BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033B05

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    179   3e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    177   9e-48   Solanum tuberosum [potatoes]
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   176   2e-47   Citrus sinensis [apfelsine]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             176   2e-47   Citrus clementina [clementine]
gb|KJB29842.1|  hypothetical protein B456_005G120900                    175   4e-47   Gossypium raimondii
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    174   8e-47   Nicotiana sylvestris
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    174   1e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    174   1e-46   Vitis vinifera
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    174   1e-46   
emb|CBI15804.3|  unnamed protein product                                174   1e-46   Vitis vinifera
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...    173   2e-46   Glycine max [soybeans]
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    173   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    172   4e-46   Prunus mume [ume]
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    172   4e-46   
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             172   5e-46   
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    172   7e-46   
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    172   7e-46   Cucumis sativus [cucumbers]
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    171   1e-45   Solanum lycopersicum
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    170   2e-45   Glycine max [soybeans]
gb|KHN40609.1|  Putative inactive receptor kinase                       170   2e-45   Glycine soja [wild soybean]
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             170   3e-45   Citrus clementina [clementine]
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             170   3e-45   
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   170   3e-45   Citrus sinensis [apfelsine]
ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    170   3e-45   Nicotiana tomentosiformis
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   170   4e-45   Citrus sinensis [apfelsine]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   170   4e-45   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             170   4e-45   Citrus clementina [clementine]
ref|XP_002319979.1|  putative plant disease resistance family pro...    169   6e-45   Populus trichocarpa [western balsam poplar]
ref|XP_006371315.1|  putative plant disease resistance family pro...    169   6e-45   
gb|KJB71491.1|  hypothetical protein B456_011G125200                    169   7e-45   Gossypium raimondii
gb|KHG17391.1|  hypothetical protein F383_22576                         169   8e-45   Gossypium arboreum [tree cotton]
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             169   8e-45   
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    168   1e-44   Populus euphratica
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    168   1e-44   Cucumis melo [Oriental melon]
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g             167   2e-44   Phaseolus vulgaris [French bean]
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    167   2e-44   Nicotiana sylvestris
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    167   2e-44   Solanum lycopersicum
ref|XP_010094441.1|  putative inactive receptor kinase                  167   3e-44   Morus notabilis
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    167   3e-44   
gb|KEH34523.1|  LRR receptor-like kinase                                167   3e-44   Medicago truncatula
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    167   3e-44   Nicotiana sylvestris
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    167   4e-44   Solanum tuberosum [potatoes]
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    167   5e-44   Nicotiana tomentosiformis
gb|AAL76166.1|AF348333_1  candidate plant disease resistance protein    158   8e-44   Glycine max [soybeans]
ref|XP_010098027.1|  putative inactive receptor kinase                  166   8e-44   
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...    166   9e-44   Eucalyptus grandis [rose gum]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    166   9e-44   
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    164   3e-43   
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    164   3e-43   Populus euphratica
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    164   4e-43   Populus euphratica
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    164   4e-43   
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    164   4e-43   Populus euphratica
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    164   4e-43   
gb|EEE64112.1|  hypothetical protein OsJ_18944                          164   5e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055854.1|  Os05g0480400                                       164   5e-43   
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    164   5e-43   Cucumis sativus [cucumbers]
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    163   7e-43   Sesamum indicum [beniseed]
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    163   7e-43   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    163   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    162   1e-42   Sesamum indicum [beniseed]
gb|KEH23299.1|  LRR receptor-like kinase                                162   1e-42   Medicago truncatula
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    162   2e-42   Oryza brachyantha
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    162   2e-42   Nicotiana tomentosiformis
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     161   3e-42   
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    161   3e-42   Nicotiana sylvestris
dbj|BAK08005.1|  predicted protein                                      159   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    161   4e-42   Theobroma cacao [chocolate]
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    161   4e-42   
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             160   8e-42   Phaseolus vulgaris [French bean]
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    160   9e-42   
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   160   9e-42   Citrus sinensis [apfelsine]
ref|XP_002325632.1|  putative plant disease resistance family pro...    160   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002520893.1|  Receptor protein kinase CLAVATA1 precursor, ...    160   1e-41   
emb|CDP13882.1|  unnamed protein product                                160   1e-41   Coffea canephora [robusta coffee]
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    160   1e-41   
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   Populus euphratica
gb|EYU36891.1|  hypothetical protein MIMGU_mgv1a0177022mg               156   1e-41   Erythranthe guttata [common monkey flower]
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...    159   1e-41   Populus euphratica
gb|EMT17815.1|  Putative inactive receptor kinase                       159   1e-41   
gb|KEH35517.1|  receptor-like kinase                                    159   2e-41   Medicago truncatula
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    159   2e-41   Populus euphratica
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    159   3e-41   Glycine max [soybeans]
gb|KJB20519.1|  hypothetical protein B456_003G153000                    157   3e-41   Gossypium raimondii
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    159   3e-41   Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    159   3e-41   Glycine max [soybeans]
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    159   3e-41   Glycine max [soybeans]
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             158   4e-41   Citrus clementina [clementine]
gb|KDP45679.1|  hypothetical protein JCGZ_17286                         158   4e-41   Jatropha curcas
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             158   4e-41   Citrus clementina [clementine]
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    158   4e-41   Cicer arietinum [garbanzo]
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    158   4e-41   Cicer arietinum [garbanzo]
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    158   4e-41   Sesamum indicum [beniseed]
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             158   5e-41   
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    158   5e-41   
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             158   5e-41   Eutrema salsugineum [saltwater cress]
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    158   6e-41   Glycine max [soybeans]
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    158   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    157   9e-41   
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...    157   9e-41   Solanum tuberosum [potatoes]
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    157   9e-41   
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    157   1e-40   
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    157   1e-40   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    157   1e-40   Glycine max [soybeans]
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             157   1e-40   Phaseolus vulgaris [French bean]
gb|EMT10528.1|  Putative inactive receptor kinase                       157   1e-40   
gb|KHG05843.1|  hypothetical protein F383_32232                         157   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010109178.1|  putative inactive receptor kinase                  156   2e-40   
gb|KJB20517.1|  hypothetical protein B456_003G153000                    156   2e-40   Gossypium raimondii
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    156   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    156   3e-40   Setaria italica
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     155   4e-40   Ricinus communis
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    155   4e-40   Brassica rapa
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          155   4e-40   Arabidopsis lyrata subsp. petraea
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    155   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX88667.1|  BnaA03g09820D                                          155   5e-40   
ref|XP_002864562.1|  predicted protein                                  155   5e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    155   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    155   6e-40   Nicotiana sylvestris
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    155   7e-40   
emb|CDY58565.1|  BnaC03g12450D                                          155   8e-40   Brassica napus [oilseed rape]
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     154   8e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    154   9e-40   
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    154   1e-39   Fragaria vesca subsp. vesca
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg                154   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    153   3e-39   Phoenix dactylifera
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    153   3e-39   Medicago truncatula
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    152   4e-39   Elaeis guineensis
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             152   5e-39   Phaseolus vulgaris [French bean]
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    152   6e-39   Sesamum indicum [beniseed]
gb|EPS58213.1|  hypothetical protein M569_16602                         151   7e-39   Genlisea aurea
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    151   2e-38   Fragaria vesca subsp. vesca
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    150   2e-38   Cicer arietinum [garbanzo]
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...    150   2e-38   Tarenaya hassleriana [spider flower]
gb|KHN40011.1|  Putative inactive receptor kinase                       149   2e-38   Glycine soja [wild soybean]
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    150   3e-38   Phoenix dactylifera
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    150   3e-38   Elaeis guineensis
ref|XP_006842563.1|  hypothetical protein AMTR_s00077p00144650          147   4e-38   
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    149   6e-38   Brachypodium distachyon [annual false brome]
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    149   6e-38   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          149   8e-38   Sorghum bicolor [broomcorn]
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    149   8e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    149   8e-38   Oryza brachyantha
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...    149   9e-38   Glycine max [soybeans]
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             149   9e-38   Zea mays [maize]
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    149   9e-38   
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...    149   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    149   1e-37   Glycine max [soybeans]
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    149   1e-37   Glycine max [soybeans]
dbj|BAB62593.1|  putative receptor-like protein kinase                  147   2e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05160.1|  hypothetical protein OsI_27356                          147   3e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001060650.1|  Os07g0681100                                       147   3e-37   
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    147   4e-37   Oryza brachyantha
gb|KDP21623.1|  hypothetical protein JCGZ_03294                         147   4e-37   Jatropha curcas
gb|KHN25793.1|  Putative inactive receptor kinase                       147   4e-37   Glycine soja [wild soybean]
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    146   6e-37   Setaria italica
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    146   6e-37   
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...    146   6e-37   Solanum lycopersicum
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...    146   6e-37   
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    146   8e-37   Brassica rapa
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    146   9e-37   
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...    145   1e-36   
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    145   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP06375.1|  unnamed protein product                                145   2e-36   Coffea canephora [robusta coffee]
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    145   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    145   2e-36   Phoenix dactylifera
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...    145   2e-36   
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                     144   3e-36   Eucalyptus grandis [rose gum]
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    144   3e-36   
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    144   3e-36   
emb|CDY32713.1|  BnaA02g07750D                                          144   3e-36   Brassica napus [oilseed rape]
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...    144   4e-36   
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    145   4e-36   Phoenix dactylifera
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    144   5e-36   Elaeis guineensis
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    144   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    144   6e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    144   8e-36   Elaeis guineensis
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             143   9e-36   Prunus persica
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    143   1e-35   
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    143   1e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...    142   2e-35   Brassica rapa
gb|AAL09719.1|  AT3g08680/F17O14_15                                     139   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g             140   8e-35   Phaseolus vulgaris [French bean]
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...    140   1e-34   Fragaria vesca subsp. vesca
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    140   1e-34   Malus domestica [apple tree]
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     140   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    140   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    140   2e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...    139   2e-34   Brassica rapa
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    139   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    139   3e-34   Prunus mume [ume]
ref|XP_008813231.1|  PREDICTED: probable inactive receptor kinase...    137   4e-34   
emb|CDY35996.1|  BnaA05g29540D                                          138   5e-34   Brassica napus [oilseed rape]
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...    139   6e-34   Tarenaya hassleriana [spider flower]
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...    137   9e-34   Setaria italica
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...    138   1e-33   
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    137   2e-33   Phoenix dactylifera
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             137   2e-33   Eutrema salsugineum [saltwater cress]
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                136   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_010055829.1|  PREDICTED: probable inactive receptor kinase...    135   4e-33   Eucalyptus grandis [rose gum]
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             135   5e-33   
emb|CDY27986.1|  BnaC05g43880D                                          135   5e-33   Brassica napus [oilseed rape]
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    135   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             135   9e-33   Zea mays [maize]
gb|KDP21848.1|  hypothetical protein JCGZ_00635                         135   1e-32   Jatropha curcas
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    135   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...    134   1e-32   Nicotiana tomentosiformis
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             134   2e-32   Capsella rubella
gb|KHF99691.1|  hypothetical protein F383_18108                         134   2e-32   Gossypium arboreum [tree cotton]
ref|XP_002509916.1|  ATP binding protein, putative                      133   2e-32   
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...    134   3e-32   Nicotiana sylvestris
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...    133   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570          133   4e-32   Sorghum bicolor [broomcorn]
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...    133   4e-32   Populus euphratica
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...    133   5e-32   Populus euphratica
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    133   5e-32   Brachypodium distachyon [annual false brome]
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    132   8e-32   
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...    132   1e-31   
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    132   1e-31   Solanum tuberosum [potatoes]
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...    132   1e-31   Cucumis sativus [cucumbers]
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    132   1e-31   
ref|NP_001050019.1|  Os03g0332900                                       132   1e-31   
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    132   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    131   2e-31   Pyrus x bretschneideri [bai li]
gb|KJB67957.1|  hypothetical protein B456_010G219700                    131   2e-31   Gossypium raimondii
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    129   3e-31   
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...    130   3e-31   
gb|KDP25339.1|  hypothetical protein JCGZ_20495                         130   4e-31   Jatropha curcas
ref|XP_010452417.1|  PREDICTED: probable leucine-rich repeat rece...    130   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          130   7e-31   Sorghum bicolor [broomcorn]
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...    129   7e-31   Sesamum indicum [beniseed]
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg             129   9e-31   Eutrema salsugineum [saltwater cress]
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...    129   1e-30   Sesamum indicum [beniseed]
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...    129   1e-30   Populus trichocarpa [western balsam poplar]
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    129   1e-30   
gb|EPS74415.1|  hypothetical protein M569_00340                         129   1e-30   Genlisea aurea
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    128   1e-30   Populus euphratica
ref|XP_009413825.1|  PREDICTED: probable inactive receptor kinase...    129   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    129   2e-30   Nelumbo nucifera [Indian lotus]
