLEQLKAETDPIVKMFEDPETTRQMQSTRDGRMLFDYLADK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E ++ LY+YAK Q+ECGNY GAA+YLY +R L  ++DR +LS+LWGKLA+EIL+Q
Sbjct  121  HGFRQEYLDTLYRYAKIQYECGNYPGAAEYLYLFRVLVPSTDRNALSSLWGKLASEILVQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NWDAAMEDLTRLKETIDNNSVSSPLQ  206



>ref|XP_002609740.1| hypothetical protein BRAFLDRAFT_114473 [Branchiostoma floridae]
 gb|EEN65750.1| hypothetical protein BRAFLDRAFT_114473 [Branchiostoma floridae]
Length=436

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+   LDRHLVFPLLEFL  + +Y + ++LK K++LL++TNMVD+AMD+ KSL
Sbjct  2    AEWDLTTRMGQYLDRHLVFPLLEFLSVKGIYDEHELLKGKLDLLSNTNMVDFAMDVWKSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +DVP  +V +R EVV +LK L+    P+V+  ++    +++++  D +     L   
Sbjct  62   YPDQDVPDSLVQKRQEVVGQLKFLQAECEPIVKIFEDPEVARQIQSTRDGRQLFDYLARN  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    + ++ LY YAKFQ+ECGNYSGAA+YLY +R L  + D+ ++++LWGKLA+EILMQ
Sbjct  122  HGFESKMVDTLYDYAKFQYECGNYSGAAEYLYFHRVLVPSDDKNAMNSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NWD A+E+LNRLK++ID  +F+  L 
Sbjct  182  NWDPAMEDLNRLKDVIDGSTFTNQLQ  207



>ref|XP_008640866.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Corvus brachyrhynchos]
 ref|XP_008921429.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Manacus vitellinus]
Length=462

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 156/223 (70%), Gaps = 21/223 (9%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQE-----------------MVDRRVEVVARLKALEEAAAPLVQFLQNANAVQE  370
            Y ++++P E                 + ++R  VVA+LK L+    P+V+  ++    ++
Sbjct  62   Y-SDEIPHESTEVGDNFSLLEHFLSALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQ  120

Query  371  LRADKQHNLQL--LNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR  544
            +++ +   +    L +++    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR
Sbjct  121  MQSTRDGRMLFDYLAEKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDR  180

Query  545  -SLSALWGKLAAEILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
             +LS+LWGKLA+EILMQNWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQ  223



>ref|XP_011454873.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Crassostrea gigas]
 gb|EKC40779.1| Eukaryotic translation initiation factor 3 subunit E [Crassostrea 
gigas]
Length=438

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT R+   LDRHLVFPLLEFL  ++LY ++++LK K++LL++TNMVD+AMD+HK+L
Sbjct  2    AEFDLTTRMGQYLDRHLVFPLLEFLSVKELYDEKEMLKGKLDLLSNTNMVDFAMDVHKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  +DVP  +  +R +VVA+LK+L+     + +  ++   V+++++  D +   + LN  
Sbjct  62   YPDQDVPNSLKGKRQDVVAQLKSLQAETELITKIFEDPEVVRQMQSSRDGRQLYEFLNKE  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS-LSALWGKLAAEILMQ  592
            +      ++ LY YAKFQ+ECGNYSGAA+YLY  R L  ++D   L A+WGKLA+EILMQ
Sbjct  122  HGFEASMVDTLYTYAKFQYECGNYSGAAEYLYFVRVLLPSTDSHFLDAMWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            NW+ AL++L +LK+IIDS  F + L 
Sbjct  182  NWETALDDLQKLKDIIDSNPFGSALQ  207



>ref|XP_009140765.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Brassica rapa]
 ref|XP_009140766.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Brassica rapa]
 ref|XP_009140767.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Brassica rapa]
 ref|XP_009140768.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Brassica rapa]
Length=182

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 107/135 (79%), Gaps = 14/135 (10%)
 Frame = +2

Query  104  RHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSLYHTEDVPQEMVDRR  283
            RHLVFP+LEFLQE QLY DE ILK KIELLN TNMVDYAMDIHKSL HTED PQ+M    
Sbjct  49   RHLVFPILEFLQEHQLYPDEQILKFKIELLNKTNMVDYAMDIHKSLDHTEDAPQDM----  104