emb|CAN80590.1|  hypothetical protein VITISV_040789                     128   2e-30   Vitis vinifera
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                   128   2e-30   Citrus sinensis [apfelsine]
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg             128   2e-30   Citrus clementina [clementine]
ref|XP_006289209.1|  hypothetical protein CARUB_v10002657mg             128   3e-30   Capsella rubella
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...    128   3e-30   Pyrus x bretschneideri [bai li]
ref|XP_004253440.1|  PREDICTED: probable inactive receptor kinase...    126   4e-30   Solanum lycopersicum
ref|XP_010423497.1|  PREDICTED: probable leucine-rich repeat rece...    127   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...    127   5e-30   Solanum tuberosum [potatoes]
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    127   6e-30   Cucumis melo [Oriental melon]
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...    127   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...    127   7e-30   
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...    127   7e-30   Citrus sinensis [apfelsine]
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                    126   1e-29   Arabis alpina [alpine rockcress]
ref|XP_010491047.1|  PREDICTED: probable leucine-rich repeat rece...    126   1e-29   Camelina sativa [gold-of-pleasure]
gb|EMT12910.1|  Putative inactive receptor kinase                       126   1e-29   
ref|XP_010053173.1|  PREDICTED: probable inactive receptor kinase...    126   1e-29   Eucalyptus grandis [rose gum]
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...    126   1e-29   
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...    126   1e-29   
ref|NP_001168611.1|  uncharacterized LOC100382395 precursor             126   1e-29   Zea mays [maize]
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...    126   2e-29   Malus domestica [apple tree]
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150             126   2e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...    125   2e-29   Populus euphratica
ref|XP_010104998.1|  putative inactive receptor kinase                  125   2e-29   Morus notabilis
gb|EPS60741.1|  hypothetical protein M569_14060                         125   2e-29   Genlisea aurea
ref|XP_009357339.1|  PREDICTED: probable inactive receptor kinase...    125   3e-29   
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    125   3e-29   
ref|XP_010097875.1|  putative inactive receptor kinase                  125   3e-29   
dbj|BAK07296.1|  predicted protein                                      125   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93317.1|  predicted protein                                      125   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...    125   4e-29   Nicotiana sylvestris
gb|EMT09037.1|  Putative inactive receptor kinase                       125   4e-29   
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    125   4e-29   Sesamum indicum [beniseed]
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...    125   6e-29   Eucalyptus grandis [rose gum]
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...    124   6e-29   Solanum lycopersicum
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...    124   8e-29   
gb|AES98409.2|  LRR receptor-like kinase                                124   9e-29   Medicago truncatula
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...    123   1e-28   Glycine max [soybeans]
ref|XP_003615451.1|  Leucine-rich repeat receptor-like protein ki...    124   1e-28   
emb|CDX98821.1|  BnaC09g50140D                                          123   1e-28   
gb|KHN44239.1|  Putative inactive receptor kinase                       123   1e-28   Glycine soja [wild soybean]
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...    123   1e-28   
emb|CDP12117.1|  unnamed protein product                                123   2e-28   
ref|XP_009368693.1|  PREDICTED: probable inactive receptor kinase...    123   2e-28   
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...    123   2e-28   
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    122   3e-28   
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...    122   3e-28   
emb|CDP05105.1|  unnamed protein product                                122   3e-28   
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...    122   3e-28   
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    122   4e-28   
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...    122   4e-28   
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...    122   4e-28   
gb|EYU23390.1|  hypothetical protein MIMGU_mgv1a003016mg                121   5e-28   
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...    122   6e-28   
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    121   7e-28   
ref|XP_004167200.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    121   7e-28   
ref|XP_008439323.1|  PREDICTED: probable inactive receptor kinase...    121   8e-28   
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...    121   8e-28   
gb|EPS73425.1|  hypothetical protein M569_01324                         120   9e-28   
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    121   9e-28   
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg             121   1e-27   
gb|KJB19053.1|  hypothetical protein B456_003G082600                    120   1e-27   
gb|AES72427.2|  LRR receptor-like kinase                                120   1e-27   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             120   1e-27   
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    120   1e-27   
gb|KHG27491.1|  hypothetical protein F383_14041                         120   1e-27   
gb|KHN18649.1|  Putative inactive receptor kinase                       120   2e-27   
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             120   2e-27   
gb|KJB52635.1|  hypothetical protein B456_008G271600                    118   2e-27   
gb|KDP32336.1|  hypothetical protein JCGZ_13261                         120   2e-27   
ref|XP_010242278.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    117   3e-27   
gb|KHN23405.1|  Putative inactive receptor kinase                       119   3e-27   
ref|XP_004149452.1|  PREDICTED: probable inactive receptor kinase...    119   3e-27   
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g             119   3e-27   
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...    119   3e-27   
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    119   4e-27   
gb|KDP22183.1|  hypothetical protein JCGZ_26014                         119   4e-27   
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    119   4e-27   
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...    119   4e-27   
gb|KJB52636.1|  hypothetical protein B456_008G271600                    117   4e-27   
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...    120   4e-27   
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    119   4e-27   
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    119   5e-27   
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...    119   5e-27   
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    119   5e-27   
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    119   6e-27   
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                119   6e-27   
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    119   7e-27   
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    118   8e-27   
gb|KEH21182.1|  LRR receptor-like kinase                                118   8e-27   
ref|XP_002513601.1|  ATP binding protein, putative                      118   8e-27   
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    118   9e-27   
gb|KJB52637.1|  hypothetical protein B456_008G271600                    118   9e-27   
gb|KJB52632.1|  hypothetical protein B456_008G271600                    118   1e-26   
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg             118   1e-26   
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   118   1e-26   
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    118   1e-26   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...    117   1e-26   
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g             117   1e-26   
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...    117   2e-26   
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g             117   2e-26   
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    117   2e-26   
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...    117   3e-26   
gb|EPS63924.1|  hypothetical protein M569_10855                         117   3e-26   
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    116   4e-26   
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    116   4e-26   
emb|CBI22555.3|  unnamed protein product                                116   7e-26   
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    115   8e-26   
ref|XP_004167125.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    115   9e-26   
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...    115   1e-25   
ref|XP_004490516.1|  PREDICTED: probable inactive receptor kinase...    115   1e-25   
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             115   1e-25   
gb|KHN08297.1|  Putative inactive receptor kinase                       115   1e-25   
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    115   1e-25   
ref|XP_006596280.1|  PREDICTED: probable inactive receptor kinase...    115   1e-25   
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    115   1e-25   
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    114   2e-25   
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    114   2e-25   
gb|ACZ98536.1|  protein kinase                                          114   2e-25   
gb|KGN49888.1|  hypothetical protein Csa_5G139660                       114   2e-25   
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...    114   2e-25   
gb|EEE54142.1|  hypothetical protein OsJ_00935                          114   3e-25   
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    114   3e-25   
ref|XP_009400513.1|  PREDICTED: probable inactive receptor kinase...    114   3e-25   
ref|XP_010916177.1|  PREDICTED: probable inactive receptor kinase...    114   3e-25   
dbj|BAA94519.1|  putative receptor-like kinase                          114   4e-25   
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             113   5e-25   
dbj|BAJ94608.1|  predicted protein                                      113   5e-25   
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     113   5e-25   
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    113   5e-25   
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    113   5e-25   
gb|AAK92807.1|  putative receptor protein kinase                        113   5e-25   
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...    113   6e-25   
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...    113   6e-25   
gb|KJB27114.1|  hypothetical protein B456_004G278900                    113   6e-25   
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...    113   7e-25   
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...    112   7e-25   
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     113   7e-25   
ref|XP_010098956.1|  putative inactive receptor kinase                  113   8e-25   
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    112   9e-25   
gb|EPS62971.1|  hypothetical protein M569_11816                         112   1e-24   
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  112   1e-24   
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    112   1e-24   
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g             112   1e-24   
gb|KHN35064.1|  Putative inactive receptor kinase                       110   2e-24   
ref|XP_010513336.1|  PREDICTED: probable inactive receptor kinase...    111   2e-24   
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...    111   2e-24   
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...    111   3e-24   
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             111   3e-24   
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    111   3e-24   
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             111   3e-24   
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...    111   3e-24   
ref|XP_008437572.1|  PREDICTED: probable inactive receptor kinase...    111   3e-24   
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    111   4e-24   
gb|KJB07168.1|  hypothetical protein B456_001G003200                    110   4e-24   
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...    110   4e-24   
ref|XP_004145918.1|  PREDICTED: probable inactive receptor kinase...    110   4e-24   
gb|KCW46493.1|  hypothetical protein EUGRSUZ_K00318                     108   5e-24   
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             110   5e-24   
ref|XP_006600766.1|  PREDICTED: probable inactive receptor kinase...    110   5e-24   
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             110   7e-24   
gb|EYU19612.1|  hypothetical protein MIMGU_mgv1a026050mg                109   8e-24   
gb|EYU25187.1|  hypothetical protein MIMGU_mgv1a002923mg                109   1e-23   
emb|CDP03386.1|  unnamed protein product                                109   1e-23   
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g             109   1e-23   
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    109   1e-23   
gb|KJB54134.1|  hypothetical protein B456_009G022300                    109   1e-23   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...    109   1e-23   
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...    109   2e-23   
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             108   2e-23   
ref|XP_002872091.1|  hypothetical protein ARALYDRAFT_489266             108   2e-23   
ref|XP_010035197.1|  PREDICTED: probable inactive receptor kinase...    108   3e-23   
ref|XP_006287298.1|  hypothetical protein CARUB_v10000491mg             108   3e-23   
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...    108   3e-23   
ref|XP_008810158.1|  PREDICTED: probable inactive receptor kinase...    107   8e-23   
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...    107   9e-23   
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...    107   9e-23   
gb|KHG24076.1|  hypothetical protein F383_10304                         107   9e-23   
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...    105   9e-23   
ref|XP_006829650.1|  hypothetical protein AMTR_s00122p00112840          107   1e-22   
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    106   1e-22   
gb|KEH40435.1|  LRR receptor-like kinase                                106   1e-22   
ref|XP_009770433.1|  PREDICTED: uncharacterized protein LOC104221140    107   2e-22   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    105   2e-22   
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    106   2e-22   
ref|XP_006391655.1|  hypothetical protein EUTSA_v10024075mg             105   3e-22   
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor             105   3e-22   
ref|XP_010550530.1|  PREDICTED: inactive leucine-rich repeat rece...    105   3e-22   
ref|XP_010433865.1|  PREDICTED: probable inactive receptor kinase...    105   4e-22   
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    105   5e-22   
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...    105   5e-22   
emb|CDY03527.1|  BnaC01g15550D                                          102   5e-22   
ref|XP_010555780.1|  PREDICTED: probable inactive receptor kinase...    104   5e-22   
emb|CDY47625.1|  BnaA01g13400D                                          104   5e-22   
ref|XP_006394667.1|  hypothetical protein EUTSA_v10003837mg             104   5e-22   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    104   6e-22   
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    104   7e-22   
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    104   9e-22   
ref|XP_010493544.1|  PREDICTED: inactive leucine-rich repeat rece...    102   2e-21   
ref|NP_197798.1|  Leucine-rich repeat protein kinase family protein     102   2e-21   
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase     102   2e-21   
gb|AFK45382.1|  unknown                                                 102   3e-21   
ref|XP_010445167.1|  PREDICTED: probable inactive receptor kinase...    103   3e-21   
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...    102   3e-21   
gb|KHG17719.1|  hypothetical protein F383_03334                         102   3e-21   
ref|XP_010049947.1|  PREDICTED: probable inactive receptor kinase...    102   3e-21   
gb|KHG18372.1|  hypothetical protein F383_03411                         102   4e-21   
emb|CDY10963.1|  BnaA03g46220D                                          100   4e-21   
emb|CDY48185.1|  BnaA04g15490D                                          102   4e-21   
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    102   4e-21   
ref|XP_010421220.1|  PREDICTED: inactive leucine-rich repeat rece...    102   4e-21   
ref|XP_004498388.1|  PREDICTED: probable inactive receptor kinase...    102   5e-21   
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     101   6e-21   
gb|KFK36585.1|  hypothetical protein AALP_AA4G143000                    101   6e-21   
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    101   8e-21   
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             101   1e-20   
ref|NP_176603.1|  putative inactive receptor-like protein kinase        100   1e-20   
ref|XP_010541406.1|  PREDICTED: probable inactive receptor kinase...    100   1e-20   
ref|XP_010448663.1|  PREDICTED: probable inactive receptor kinase...    100   1e-20   
gb|KJB64834.1|  hypothetical protein B456_010G067400                    100   1e-20   
ref|XP_006283317.1|  hypothetical protein CARUB_v10004355mg             100   2e-20   
emb|CDX77054.1|  BnaC04g38490D                                          100   2e-20   
emb|CDP00835.1|  unnamed protein product                                100   2e-20   
gb|ACC91242.1|  leucine-rich repeat transmembrane protein kinase        100   3e-20   
emb|CDX94213.1|  BnaC07g38470D                                        99.8    3e-20   
gb|KHN27389.1|  Putative inactive receptor kinase                     95.5    3e-20   
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...  99.4    4e-20   
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...  99.0    5e-20   
ref|XP_010474611.1|  PREDICTED: putative inactive receptor-like p...  98.6    7e-20   
emb|CDY04464.1|  BnaA07g12900D                                        98.6    8e-20   
ref|XP_010418476.1|  PREDICTED: putative inactive receptor-like p...  98.2    9e-20   
ref|XP_009141903.1|  PREDICTED: inactive leucine-rich repeat rece...  97.8    1e-19   
emb|CDY19849.1|  BnaA09g05020D                                        97.8    1e-19   
ref|XP_002887913.1|  hypothetical protein ARALYDRAFT_337960           97.4    1e-19   
emb|CDX87143.1|  BnaC09g04580D                                        97.4    2e-19   
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...  97.4    2e-19   
ref|XP_010454700.1|  PREDICTED: inactive leucine-rich repeat rece...  97.1    2e-19   
gb|KJB83152.1|  hypothetical protein B456_013G231800                  97.1    2e-19   
gb|KHG20222.1|  putative inactive receptor kinase -like protein       95.9    5e-19   
ref|XP_010445702.1|  PREDICTED: probable inactive receptor kinase...  95.9    5e-19   
ref|XP_006646083.1|  PREDICTED: probable inactive receptor kinase...  95.5    6e-19   
gb|AFW80440.1|  putative leucine-rich repeat receptor-like protei...  90.9    8e-19   
dbj|BAJ90284.1|  predicted protein                                    95.5    1e-18   
ref|XP_006280204.1|  hypothetical protein CARUB_v10026109mg           94.7    2e-18   
tpg|DAA58915.1|  TPA: putative leucine-rich repeat receptor-like ...  93.6    3e-18   
ref|XP_010482722.1|  PREDICTED: probable inactive receptor kinase...  94.0    3e-18   
gb|KHG17549.1|  putative inactive receptor kinase -like protein       93.6    3e-18   
ref|XP_002868799.1|  predicted protein                                89.0    3e-18   
gb|EEE54963.1|  hypothetical protein OsJ_02553                        94.0    3e-18   
ref|XP_003566864.1|  PREDICTED: probable inactive receptor kinase...  94.0    3e-18   
gb|KJB43131.1|  hypothetical protein B456_007G186000                  93.6    3e-18   
dbj|BAD52827.1|  receptor-like protein kinase 1-like                  93.6    4e-18   
ref|XP_002458131.1|  hypothetical protein SORBIDRAFT_03g027400        93.6    4e-18   
gb|KJB10379.1|  hypothetical protein B456_001G198100                  93.6    4e-18   
gb|EEC71058.1|  hypothetical protein OsI_02797                        93.6    4e-18   
gb|AFD98845.1|  receptor-like protein kinase 1                        93.6    4e-18   
emb|CDX71488.1|  BnaC04g17230D                                        93.6    4e-18   
gb|AFD98844.1|  receptor-like protein kinase 1                        93.6    4e-18   
gb|KHG00875.1|  putative inactive receptor kinase -like protein       93.2    5e-18   
ref|XP_004969119.1|  PREDICTED: probable inactive receptor kinase...  93.2    5e-18   
gb|KJB08440.1|  hypothetical protein B456_001G081900                  92.8    7e-18   
ref|NP_001146031.1|  uncharacterized LOC100279562 precursor           92.4    9e-18   



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
             LF   ++DL +DRQALLDF  A PHGR+LNW+  + IC++WVGVTCS+DG+RVV LRLP
Sbjct  19   FLFSLAIADLNSDRQALLDFVDAVPHGRKLNWNSSSPICSTWVGVTCSQDGTRVVALRLP  78

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPST  611
            G+G SGPIP NT+GRLDAL  LSLRSN LSGSLPSD+ SLPSL +++LQ NN S +IP++
Sbjct  79   GIGLSGPIPTNTLGRLDALRVLSLRSNRLSGSLPSDITSLPSLHHLFLQHNNLSDEIPAS  138

Query  612  LSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+PEL+ IDLSFNSF G+IP+ V++LT LTGLN
Sbjct  139  LTPELNLIDLSFNSFRGSIPLTVRDLTRLTGLN  171



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score =   177 bits (449),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 1/148 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            V++DL +DRQALLDFASA PH R   W+  +SICT W GV+CS DG+RVV LRLPG+G  
Sbjct  25   VIADLSSDRQALLDFASAVPHLRNFKWNTNSSICT-WHGVSCSSDGTRVVALRLPGIGLY  83

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            GPIP+NTIGRLDALTTLSL SN L+G+LPSD+ SLPSL+ I++Q+N FSG+IPS+LS +L
Sbjct  84   GPIPDNTIGRLDALTTLSLHSNALTGNLPSDITSLPSLRFIFIQQNKFSGEIPSSLSLQL  143

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +FIDLSFNSF+G IP  +QNLTHLTGLN
Sbjct  144  NFIDLSFNSFSGEIPTTIQNLTHLTGLN  171



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MKL   F+ L  +    L  ++++DL +D+QALLDFA+  PH R+LNW+   S+CTSWVG
Sbjct  1    MKLRCVFAALSFIW---LIPQMIADLNSDKQALLDFAANVPHARKLNWNSSTSVCTSWVG  57

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+++GSRV+ +RLPGVG  GPIP NT+ +LD+L  LSLRSN LSG LPS+VLSL SL+
Sbjct  58   ITCTKNGSRVLAVRLPGVGLYGPIPANTLEKLDSLMILSLRSNHLSGDLPSNVLSLSSLR  117

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG+IPS+LSP+L+++DLSFNS TGNIP  ++NL+HL GLN
Sbjct  118  FLYLQNNNFSGNIPSSLSPQLNWVDLSFNSITGNIPASIRNLSHLVGLN  166



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MKL   F+ L  +    L  ++++DL +D+QALLDFA+  PH R+LNW+   S+CTSWVG
Sbjct  1    MKLRCVFAALSFIW---LIPQMIADLNSDKQALLDFAANVPHARKLNWNSSTSVCTSWVG  57

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+++GSRV+ +RLPGVG  GPIP NT+ +LD+L  LSLRSN LSG LPS+VLSL SL+
Sbjct  58   ITCTKNGSRVLAVRLPGVGLYGPIPANTLEKLDSLMILSLRSNHLSGDLPSNVLSLSSLR  117