Query  284  VEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQIGPEQIEALYQYAK  463
                      EEAAA LV FL N NAVQELR DK++NLQ+L +RYQIGP+QIEAL QYAK
Sbjct  105  ----------EEAAALLVTFLLNPNAVQELRGDKKYNLQMLKERYQIGPDQIEALNQYAK  154

Query  464  FQFECGNYSGAADYL  508
            FQFECGNYSGAADYL
Sbjct  155  FQFECGNYSGAADYL  169



>ref|XP_782397.3| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Strongylocentrotus purpuratus]
Length=458

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 151/205 (74%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT +I   LDRHLVFPLLEFL  +++Y ++D+L+ K++LL++TNMVD+AMD++K+L
Sbjct  2    AEFDLTAKIGQYLDRHLVFPLLEFLSVQEIYDEKDMLQGKLDLLSNTNMVDFAMDVYKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
               ++VPQ + ++R +VV +LK L++   P+++  +NA+  + +++  D +   + L   
Sbjct  62   NEDQEVPQTLKEKRADVVNQLKRLQQDTEPIIEIFENADVREHIQSARDSRQLFEYLEKN  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSD-RSLSALWGKLAAEILMQ  592
            +    + +  LY YAKFQ++CGNYSGA++YLY +R L   SD +S S+LWGKLA+EILMQ
Sbjct  122  HGFKHDNLSLLYDYAKFQYDCGNYSGASEYLYFHRTLVPPSDPKSTSSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NW+ ALE+LN+L+E+ID   F TPL
Sbjct  182  NWEGALEDLNKLQEVIDPSHFITPL  206



>gb|KIJ53523.1| hypothetical protein M422DRAFT_64535 [Sphaerobolus stellatus 
SS14]
Length=459

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 134/200 (67%), Gaps = 0/200 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
             +YDLT  + P LDRHL FPLL  L E  ++  E ++KA+ EL   TNMVDY++++ + L
Sbjct  2    TEYDLTQTVIPYLDRHLAFPLLTHLTETSIFPVEQLIKAQYELTKGTNMVDYSVNLFEQL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            Y   DVP E   +R  VV+  + LE  A  +++ +QN    Q LR DK+ NLQ L D Y 
Sbjct  62   YPDTDVPAEFAQKRETVVSTNERLENEAQSVLEIIQNPEVAQALRQDKRQNLQYLKDHYG  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            +  EQI  LY++ +FQF CGNYS A+DYLY +R L T++D +LSA WGKLA++IL   WD
Sbjct  122  LTLEQITVLYKFGQFQFTCGNYSSASDYLYHFRVLSTDADLNLSAHWGKLASDILTGRWD  181

Query  602  IALEELNRLKEIIDSKSFST  661
             ALEELN L+E+IDS+S +T
Sbjct  182  KALEELNSLRELIDSRSVTT  201



>gb|EHB17733.1| Eukaryotic translation initiation factor 3 subunit E [Heterocephalus 
glaber]
Length=279

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 146/210 (70%), Gaps = 4/210 (2%)
 Frame = +2

Query  47   SASMAAKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMD  226
            S+   A+YDLT  +A  LDRHLVF LLEFL  + +Y ++++L+ K++LL+DTNMVD+AMD
Sbjct  12   SSVKVAEYDLTTHMAHFLDRHLVFLLLEFLSVKGIYNEKELLQGKLDLLSDTNMVDFAMD  71

Query  227  IHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQ  400
            ++K LY ++D+P  +  +R  VVA+LK L+    P+V+  ++    +++++  D      
Sbjct  72   VYKMLY-SDDIPHSLRKKRTTVVAQLKQLQAETEPVVKMFEDKERTRQMQSTRDGWMLFD  130

Query  401  LLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAA  577
             L D++    E +  LY+YAKFQ+ECGNYSGAA YLY +R L   +DR +LS+LW KLA 
Sbjct  131  YLADKHGFRQEYLNTLYRYAKFQYECGNYSGAAGYLYLFRVLVPATDRNALSSLWEKLAY  190