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG+IPS+LSP+L+++DLSFNS TGNIP  ++NL+HL GLN
Sbjct  118  FLYLQNNNFSGNIPSSLSPQLNWVDLSFNSITGNIPASIRNLSHLVGLN  166



>gb|KJB29842.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
 gb|KJB29843.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
Length=660

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 129/171 (75%), Gaps = 3/171 (2%)
 Frame = +3

Query  201  RMKLYTSFSTLP-LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
             MKL + F+    L LC       V+DL  D QALL F++  PHGR+LNWS    +CTSW
Sbjct  26   EMKLASYFAAFACLFLCC--GSGTVADLDLDEQALLQFSATVPHGRKLNWSPATPVCTSW  83

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            VG+ C++DGSRV+ L LPGVG  G IP NT+G+LDAL  LSLRSN LSG+LPSDVLSLP+
Sbjct  84   VGINCTKDGSRVIALHLPGVGLHGQIPANTLGKLDALRVLSLRSNRLSGNLPSDVLSLPT  143

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ +YLQ NNFSGDIPS+L P LDF+DLSFNS TGNIP  +QNLT+LTGLN
Sbjct  144  LRYVYLQLNNFSGDIPSSLPPSLDFLDLSFNSLTGNIPTAIQNLTNLTGLN  194



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score =   174 bits (442),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 124/149 (83%), Gaps = 1/149 (1%)
 Frame = +3

Query  264  KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGF  443
            KV++DL +DRQALLDFASA PH R+  W+  +SICT W GV+C+ DG+RVV LRLP +G 
Sbjct  21   KVIADLSSDRQALLDFASAVPHLRKFTWNTNSSICT-WHGVSCNSDGTRVVALRLPAIGL  79

Query  444  SGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPE  623
             GPIP+NTIGRLDALTTLSL SN L G+LPSD+ SLPSL+ I+LQ+N  SG+IPS+LSP+
Sbjct  80   YGPIPDNTIGRLDALTTLSLHSNGLKGNLPSDITSLPSLRFIFLQQNQLSGEIPSSLSPQ  139

Query  624  LDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+F+DLSFNSF+G IP  VQNLT LTGLN
Sbjct  140  LNFVDLSFNSFSGEIPTTVQNLTSLTGLN  168



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +3

Query  264  KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGF  443
            +V++DL  D+QALLDF++A PHGR+LNW+  + IC++WVGVTCS+DG+ VV LRLPGVG 
Sbjct  58   QVIADLDTDKQALLDFSAAVPHGRKLNWNSTSPICSTWVGVTCSQDGNHVVMLRLPGVGL  117

Query  444  SGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPE  623
            SGPIP NT+GRLDAL  LSLRSN L G+LPSD+  LPSLQ ++LQ NNFSG++P++LS +
Sbjct  118  SGPIPANTLGRLDALKVLSLRSNHLIGNLPSDIPFLPSLQYLFLQHNNFSGNVPASLSRK  177

Query  624  LDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ IDLSFNSF GNIP  +QNLT LT LN
Sbjct  178  LNLIDLSFNSFKGNIPPTIQNLTRLTRLN  206



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLY-TSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL+ TS   L L +  +L    ++DL AD+QALLDFA A PH R+LNW+    +CTSWV
Sbjct  30   MKLFSTSLVLLFLFVIAILLPLAIADLDADKQALLDFADAVPHRRKLNWNSSTPVCTSWV  89

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+ C+ DGSRV  LRLPG+G +G IP  T+G+LDAL  LSLRSNLL+G LPSD+ SLPSL
Sbjct  90   GINCTGDGSRVRALRLPGIGLTGSIPATTLGKLDALEILSLRSNLLTGKLPSDIPSLPSL  149

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q ++LQ NNFSGDIP++ SP+L  +DLSFNSFTGNIP+ + NLT LTGLN
Sbjct  150  QYLFLQHNNFSGDIPASFSPQLTVLDLSFNSFTGNIPLTIWNLTQLTGLN  199



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  264  KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGF  443
            + V+DL +D QALL F++  PHGR+LNWS    +C SWVG+ C++DGSRV+ + LPGVG 
Sbjct  20   ETVADLNSDEQALLQFSATVPHGRKLNWSPATPVCASWVGINCTKDGSRVLAVHLPGVGL  79

Query  444  SGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPE  623
             GPIP NT+G+LDAL  LSLRSN LSG+LPSD+LSLPSLQ +YLQ NNFSGDIPS L P+
Sbjct  80   YGPIPANTLGKLDALMILSLRSNRLSGNLPSDILSLPSLQYLYLQHNNFSGDIPSALPPK  139

Query  624  LDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            LDF+DLSFN FTGNIP  +QNLT+LTGL+
Sbjct  140  LDFLDLSFNFFTGNIPTTIQNLTNLTGLS  168



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLY-TSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL+ TS   L L +  +L    ++DL AD+QALLDFA A PH R+LNW+    +CTSWV
Sbjct  20   MKLFSTSLVLLFLFVIAILLPLAIADLDADKQALLDFADAVPHRRKLNWNSSTPVCTSWV  79

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+ C+ DGSRV  LRLPG+G +G IP  T+G+LDAL  LSLRSNLL+G LPSD+ SLPSL
Sbjct  80   GINCTGDGSRVRALRLPGIGLTGSIPATTLGKLDALEILSLRSNLLTGKLPSDIPSLPSL  139

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q ++LQ NNFSGDIP++ SP+L  +DLSFNSFTGNIP+ + NLT LTGLN
Sbjct  140  QYLFLQHNNFSGDIPASFSPQLTVLDLSFNSFTGNIPLTIWNLTQLTGLN  189



>ref|XP_006587908.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
 gb|KHN29485.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 131/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            M L + F+T+P+ L +L+F    ++L +++QALLDFA+A  HG ++NW+   SICTSWVG
Sbjct  1    MLLQSYFTTIPIFLLLLVFPHTKANLHSEKQALLDFAAALHHGPKVNWNSSTSICTSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTCS DGS V+ +RLPGVG  G +P NT+G+L+ L +LSLRSN L G+LP+D+LSLPSL+
Sbjct  61   VTCSHDGSHVLSVRLPGVGLRGSLPPNTLGKLNGLISLSLRSNSLRGNLPTDLLSLPSLR  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG+IP +L P L F+DLS NSFTG IP  +QNLTHL GLN
Sbjct  121  FVYLQHNNFSGEIPDSLPPRLIFLDLSHNSFTGQIPASIQNLTHLIGLN  169



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            +L   V SDL +D+QALLDFA+A PH R+L+W+    +CTSWVG+TC+ +G+RV+ LRLP
Sbjct  17   ILLPLVFSDLTSDKQALLDFANAVPHRRKLSWNPATPVCTSWVGITCTPNGTRVISLRLP  76

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPST  611
            GVG  G +P NT+GRLDAL  LSLRSNLL G LPSD+ +LP+LQ++YLQRNNFSGDIP++
Sbjct  77   GVGLLGSVPPNTLGRLDALRILSLRSNLLRGVLPSDITTLPALQHLYLQRNNFSGDIPTS  136

Query  612  LSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             SP+L+ +DLSFNSFTGNIP  ++NLT LTGL+
Sbjct  137  FSPQLNVLDLSFNSFTGNIPETMRNLTQLTGLS  169



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  222  FSTLPLVLC-VLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            FS +P +   V+L   V SDL +D+QALLDFA+A PH R L W+  + +CTSWVG+TC+ 
Sbjct  6    FSVIPFLFSIVILLPLVFSDLNSDKQALLDFAAAVPHRRNLTWNPASPVCTSWVGITCNR  65

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            +G+RV  LRLPGVG  G +P NT+GRLDAL  LSLRSNLL G+LPSD+ SLP LQN+YLQ
Sbjct  66   NGTRVTALRLPGVGLVGSVPSNTVGRLDALRILSLRSNLLRGNLPSDITSLPVLQNLYLQ  125

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             NNFSGDIP++ S +L+ +DLSFNSFTGNIP  + NLT LTGLN
Sbjct  126  HNNFSGDIPASFSLQLNVLDLSFNSFTGNIPRILHNLTQLTGLN  169



>ref|XP_008244579.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244587.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244595.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244604.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244609.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
Length=633

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +3

Query  240  VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVE  419
            V+ +L   + ++DL +DRQALL F S  PHGR++NW    ++C+SWVG+TC+ DG+RV+ 
Sbjct  10   VILLLSLCRTIADLNSDRQALLGFISVVPHGRKVNWDPANAVCSSWVGITCTLDGTRVLA  69

Query  420  LRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGD  599
            +RLPGVG  GPIP NT+G+LDAL  LSLRSN LSG LPSD+ SLPSL  +YLQ NNF+G+
Sbjct  70   VRLPGVGLYGPIPANTLGKLDALIVLSLRSNRLSGKLPSDIFSLPSLHYMYLQNNNFTGN  129

Query  600  IPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            IPS+LSP L  +DLSFNSFTGNIP  +QNLT LTGLN
Sbjct  130  IPSSLSPNLTLLDLSFNSFTGNIPATIQNLTRLTGLN  166



>ref|XP_007207849.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
 gb|EMJ09048.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
Length=623

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  243  LCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVEL  422
            + +L  ++ ++DL +D+QALL F S  PHGR++NW    ++C+SWVG+TC+ DG+RV+ +
Sbjct  1    ILLLSLRRTIADLNSDKQALLGFISVVPHGRKVNWDPANAVCSSWVGITCTLDGTRVLAV  60

Query  423  RLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDI  602
            RLPGVG  GPIP NT+G+LDAL  LSLRSN LSG+LPSD+ SLPSL  IYLQ NNF+G+I
Sbjct  61   RLPGVGLYGPIPANTLGKLDALIVLSLRSNRLSGNLPSDIFSLPSLHYIYLQNNNFTGNI  120

Query  603  PSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            PS+LSP L  +DLSFNSFTGNIP  +QNLT LTGLN
Sbjct  121  PSSLSPNLTLLDLSFNSFTGNIPATIQNLTRLTGLN  156



>ref|XP_004172749.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At5g58300-like [Cucumis sativus]
Length=638

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            + +DL +D++ALLDF S+ PHGR++NW     +CT+WVGVTC+ D S V+ LRLP +G  
Sbjct  22   IAADLNSDQEALLDFISSVPHGRKINWDPSTPVCTTWVGVTCTSDLSNVLALRLPAIGLY  81

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            GPIP NT+G+LDAL TLSLRSN L+G+LPSDVLSLPSL+ +YLQRNNFSG +PS+LSP L
Sbjct  82   GPIPANTLGKLDALRTLSLRSNNLNGNLPSDVLSLPSLKFLYLQRNNFSGKVPSSLSPSL  141

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             F+DLSFNS TGNIP  VQNLTHLTGLN
Sbjct  142  TFLDLSFNSLTGNIPKSVQNLTHLTGLN  169



>ref|XP_004142674.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN54462.1| hypothetical protein Csa_4G334730 [Cucumis sativus]
Length=638

 Score =   172 bits (435),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            + +DL +D++ALLDF S+ PHGR++NW     +CT+WVGVTC+ D S V+ LRLP +G  
Sbjct  22   IAADLNSDQEALLDFISSVPHGRKINWDPSTPVCTTWVGVTCTSDLSNVLALRLPAIGLY  81

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            GPIP NT+G+LDAL TLSLRSN L+G+LPSDVLSLPSL+ +YLQRNNFSG +PS+LSP L
Sbjct  82   GPIPANTLGKLDALRTLSLRSNNLNGNLPSDVLSLPSLKFLYLQRNNFSGKVPSSLSPSL  141

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             F+DLSFNS TGNIP  VQNLTHLTGLN
Sbjct  142  TFLDLSFNSLTGNIPKSVQNLTHLTGLN  169



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +3

Query  255  LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPG  434
             F  V++DL +DRQALLDFASA  H R   W+  +SICT W GV+CS DG+RVV LRLPG
Sbjct  20   FFPYVIADLTSDRQALLDFASAVAHLRNFKWNTNSSICT-WHGVSCSSDGTRVVALRLPG  78

Query  435  VGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTL  614
            +G  GPIP+NTIGRLDALTTLSL SN L+G+LPSD+ SLPSL+ I++Q+N FSG+IPS+L
Sbjct  79   LGLYGPIPDNTIGRLDALTTLSLHSNALTGNLPSDITSLPSLRFIFIQQNKFSGEIPSSL  138

Query  615  SPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            S  L FIDLSFNSF+G +P  +QNLTHLTGLN
Sbjct  139  SLLLKFIDLSFNSFSGEVPTTIQNLTHLTGLN  170



>ref|XP_006602721.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_003551618.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
Length=607

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            M L + F+T+P+ L +L+F +  +DL++++QALLDFA+A  HG ++NW+   SICTSWVG
Sbjct  1    MMLQSYFTTIPIFLLLLVFTRTKADLQSEKQALLDFAAALHHGPKVNWNSSTSICTSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTCS DGS V+ +RLPGVG  G +P  T+G+L+ L +LSLRSN L G+LP+D+LSLPSL+
Sbjct  61   VTCSHDGSHVLSVRLPGVGLRGFLPPRTLGKLNGLISLSLRSNSLRGNLPTDLLSLPSLR  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG IP +L P L F+DLS NSFTG IP  +QNLTHL G N
Sbjct  121  FVYLQHNNFSGVIPDSLPPRLIFLDLSHNSFTGQIPASIQNLTHLIGFN  169



>gb|KHN40609.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            M L + F+T+P+ L +L+F +  +DL++++QALLDFA+A  HG ++NW+   SICTSWVG
Sbjct  1    MMLQSYFTTIPIFLLLLVFTRTKADLQSEKQALLDFAAALHHGPKVNWNSSTSICTSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTCS DGS V+ +RLPGVG  G +P  T+G+L+ L +LSLRSN L G+LP+D+LSLPSL+
Sbjct  61   VTCSHDGSHVLSVRLPGVGLRGFLPPRTLGKLNGLISLSLRSNSLRGNLPTDLLSLPSLR  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG IP +L P L F+DLS NSFTG IP  +QNLTHL G N
Sbjct  121  FVYLQHNNFSGVIPDSLPPRLIFLDLSHNSFTGQIPASIQNLTHLIGFN  169



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  231  LPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
             PL + V L     +DL +DRQALLDFA A PH R+LNWS    IC SWVG+ C++D +R
Sbjct  11   FPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTR  70

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            V  LRLPG+G  GPIP NT+G+LDAL  LSLRSN+L+G LPS++ SLPSL+ +YLQ NNF
Sbjct  71   VFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNF  130

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SG IPS+ SP+L  +DLSFNSFTGNIP  +QNLT LTGL+
Sbjct  131  SGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLS  170



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  222  FSTLPLVLC-VLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            FS +P +   V+L   V SDL +D+QALLDFA+A PH R L W+  + +CTSWVG+TC+ 
Sbjct  6    FSVIPFLFSIVILLPLVFSDLHSDKQALLDFAAAVPHRRNLTWNPASPVCTSWVGITCNL  65

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            +G+RV  LRLPGVG  G +P NT+GRLDAL  LSLRSNLL G+LPSD+ SLP LQN+YLQ
Sbjct  66   NGTRVTALRLPGVGLVGSVPSNTVGRLDALRILSLRSNLLRGNLPSDITSLPVLQNLYLQ  125

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             NNFSGDIP++ S +L+ +DLSFNSF+GNIP  + NLT LTGLN
Sbjct  126  HNNFSGDIPASFSLQLNVLDLSFNSFSGNIPQILHNLTQLTGLN  169



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  231  LPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
             PL + V L     +DL +DRQALLDFA A PH R+LNWS    IC SWVG+ C++D +R
Sbjct  11   FPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTR  70

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            V  LRLPG+G  GPIP NT+G+LDAL  LSLRSN+L+G LPS++ SLPSL+ +YLQ NNF
Sbjct  71   VFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNF  130

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SG IPS+ SP+L  +DLSFNSFTGNIP  +QNLT LTGL+
Sbjct  131  SGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLS  170



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 121/149 (81%), Gaps = 1/149 (1%)
 Frame = +3

Query  264  KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGF  443
            KV++DL +DRQALLDFASA PH R+  W+  +SICT W GV+C+ D +RVV LRLP +G 
Sbjct  21   KVIADLSSDRQALLDFASAVPHLRKFTWNTNSSICT-WHGVSCNSDETRVVALRLPAIGL  79

Query  444  SGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPE  623
             GPIPENTIGRLDALTTLSL SN L G+LPSD+ SLPSL+ I+LQ N  SG+IPS+LS +
Sbjct  80   YGPIPENTIGRLDALTTLSLHSNGLKGNLPSDITSLPSLRFIFLQENQLSGEIPSSLSSQ  139

Query  624  LDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+FIDLSFNSF+G IP  VQNLT LTGLN
Sbjct  140  LNFIDLSFNSFSGEIPTTVQNLTSLTGLN  168



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  231  LPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
             PL + V L     +DL +DRQALLDFA A PH R+LNWS    IC SWVG+ C++D +R
Sbjct  48   FPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTR  107

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            V  LRLPG+G  GPIP NT+G+LDAL  LSLRSN+L+G LPS++ SLPSL+ +YLQ NNF
Sbjct  108  VFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNF  167

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SG IPS+ SP+L  +DLSFNSFTGNIP  +QNLT LTGL+
Sbjct  168  SGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLS  207



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  231  LPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
             PL + V L     +DL +DRQALLDFA A PH R+LNWS    IC SWVG+ C++D +R
Sbjct  58   FPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTR  117

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            V  LRLPG+G  GPIP NT+G+LDAL  LSLRSN+L+G LPS++ SLPSL+ +YLQ NNF
Sbjct  118  VFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNF  177

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SG IPS+ SP+L  +DLSFNSFTGNIP  +QNLT LTGL+
Sbjct  178  SGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLS  217



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 122/160 (76%), Gaps = 0/160 (0%)
 Frame = +3

Query  231  LPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
             PL + V L     +DL +DRQALLDFA A PH R+LNWS    IC SWVG+ C++D +R
Sbjct  48   FPLCVIVSLLPLAFADLNSDRQALLDFADAVPHLRKLNWSSTNPICQSWVGINCTQDRTR  107

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            V  LRLPG+G  GPIP NT+G+LDAL  LSLRSN+L+G LPS++ SLPSL+ +YLQ NNF
Sbjct  108  VFGLRLPGIGLVGPIPNNTLGKLDALEVLSLRSNVLTGGLPSEITSLPSLRYLYLQHNNF  167

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SG IPS+ SP+L  +DLSFNSFTGNIP  +QNLT LTGL+
Sbjct  168  SGKIPSSFSPQLVVLDLSFNSFTGNIPQSIQNLTQLTGLS  207



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK + +      ++  ++F   +SDLK+D+QALLDFA+  PH R+LNW+  + +C SWVG
Sbjct  1    MKFFRASVIHLFIILTIIFPFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+ + +RVVELRLPGVG  G +P NT+G+LDAL TLSLRSN+L G LPSDV SLPSLQ
Sbjct  61   VTCNSNDTRVVELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQ  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N++LQ NNFSG +P++ S +L+ +DLSFNSFTGNIP  + NLT LTGL+
Sbjct  121  NLFLQHNNFSGGVPTSFSLKLNVLDLSFNSFTGNIPQTIANLTQLTGLS  169



>ref|XP_006371315.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|ERP49112.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=630

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +S ST+  +  +L +  ++++DL +DRQALLDFA+A PH R+LNW+   S+CTSWV
Sbjct  1    MKLLSSISTVVFLFFILPVVPQIIADLNSDRQALLDFAAAVPHIRKLNWNASTSVCTSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ +G+ VV + LPGVG  GPIP NTIGRL++L  LSLRSN L+G LPSD+ SLPSL
Sbjct  61   GITCNTNGTGVVAVHLPGVGLYGPIPANTIGRLNSLKILSLRSNSLNGKLPSDIPSLPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            Q++YLQ+NNFSG  P+ LS +L+ +DLSFNSFTG+IP  +QNLT LT L
Sbjct  121  QHLYLQQNNFSGVFPALLSLQLNVLDLSFNSFTGSIPPTIQNLTQLTAL  169



>gb|KJB71491.1| hypothetical protein B456_011G125200 [Gossypium raimondii]
Length=628

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 128/171 (75%), Gaps = 3/171 (2%)
 Frame = +3

Query  201  RMKLYTSFSTLP-LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
             MKL + F+T   L LC L     V+DL +D+QALL F++  PHGR+LNWS    +CTSW
Sbjct  5    EMKLPSYFATFAFLFLCFLSVN--VADLDSDKQALLRFSARVPHGRKLNWSSATPVCTSW  62

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            VG+ C++D SRV+ L LPGVG  GPIP NT+G+LDAL  LSLR N LSG+LP+DVLSLPS
Sbjct  63   VGINCTKDQSRVMALHLPGVGLHGPIPANTLGKLDALMILSLRLNSLSGNLPTDVLSLPS  122

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ IYLQ NNFSG IP +L P L+F+DLSFNS +G IP  VQNLT+LTGL 
Sbjct  123  LRYIYLQHNNFSGRIPPSLPPHLNFLDLSFNSLSGTIPATVQNLTNLTGLE  173



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 128/171 (75%), Gaps = 3/171 (2%)
 Frame = +3