Query  578  EILMQNWDIALEELNRLKEIIDSKSFSTPL  667
            EILMQNW  A+E+L  LKEIID+ S S+PL
Sbjct  191  EILMQNWGAAMEDLTCLKEIIDNNSVSSPL  220



>ref|XP_005507309.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Columba livia]
Length=462

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 156/223 (70%), Gaps = 21/223 (9%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQE-----------------MVDRRVEVVARLKALEEAAAPLVQFLQNANAVQE  370
            Y ++++P +                 + ++R  VVA+LK L+    P+V+  ++    ++
Sbjct  62   Y-SDEIPHDSSEVGDSFSLLEHFLSALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQ  120

Query  371  LRADKQHNLQL--LNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR  544
            +++ +   +    L +++    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR
Sbjct  121  MQSTRDGRMLFDYLAEKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDR  180

Query  545  -SLSALWGKLAAEILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
             +LS+LWGKLA+EILMQNWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQ  223



>ref|XP_010575299.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Haliaeetus leucocephalus]
Length=462

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 156/223 (70%), Gaps = 21/223 (9%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT +IA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTKIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQE-----------------MVDRRVEVVARLKALEEAAAPLVQFLQNANAVQE  370
            Y ++++P +                 + ++R  VVA+LK L+    P+V+  ++    ++
Sbjct  62   Y-SDEIPHDSSEVGDNVSLLERFLSALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQ  120

Query  371  LRADKQHNLQL--LNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR  544
            +++ +   +    L +++    E ++ LY+YAKFQ+ECGNYSGAA+YLY +R L   +DR
Sbjct  121  MQSTRDGRMLFDYLAEKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDR  180

Query  545  -SLSALWGKLAAEILMQNWDIALEELNRLKEIIDSKSFSTPLH  670
             +LS+LWGKLA+EILMQNWD A+E+L RLKE ID+ S S+PL 
Sbjct  181  NALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQ  223



>ref|XP_002130084.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X2 [Ciona intestinalis]
Length=445

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 141/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT ++   LDRHLVFPLLEFL ER ++ + D+ K K+ELL++TNMVD+AMD+HK+L
Sbjct  2    AQFDLTSKVGCYLDRHLVFPLLEFLSERDIFDERDLHKGKLELLSNTNMVDFAMDVHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  E++P  + D+R  VV+ LK+      P+V   +     +++    D +   + L   
Sbjct  62   YPGEEIPSSLRDKRNNVVSLLKSYTVKTEPIVHIFEQDEVRKQIETTRDGKQLFEYLEKN  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSD-RSLSALWGKLAAEILMQ  592
            +    E ++ LY YAKFQ+ECGNYSGAA+YLY +R L    D R++ +LWGKLA+EILMQ
Sbjct  122  HNFKLEDLDTLYDYAKFQYECGNYSGAAEYLYFHRVLVQPDDKRAMDSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            +WD A E+L+RL+E IDS + ++PL
Sbjct  182  DWDTAWEDLHRLQESIDSNTIASPL  206



>ref|XP_004340264.1| eukaryotic translation initiation factor 3 subunit E, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR18244.1| eukaryotic translation initiation factor 3 subunit E, putative 
[Acanthamoeba castellanii str. Neff]
Length=431

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 141/206 (68%), Gaps = 11/206 (5%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQER----------QLYADEDILKAKIELLNDTNMV  211
            AKYDLT  IA  LDRHLVFPL+EFL+E           ++Y ++++L A+++LL++TNMV
Sbjct  2    AKYDLTQTIATYLDRHLVFPLIEFLKENRALKSSSSLNKIYGEKELLSAQLDLLSNTNMV  61

Query  212  DYAMDIHKSLYHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQH  391
            D+AMDIH+ L+ TE  P     +R  V+ARLK L    APLV+ LQ+   V EL+ +K +
Sbjct  62   DFAMDIHRKLHETEP-PATFATKRAAVLARLKELNALCAPLVRLLQDQTKVAELKEEKNY  120