Query  201  RMKLYTSFSTLP-LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
             MKL + F+    L LC       V+DL  D QALL F++  PHGR++NWS    +CTSW
Sbjct  27   EMKLASYFAAFACLFLCC--GSGTVADLDLDEQALLQFSATVPHGRKINWSPATPVCTSW  84

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            VG+ C++DGSRV+ L LPGVG  G IP NT+G+LDAL  LSLRSN LSG+LPSDVLSLPS
Sbjct  85   VGINCTKDGSRVIALHLPGVGLHGQIPANTLGKLDALMILSLRSNRLSGNLPSDVLSLPS  144

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ +YLQ NNFSGDIPS+L   LDF+DLSFNS TG+IP  +QNLT+LTGLN
Sbjct  145  LRYVYLQHNNFSGDIPSSLPLSLDFLDLSFNSLTGSIPTAIQNLTNLTGLN  195



>ref|XP_006371316.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
 gb|ERP49113.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
Length=655

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +S ST+  +  +L +  ++++DL +DRQALLDFA+A PH R+LNW+   S+CTSWV
Sbjct  26   MKLLSSISTVVFLFFILPVVPQIIADLNSDRQALLDFAAAVPHIRKLNWNASTSVCTSWV  85

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ +G+ VV + LPGVG  GPIP NTIGRL++L  LSLRSN L+G LPSD+ SLPSL
Sbjct  86   GITCNTNGTGVVAVHLPGVGLYGPIPANTIGRLNSLKILSLRSNSLNGKLPSDIPSLPSL  145

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            Q++YLQ+NNFSG  P+ LS +L+ +DLSFNSFTG+IP  +QNLT LT L
Sbjct  146  QHLYLQQNNFSGVFPALLSLQLNVLDLSFNSFTGSIPPTIQNLTQLTAL  194



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK + +      ++  ++F   +SDLK+D+QALLDFA+  PH R+LNW+  + +C SWVG
Sbjct  1    MKFFRASVIHLFIILTIIFPFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+ +G+RVVELRLPGVG  G IP NT+G+LDAL TLSLRSN+L G LPSD+ SLPSLQ
Sbjct  61   VTCNSNGTRVVELRLPGVGLLGHIPPNTLGKLDALNTLSLRSNVLEGDLPSDITSLPSLQ  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N++LQ NNFSG + ++ S  L+ +DLSFNSFTGNIP  + NLT LTGL+
Sbjct  121  NLFLQHNNFSGGVSTSFSLNLNVLDLSFNSFTGNIPQTIANLTQLTGLS  169



>ref|XP_008463277.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463278.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463279.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463281.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463282.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463283.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=640

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            + +DL +D++ALLDF S  PHGR++NW     +CT+WVG+TC+ D S V+ LRLP +G  
Sbjct  22   IAADLNSDQKALLDFISTVPHGRKINWDPSTPVCTTWVGITCTSDLSNVLALRLPAIGLY  81

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            GPIP NT+G+LDAL TLSLRSN L+G+LPSDVLSLP+L+ +YLQ NNFSG +PS+LSP L
Sbjct  82   GPIPANTLGKLDALRTLSLRSNNLNGNLPSDVLSLPTLKFLYLQHNNFSGKVPSSLSPSL  141

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             F+DLSFNS TGNIP  VQNLTHLTGLN
Sbjct  142  TFLDLSFNSLTGNIPKSVQNLTHLTGLN  169



>ref|XP_007140053.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
 gb|ESW12047.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
Length=607

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            M L   F+T+P+ L +L+F +  +DL +++QALLDFA+A  H  RLNW+   SICTSW+G
Sbjct  1    MMLQFYFTTIPIFLLLLVFPQTRADLHSEKQALLDFAAALHHAPRLNWNSSTSICTSWMG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            V CS DGS V+ +RLPGVG  G +P NT+ +L+ L +LSLRSN L G+LP+D+LSLPSL+
Sbjct  61   VACSHDGSHVLSVRLPGVGLRGSLPPNTLSKLNGLISLSLRSNSLRGNLPTDLLSLPSLR  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ N+FSG IP +L P L F+DLS+NSFTG IP  +QNLTHL GLN
Sbjct  121  FVYLQHNHFSGHIPVSLPPRLIFLDLSYNSFTGKIPASIQNLTHLIGLN  169



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +  + +  ++ +L +F  VV+DL +DRQALL+FA++ PH R+LNW++   IC SW 
Sbjct  11   MKLQSLLAAVAFLIPLLSIFPHVVADLDSDRQALLEFANSVPHIRKLNWNLALPICYSWA  70

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC++DG+RV+ + LP VG  GPIP N+IG+LDAL  LSLR+N L+GSLPSD+LS+PSL
Sbjct  71   GVTCNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSLPSDLLSIPSL  130

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q++YLQ NNFSGDIP +LSP L  +DLSFNSFTG IP  +++L+ L+ LN
Sbjct  131  QSVYLQHNNFSGDIPVSLSPRLGVLDLSFNSFTGKIPTTIKSLSRLSVLN  180



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +  + +  ++ +L +F  V++DL +DRQALLDFA + PH R+LNW++   IC SW 
Sbjct  1    MKLQSLLAAIVFLISLLSVFLNVIADLDSDRQALLDFAESVPHIRKLNWNLALPICKSWA  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+ C+EDG+RV+ + LP VG  GPIP N+IG+LDAL  LSLR+N L+GS+PSD+LS+PSL
Sbjct  61   GIACNEDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSVPSDLLSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q++YLQ N+FSGDIP +LSP +  +DLSFNSFTG IP  ++NLT L+ LN
Sbjct  121  QSVYLQHNSFSGDIPVSLSPRIGVLDLSFNSFTGEIPPTIKNLTRLSVLN  170



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  213  YTSFSTLPL-VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            Y + + LP  V  V+L    ++DL +D+QALL FA+A PH R L W     +CTSW+GV 
Sbjct  3    YCAAAVLPFFVFIVILLPLAIADLDSDKQALLKFAAAVPHLRNLKWDPATPVCTSWIGVN  62

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C+ED +RV+ LRLPGVG  G IP NT+G+LDAL  LSLRSNLLSG LPSDV SLPSL  +
Sbjct  63   CTEDHTRVLSLRLPGVGLVGTIPANTLGKLDALRVLSLRSNLLSGDLPSDVTSLPSLHYL  122

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            YLQ NNFSG+IP++LSP+L+ +DLSFNSF+G IP  +QNLT LTGLN
Sbjct  123  YLQHNNFSGEIPASLSPKLNVLDLSFNSFSGEIPQTIQNLTQLTGLN  169



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y++ +   L++  ++F   ++DL +D+QALLDF +  PH + L W+   SICTSWVG
Sbjct  23   MKFYSASAASFLLVIAIIFPLAIADLNSDKQALLDFINVVPHRKNLMWNPSTSICTSWVG  82

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC++DG+RVV +RLPGVG  G IP NT+G+LDA+  +SLRSNLL G+LP+D+ SLPSLQ
Sbjct  83   ITCNQDGTRVVNVRLPGVGLIGSIPSNTLGKLDAVKIISLRSNLLGGNLPADIASLPSLQ  142

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSGDIP++LSP+L  +DLS+NSF G IP  +QNLT L  LN
Sbjct  143  YLYLQHNNFSGDIPTSLSPQLIVLDLSYNSFAGRIPKTLQNLTELNSLN  191



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y++ +   L++  ++F   ++DL +D+QALLDF +  PH + L W+   SICTSWVG
Sbjct  13   MKFYSASAASFLLVIAIIFPLAIADLNSDKQALLDFINVVPHRKNLMWNPSTSICTSWVG  72

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC++DG+RVV +RLPGVG  G IP NT+G+LDA+  +SLRSNLL G+LP+D+ SLPSLQ
Sbjct  73   ITCNQDGTRVVNVRLPGVGLIGSIPSNTLGKLDAVKIISLRSNLLGGNLPADIASLPSLQ  132

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSGDIP++LSP+L  +DLS+NSF G IP  +QNLT L  LN
Sbjct  133  YLYLQHNNFSGDIPTSLSPQLIVLDLSYNSFAGRIPKTLQNLTELNSLN  181



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +  + +  ++ +L +F  VV+DL +DRQALL+FA++ PH R+LNW++   IC SW 
Sbjct  82   MKLQSLLAAVAFLIPLLSIFPHVVADLDSDRQALLEFANSVPHIRKLNWNLALPICYSWA  141

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC++DG+RV+ + LP VG  GPIP N+IG+LDAL  LSLR+N L+GSLPSD+LS+PSL
Sbjct  142  GVTCNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSLPSDLLSIPSL  201

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q++YLQ NNFSGDIP +LSP L  +DLSFNSFTG IP  +++L+ L+ LN
Sbjct  202  QSVYLQHNNFSGDIPVSLSPRLGVLDLSFNSFTGKIPTTIKSLSRLSVLN  251



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L+L + +F  V++DL +DRQALLDFA + PH R+LNW++   IC SW G+ C++DG+RV+
Sbjct  13   LILLLSVFLHVIADLDSDRQALLDFAESVPHIRKLNWNLALPICKSWAGIACNKDGTRVI  72

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             + LP VG  GPIP N+IG+LDAL  LSLR+N L+GS+PSD+LS+PSLQ++YLQ N+FSG
Sbjct  73   AIHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSVPSDLLSIPSLQSVYLQHNSFSG  132

Query  597  DIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            DIP +LSP L  +DLSFNSFTG IP  ++NLT L+ LN
Sbjct  133  DIPVSLSPRLGVLDLSFNSFTGEIPSTIKNLTRLSVLN  170



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 130/173 (75%), Gaps = 1/173 (1%)
 Frame = +3

Query  195  C*RMKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICT  371
            C  M++ ++   LP +L V  L    + DL +D+QALL FASA PHG ++NWS    IC+
Sbjct  19   CFLMRICSACQLLPALLVVATLLPLTLGDLDSDKQALLAFASAVPHGPKINWSPATPICS  78

Query  372  SWVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlsl  551
            SWVG+TCSEDG+ VV +RLPGVG +GP+P+NT+G+LD+L  +SLR+N L+G+LP ++ SL
Sbjct  79   SWVGITCSEDGAHVVAVRLPGVGLAGPLPQNTLGKLDSLRIISLRANRLNGNLPVEITSL  138

Query  552  pslQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             SLQ ++LQ NNFSG IP++ S +L+ +DLS+NSF G IPV  QNLT L+GL+
Sbjct  139  SSLQYLFLQHNNFSGPIPASFSHKLNVLDLSYNSFIGKIPVTFQNLTQLSGLS  191



>gb|AAL76166.1|AF348333_1 candidate plant disease resistance protein [Glycine max]
Length=228

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L + V+ F   ++DL +D+QALL+FA+A PH R L W+   S+C+SWVG+TC+E+ +RVV
Sbjct  44   LFVIVIFFPLAIADLSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNENRTRVV  103