Query  392  NLQLLNDRYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKL  571
            N++ + +   +    ++ LY+ AKFQFECGNYSGAAD+LY +R L  ++++  +ALWGK 
Sbjct  121  NIEFIQENLGVPAGCLDHLYESAKFQFECGNYSGAADFLYHFRTLSNDAEKKFNALWGKF  180

Query  572  AAEILMQNWDIALEELNRLKEIIDSK  649
            AAEILM  W  A+E+L  LKE I++K
Sbjct  181  AAEILMLKWTTAIEDLKALKEAIEAK  206



>ref|XP_004226360.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X1 [Ciona intestinalis]
Length=470

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 141/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A++DLT ++   LDRHLVFPLLEFL ER ++ + D+ K K+ELL++TNMVD+AMD+HK+L
Sbjct  2    AQFDLTSKVGCYLDRHLVFPLLEFLSERDIFDERDLHKGKLELLSNTNMVDFAMDVHKTL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  E++P  + D+R  VV+ LK+      P+V   +     +++    D +   + L   
Sbjct  62   YPGEEIPSSLRDKRNNVVSLLKSYTVKTEPIVHIFEQDEVRKQIETTRDGKQLFEYLEKN  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSD-RSLSALWGKLAAEILMQ  592
            +    E ++ LY YAKFQ+ECGNYSGAA+YLY +R L    D R++ +LWGKLA+EILMQ
Sbjct  122  HNFKLEDLDTLYDYAKFQYECGNYSGAAEYLYFHRVLVQPDDKRAMDSLWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            +WD A E+L+RL+E IDS + ++PL
Sbjct  182  DWDTAWEDLHRLQESIDSNTIASPL  206



>ref|XP_005662958.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Sus scrofa]
Length=484

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 153/245 (62%), Gaps = 43/245 (18%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  +++Y ++++L+ K++LL+DTNMVD+AMD++K+L
Sbjct  2    AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLND---  412
            Y ++D+P  + ++R  VVA+LK L+    P+V+  ++    +++++ +    Q L     
Sbjct  62   Y-SDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRWAICQCLETFLV  120

Query  413  --------------------------------------RYQIGPEQIEALYQYAKFQFEC  478
                                                  R     E ++ LY+YAKFQ+EC
Sbjct  121  VTTGEVLLVSNQESPGILLYILEFICLYPTSPKRMTQPRISFRQEYLDTLYRYAKFQYEC  180

Query  479  GNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQNWDIALEELNRLKEIIDSKSF  655
            GNYSGAA+YLY +R L   +DR +LS+LWGKLA+EILMQNWD A+E+L RLKE ID+ S 
Sbjct  181  GNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSV  240

Query  656  STPLH  670
            S+PL 
Sbjct  241  SSPLQ  245



>ref|XP_007427485.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Python bivittatus]
Length=445

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 154/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT RIA  LDRHLVFPLLEFL  + +Y ++++L+ K++LL+DTNMVD+AMD++++L
Sbjct  2    AEYDLTNRIAHFLDRHLVFPLLEFLSVKGIYDEKELLQGKLDLLDDTNMVDFAMDVYRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQL--LNDR  415
            Y ++D+P  + ++R  VVA+L+ L+E   P+V+  ++     ++++ +   +    L ++
Sbjct  62   Y-SDDIPHALREKRNTVVAQLQLLQEEMDPIVKMFEDKETTLQMQSTRDGRVLFDYLAEK  120

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDR-SLSALWGKLAAEILMQ  592
            +    E +++LY++AKFQ++CGNY+ A++YLY +R L  ++DR +LS+LWGKLA+ ILMQ
Sbjct  121  HGFRQEYLDSLYRFAKFQYKCGNYTAASEYLYLFRVLVPSTDRNALSSLWGKLASGILMQ  180

Query  593  NWDIALEELNRLKEIIDSKSFSTPLH  670
            +WD A+E+L RLKE ID+ S S+PL 
Sbjct  181  DWDAAMEDLTRLKETIDNSSVSSPLQ  206



>ref|XP_005098426.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Aplysia californica]
Length=367