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
            ++RLPGVG  G IP NT+G+LDA+  +SLRSNLLSG+LP+D+ SLPSLQ +YLQ NN SG
Sbjct  104  KVRLPGVGLVGTIPSNTLGKLDAVKIISLRSNLLSGNLPADIGSLPSLQYLYLQHNNLSG  163

Query  597  DIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            DIP++LSP+L  +DLS+NSFTG IP   QN++ LT LN
Sbjct  164  DIPASLSPQLIVLDLSYNSFTGVIPKTFQNMSVLTSLN  201



>ref|XP_010098027.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74410.1| putative inactive receptor kinase [Morus notabilis]
Length=711

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSED  401
            FS + L L ++   + ++D+ +D++ALLDF SA PHGR++NW+    +C +WVG+TC+ +
Sbjct  84   FSVVLLFLALIFVDRTIADIDSDKEALLDFISAVPHGRKVNWNPATPVCKTWVGITCNLN  143

Query  402  GSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQR  581
            GS V+ +RLPGVG  GPIP NT+G+LD L +LSLRSN L+G+LPSD+LSLPSL+N+YLQ 
Sbjct  144  GSNVIAVRLPGVGLFGPIPANTLGKLDGLISLSLRSNRLNGTLPSDILSLPSLRNVYLQN  203

Query  582  NNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N FSG+IPS+LSP L F D+SFNS +G IP   QNLT LTGLN
Sbjct  204  NTFSGNIPSSLSPRLTFFDVSFNSISGQIPAVFQNLTRLTGLN  246



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA+A PHGR+LNW+  + ICTSWVG+TCS++ +RV+ LRLPG G  GP
Sbjct  23   ADLDSDKQALLQFANAIPHGRKLNWTASSPICTSWVGITCSKNPTRVIALRLPGTGLFGP  82

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+LDALT LSLRSN LSG+LPSDVL LPSL  I LQ NN SGD+PS+LSP+L  
Sbjct  83   IPANTLGKLDALTALSLRSNRLSGNLPSDVLILPSLHTINLQSNNLSGDLPSSLSPQLSV  142

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLSFN+FTG IP ++ NLTHLT LN
Sbjct  143  VDLSFNAFTGEIPPEITNLTHLTILN  168



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  222  FSTLPLVLCV-LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            F  +P +  + +L   V SDL +DRQALLDFA A PH R+L+W+    +CTSWVG+TC+ 
Sbjct  6    FLVIPXLFGIAILLPLVFSDLTSDRQALLDFADAVPHRRKLSWNPATPVCTSWVGITCTP  65

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            +G+RV  LRLPGVG  G +P NT+G L+AL  LSLRSNLL G LPSD+ SLP+LQ +YLQ
Sbjct  66   NGTRVTSLRLPGVGLVGSVPPNTLGXLBALRILSLRSNLLRGVLPSDITSLPALQRLYLQ  125

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            RNNFSGDIP++ SP+L+ +DLSFNSFTGNIP  ++NLT LT L+
Sbjct  126  RNNFSGDIPTSFSPQLNVLDLSFNSFTGNIPQTMRNLTQLTELS  169



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 125/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  213  YTSFSTLPLVLCVLLFQKVV-SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            +  FS +P +  + +   VV SDL +D+QALLDFA A PH R  +W+    +CTSWVGV 
Sbjct  3    FCPFSVIPFLFGIAILLPVVFSDLTSDKQALLDFADAVPHRRNFSWNPATPVCTSWVGVN  62

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C+ +G RV  LRLPGVG  G +P NT+G+LDAL  LSLRSNLL G LPSD+ SLP+L+ +
Sbjct  63   CTPNGIRVTSLRLPGVGLVGSVPPNTLGKLDALRILSLRSNLLRGDLPSDITSLPALRYL  122

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            YLQRNNFSGDIP++ SP+L+ +DLSFNS TGNIP  V+NLT LTGL+
Sbjct  123  YLQRNNFSGDIPTSFSPQLNVLDLSFNSLTGNIPQTVRNLTQLTGLS  169



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +S ST+  +  +L +  ++++DL +DRQALL+FA+A PH R+LNW+   S+CTSWV
Sbjct  1    MKLLSSISTVVSLFFILPVVPQIIADLNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ +G+ VV + LPGVG  GPIP NTIGRL++L  LSLRSN L+G LPSD+ SLPSL
Sbjct  61   GITCNTNGTGVVAVHLPGVGLYGPIPANTIGRLNSLKILSLRSNSLNGKLPSDIPSLPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            +++YLQ+NNFSG  P+ LS +L+ +DLSFNSFTG+IP  +QNLT LT L
Sbjct  121  RHLYLQQNNFSGVFPALLSLQLNVLDLSFNSFTGSIPPTIQNLTQLTAL  169



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +S ST+  +  +L +  ++++DL +DRQALL+FA+A PH R+LNW+   S+CTSWV
Sbjct  27   MKLLSSISTVVSLFFILPVVPQIIADLNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWV  86

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ +G+ VV + LPGVG  GPIP NTIGRL++L  LSLRSN L+G LPSD+ SLPSL
Sbjct  87   GITCNTNGTGVVAVHLPGVGLYGPIPANTIGRLNSLKILSLRSNSLNGKLPSDIPSLPSL  146

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            +++YLQ+NNFSG  P+ LS +L+ +DLSFNSFTG+IP  +QNLT LT L
Sbjct  147  RHLYLQQNNFSGVFPALLSLQLNVLDLSFNSFTGSIPPTIQNLTQLTAL  195



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +3

Query  213  YTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            + S S LPL   ++ L     +DL++D+QALLDFAS+ PH R L+W+   S+CTSWVGVT
Sbjct  3    FCSASVLPLFFVIINLLHLATADLESDKQALLDFASSVPHRRSLDWNDTTSVCTSWVGVT  62

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            CS DG+ V+ LRLPG+G  G IP NT+G+LD L  LSLRSNLLSG +PSD+ SLPSLQ +
Sbjct  63   CSADGTHVLTLRLPGIGLVGSIPSNTLGKLDGLKILSLRSNLLSGKIPSDITSLPSLQYL  122

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            YLQ NN SGD+PS+LSP L  ++LSFN   G IP  VQNLT LTGLN
Sbjct  123  YLQHNNLSGDVPSSLSPTLIVLNLSFNLLEGKIPKTVQNLTQLTGLN  169



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +S ST+  +  +L +  ++++DL +DRQALL+FA+A PH R+LNW+   S+CTSWV
Sbjct  26   MKLLSSISTVVSLFFILPVVPQIIADLNSDRQALLNFAAAVPHIRKLNWNASTSVCTSWV  85

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ +G+ VV + LPGVG  GPIP NTIGRL++L  LSLRSN L+G LPSD+ SLPSL
Sbjct  86   GITCNTNGTGVVAVHLPGVGLYGPIPANTIGRLNSLKILSLRSNSLNGKLPSDIPSLPSL  145

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            +++YLQ+NNFSG  P+ LS +L+ +DLSFNSFTG+IP  +QNLT LT L
Sbjct  146  RHLYLQQNNFSGVFPALLSLQLNVLDLSFNSFTGSIPPTIQNLTQLTAL  194



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  240  VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVE  419
            V+  L   + ++D+ +D+QALLDF SA PHGR++NW     +C SW G+TC+ DG+RV+ 
Sbjct  10   VILFLFLCRTIADINSDKQALLDFISAVPHGRKVNWDPANPVCKSWAGITCTLDGTRVLT  69

Query  420  LRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGD  599
            +RLPGVG  GPIP NT+G+LDAL  LSLRSN LSG++PSD+ SLPSL  IYLQ NN +G 
Sbjct  70   VRLPGVGLYGPIPANTLGKLDALMILSLRSNRLSGNVPSDIFSLPSLHYIYLQNNNLTGK  129

Query  600  IPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            IPS+L P L F+DLS NSFTGNIP  VQNLT L GL
Sbjct  130  IPSSLPPNLTFLDLSSNSFTGNIPATVQNLTRLNGL  165



>gb|EEE64112.1| hypothetical protein OsJ_18944 [Oryza sativa Japonica Group]
Length=638

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +DRQALL FA++ PHGR+LNW++   +CTSWVG+TC+ DG RV ELRLP VG  GP
Sbjct  25   ADLNSDRQALLAFAASVPHGRKLNWTLTTQVCTSWVGITCTPDGRRVRELRLPAVGLLGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP +T+G+LDAL  LSLRSN L+ SLP DV S+PSL ++YLQ NN SG IP++LS  L F
Sbjct  85   IPSDTLGKLDALQVLSLRSNRLTISLPPDVASIPSLHSLYLQHNNLSGIIPTSLSSNLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+KVQN+T LT L
Sbjct  145  LDLSYNSFDGEIPLKVQNITQLTAL  169



>ref|NP_001055854.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|AAT01376.1| putative phytosulfokine receptor kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17768.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|EAY98442.1| hypothetical protein OsI_20356 [Oryza sativa Indica Group]
 dbj|BAG99879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=638

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +DRQALL FA++ PHGR+LNW++   +CTSWVG+TC+ DG RV ELRLP VG  GP
Sbjct  25   ADLNSDRQALLAFAASVPHGRKLNWTLTTQVCTSWVGITCTPDGRRVRELRLPAVGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP +T+G+LDAL  LSLRSN L+ SLP DV S+PSL ++YLQ NN SG IP++LS  L F
Sbjct  85   IPSDTLGKLDALQVLSLRSNRLTISLPPDVASIPSLHSLYLQHNNLSGIIPTSLSSNLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+KVQN+T LT L
Sbjct  145  LDLSYNSFDGEIPLKVQNITQLTAL  169



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 ref|XP_004154555.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +3

Query  213  YTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            + S S LPL   ++ L    ++DL++D+QALLDFAS+ PH R LNW+    ICTSWVGVT
Sbjct  3    FCSASVLPLFFVIINLLHLAIADLESDKQALLDFASSVPHRRSLNWNDTTPICTSWVGVT  62

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            CS DG+ V+ LRLPG+G  G IP +T+G+LD L  LSLRSNLLSG +PSD+ SLPSLQ +
Sbjct  63   CSADGTHVLTLRLPGIGLVGSIPSDTLGKLDGLKILSLRSNLLSGIIPSDITSLPSLQYL  122

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            YLQ NN SGD+PS+LSP L  ++LSFN   G IP  VQNLT LTGLN
Sbjct  123  YLQHNNLSGDVPSSLSPTLVVLNLSFNLLEGKIPKTVQNLTQLTGLN  169



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            L+   S+L +++C+L       DL +D+QALL F++A PHGR+LNW+  + ICT+W+G+ 
Sbjct  25   LHVKLSSLFVIVCLLPV--ACGDLSSDKQALLAFSAAVPHGRKLNWNPASPICTTWIGIN  82