 Score =   197 bits (500),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 142/205 (69%), Gaps = 3/205 (1%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            AK+DLT  +   LDRHLVFPLLEFL  + LY ++++L  K++LL++TNMVD+AMD+H++L
Sbjct  2    AKFDLTTTLGQYLDRHLVFPLLEFLTVKGLYEEKEMLLGKLDLLSNTNMVDFAMDVHRNL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRA--DKQHNLQLLNDR  415
            Y  + VP  + D+R +VV++LK L+     + +   +    +++++  D +    LL+  
Sbjct  62   YPDQSVPTTLKDKRQDVVSQLKDLQSKTNIITEIFDSPEVQRQIQSSRDGRQLYDLLSKE  121

Query  416  YQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS-LSALWGKLAAEILMQ  592
            Y    E I  LY YAKFQ+ECGNYS  A+YLY  R L   SDR+ LS+ WGKLA+EILMQ
Sbjct  122  YGFKHEMINTLYDYAKFQYECGNYSATAEYLYFVRVLIPPSDRNFLSSCWGKLASEILMQ  181

Query  593  NWDIALEELNRLKEIIDSKSFSTPL  667
            NWD AL++LN++K++ID  SF++ L
Sbjct  182  NWDYALDDLNKVKDLIDGNSFASDL  206



>gb|EPS98504.1| eukaryotic translation initiation factor 3 subunit 6 [Fomitopsis 
pinicola FP-58527 SS1]
Length=462

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 133/201 (66%), Gaps = 0/201 (0%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A+YDLT  + P  DRHLVFPLL  L E +L+  E++ KA+ EL  +TNMVDYA+ + + L
Sbjct  2    AEYDLTRTVIPHCDRHLVFPLLAHLVENELFPAEEVQKAQYELAKETNMVDYAVSLFEQL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQNANAVQELRADKQHNLQLLNDRYQ  421
            +  E VP+E   +R   ++  + L++ A  ++  + N    Q LR DK  NLQ L + Y 
Sbjct  62   HPEESVPEEFAGKRENALSTNERLQQEAQAVLDVITNPEVAQSLRQDKNQNLQYLKEHYN  121

Query  422  IGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRSLSALWGKLAAEILMQNWD  601
            +  EQI ALY + +FQ+  GNYSGAADYLY +R L T+ D ++SA WGKLA++IL   WD
Sbjct  122  VTLEQINALYNFGQFQYSYGNYSGAADYLYHFRVLSTDPDLTMSAHWGKLASDILTGKWD  181

Query  602  IALEELNRLKEIIDSKSFSTP  664
            +ALEELN L+E IDS+S S P
Sbjct  182  VALEELNTLREAIDSRSPSVP  202



>gb|ELT88021.1| hypothetical protein CAPTEDRAFT_159549 [Capitella teleta]
Length=439

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = +2

Query  62   AKYDLTPRIAPQLDRHLVFPLLEFLQERQLYADEDILKAKIELLNDTNMVDYAMDIHKSL  241
            A +DLT  +   LDRHLVFPLLEFL  +Q+Y + ++ K K++LL  TNMVD+AMD+H+SL
Sbjct  2    AAFDLTTSMGKYLDRHLVFPLLEFLSNKQIYDETEMQKGKLDLLKSTNMVDFAMDVHRSL  61

Query  242  YHTEDVPQEMVDRRVEVVARLKALEEAAAPLVQFLQN---ANAVQELRADKQHNLQLLND  412
            Y  ++VP+ + ++R +V++ LK L     P+ + L+    ++ +Q  R D +     L +
Sbjct  62   YPDQEVPESLQEKRTQVLSELKGLTVETEPVSRILEKEEVSSMIQSTR-DGRTLFNFLTE  120

Query  413  RYQIGPEQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSDRS-LSALWGKLAAEILM  589
            ++      +E LY+Y+KFQ+ECGNYSGAA+YLY  RAL    +++ ++ALWGKLA+EILM
Sbjct  121  KHGFNDGMLETLYKYSKFQYECGNYSGAAEYLYFVRALLPPGNKNYMNALWGKLASEILM  180

Query  590  QNWDIALEELNRLKEIIDS  646
            QNWD ALE+LNRL+E+ID+
Sbjct  181  QNWDAALEDLNRLREVIDN  199



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780