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            CS DG  V+ LRLPGVG +GPIP NT+G+L+AL  LSLRSN LSG+LPSD+LSLPSL  +
Sbjct  83   CSVDGRNVIGLRLPGVGLTGPIPNNTLGKLEALRVLSLRSNRLSGNLPSDILSLPSLHYL  142

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +LQ+NNFSGDIP+++SP+L  +DLSFNS TG+IP+ ++NLT LT L+
Sbjct  143  FLQKNNFSGDIPTSISPQLSVLDLSFNSLTGSIPLTIRNLTRLTALS  189



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            L+   S+L +++C+L       DL +D+QALL F++A PHGR+LNW+  + ICT+W+G+ 
Sbjct  6    LHVKLSSLFVIVCLLPV--ACGDLSSDKQALLAFSAAVPHGRKLNWNPASPICTTWIGIN  63

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            CS DG  V+ LRLPGVG +GPIP NT+G+L+AL  LSLRSN LSG+LPSD+LSLPSL  +
Sbjct  64   CSVDGRNVIGLRLPGVGLTGPIPNNTLGKLEALRVLSLRSNRLSGNLPSDILSLPSLHYL  123

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +LQ+NNFSGDIP+++SP+L  +DLSFNS TG+IP+ ++NLT LT L+
Sbjct  124  FLQKNNFSGDIPTSISPQLSVLDLSFNSLTGSIPLTIRNLTRLTALS  170



>ref|XP_003568238.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=634

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA++ PHG+++NW+    +CTSWVGVTC+ DG RV ELRLP +G  GP
Sbjct  25   ADLNSDKQALLAFAASLPHGKKINWTRTTQVCTSWVGVTCTPDGKRVRELRLPAIGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP N +G+LDAL  LSLRSN L+  LP DV S+PSL ++YLQRNN SG IP++LS  L F
Sbjct  85   IPSNILGKLDALQVLSLRSNRLTVGLPPDVASIPSLHSLYLQRNNLSGIIPTSLSSNLAF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+KVQN+T LTGL
Sbjct  145  LDLSYNSFNGEIPLKVQNMTQLTGL  169



>ref|XP_009370892.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009370912.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=639

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +3

Query  240  VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVE  419
            V+  L   + ++D+ +D+QALLDF SA PHGR++NW     +C SW G+TC+ DG+RV+ 
Sbjct  10   VILFLFLCRTIADINSDKQALLDFISAVPHGRKVNWDPANPVCKSWAGITCTLDGTRVLT  69

Query  420  LRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGD  599
            +RLPG G  GPIP NT+G+LDAL  LSLRSN LSG++PSD+ SLPSL  IYLQ NN +G+
Sbjct  70   VRLPGAGLYGPIPANTLGKLDALMILSLRSNRLSGNVPSDIFSLPSLHYIYLQNNNLTGN  129

Query  600  IPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            IPS+L P L F+DLS NSFTGNIP  VQNLT L GL
Sbjct  130  IPSSLPPNLTFLDLSSNSFTGNIPATVQNLTRLNGL  165



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 134/172 (78%), Gaps = 5/172 (3%)
 Frame = +3

Query  204  MKLYTS---FSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTS  374
            MKL ++    S+  +++C+L     + DL +DRQALL F++A PHGR+LNW+  + ICTS
Sbjct  8    MKLCSANILLSSFFVIVCLLPL--ALGDLNSDRQALLAFSAAVPHGRKLNWNAASPICTS  65

Query  375  WVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslp  554
            W+G+ CSEDG+ V+ +RLPGVG +GPIP  T+G+LD+L  LSLRSNLLSG+LPSD+LSLP
Sbjct  66   WIGINCSEDGTSVIGVRLPGVGLTGPIPNGTLGKLDSLKVLSLRSNLLSGNLPSDILSLP  125

Query  555  slQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SL  ++LQ NNF+GDIP+ +SP+L  +DLSFNS TG+IP  +QNLT LT L+
Sbjct  126  SLSYLFLQHNNFTGDIPTMISPQLAVLDLSFNSLTGSIPPTIQNLTQLTALS  177



>gb|KEH23299.1| LRR receptor-like kinase [Medicago truncatula]
Length=611

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSED  401
            F T+ + L +L+F +  SDL +++QALLDF +A  HG +LNWS   S+CTSWVGV C+ +
Sbjct  7    FVTIQIFLLLLVFPQTKSDLNSEKQALLDFITALHHGGKLNWSSNTSLCTSWVGVECNPN  66

Query  402  GSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQR  581
            GS V  +RLPGVG  G +PENTIG+L  LT+LSLRSN L G+LPSD+  +PSL+ IYLQ 
Sbjct  67   GSHVHSVRLPGVGLRGSLPENTIGKLHGLTSLSLRSNSLFGNLPSDIFFIPSLRFIYLQH  126

Query  582  NNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            NNFSG IP+ L P L F+DLS+NSFTG IP  +QNLT+L GLN
Sbjct  127  NNFSGHIPNYLPPHLLFLDLSYNSFTGKIPSIIQNLTYLLGLN  169



>ref|XP_006654545.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=638

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +DRQALL FA++ PHGR+LNW++   +CTSWVGVTC+ DG RV ELRLP VG  GP
Sbjct  25   ADLNSDRQALLTFAASLPHGRKLNWTLTTQVCTSWVGVTCTTDGKRVRELRLPAVGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP + +G+LDAL  LSLRSN L+ SLP DV S+PSL ++YLQ NN SG IP++LS  L F
Sbjct  85   IPSDILGKLDALQVLSLRSNRLTVSLPPDVASIPSLHSLYLQHNNLSGIIPTSLSSNLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+KVQN+T LT L
Sbjct  145  LDLSYNSFDGQIPLKVQNITQLTAL  169



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLL-FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL    + +  ++ +L  F  V++DL +DRQALL+FA++ PH R+LNW++   IC SW 
Sbjct  48   MKLQYLLAAVAFLISLLSNFPHVIADLDSDRQALLEFANSVPHIRKLNWNLTIPICKSWA  107

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC++DG+RV+ + LP VG  GPIP N+IG+LDAL  LSLR+N L+GSLPSD+ S+PSL
Sbjct  108  GITCNKDGTRVIAIHLPAVGLFGPIPANSIGKLDALKVLSLRANYLNGSLPSDLFSIPSL  167

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q++YLQ NNFSGDIP +LSP L  +DLSFNS TG IP  +++L+ L+ LN
Sbjct  168  QSVYLQHNNFSGDIPVSLSPRLGVLDLSFNSLTGKIPATIKSLSRLSVLN  217



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 131/169 (78%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK + + S+  L++   LF   ++DL +D+QALL+F++A PH R LNW+  +SIC SWVG
Sbjct  1    MKFFPA-SSFRLIVLFTLFSLAIADLNSDKQALLNFSAAIPHYRLLNWNPASSICKSWVG  59

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+   +RV+ELRLPGVGF G IP NT+G+LDAL  LSLRSNLL G+LPSDV SLPSL+
Sbjct  60   VTCNPSQTRVLELRLPGVGFIGQIPANTLGKLDALRVLSLRSNLLYGNLPSDVTSLPSLR  119

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N+YLQ NNFS  IP++ S +L+ +DLSFNSF+G+IP  + NLT LTGL+
Sbjct  120  NLYLQHNNFSSTIPTSFSSQLNVLDLSFNSFSGSIPQTIANLTQLTGLS  168



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 127/173 (73%), Gaps = 1/173 (1%)
 Frame = +3

Query  195  C*RMKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICT  371
            C  M++ +++  LP +L V  L    + DL +D+Q LL FASA PHG ++NWS    IC+
Sbjct  19   CFLMRICSAYQLLPALLVVATLLPLALGDLDSDKQVLLAFASAVPHGPKINWSPATPICS  78

Query  372  SWVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlsl  551
            SWVG+TCSED + VV +RLPGVG +GP+P NT G+LD+L  +SLR+N L+GSLP ++ SL
Sbjct  79   SWVGITCSEDRAHVVAVRLPGVGLTGPLPLNTFGKLDSLRIISLRANRLNGSLPVEITSL  138

Query  552  pslQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             SLQ ++LQ NNFSG IP++ S +L+ +DLS+NSF G IPV  QNLT L+GL+
Sbjct  139  SSLQYLFLQHNNFSGPIPASFSHKLNVLDLSYNSFIGKIPVTFQNLTQLSGLS  191



>dbj|BAK08005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +3

Query  201  RMKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
             + L  S S   L  C+L  +   +DL +D+QALL FA++ PHGR+LNWS    +CTSWV
Sbjct  3    HLTLAASLSAAVLFACILYAES--ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+ D SRV  LRLP VG  GPIP +T+G+LDAL  LSLRSN L+  LP DV S+PSL
Sbjct  61   GVTCTPDNSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSNRLTVDLPPDVGSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             ++YLQ NN SG IP+TLS  L F+DLS+N+F G IP++VQNLT LT +
Sbjct  121  HSLYLQHNNLSGIIPTTLSSSLTFLDLSYNTFDGEIPLRVQNLTGLTAI  169



>ref|XP_007011392.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20202.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  258  FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGV  437
            F +V++DL +DRQALLDFA+A PH R+LNW+  A +CTSWVGVTC  + +RV+ +RLPG+
Sbjct  24   FPQVLADLNSDRQALLDFAAAVPHARKLNWNATAPVCTSWVGVTCDLNRTRVIAIRLPGI  83

Query  438  GFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS  617
            G SGPIP NTIG+LDAL  LSLRSN LSG+LPSD+ S+PSL+ ++LQ NNFS   P++LS
Sbjct  84   GLSGPIPVNTIGKLDALGVLSLRSNNLSGNLPSDIPSIPSLRRLFLQYNNFSSVFPASLS  143

Query  618  PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            P L+ +D S+NSFTG IP  +QNLT L  LN
Sbjct  144  PRLNALDFSYNSFTGIIPTTLQNLTRLAILN  174



>ref|XP_007011393.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20203.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=634

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +3

Query  258  FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGV  437
            F +V++DL +DRQALLDFA+A PH R+LNW+  A +CTSWVGVTC  + +RV+ +RLPG+
Sbjct  24   FPQVLADLNSDRQALLDFAAAVPHARKLNWNATAPVCTSWVGVTCDLNRTRVIAIRLPGI  83

Query  438  GFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS  617
            G SGPIP NTIG+LDAL  LSLRSN LSG+LPSD+ S+PSL+ ++LQ NNFS   P++LS
Sbjct  84   GLSGPIPVNTIGKLDALGVLSLRSNNLSGNLPSDIPSIPSLRRLFLQYNNFSSVFPASLS  143

Query  618  PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            P L+ +D S+NSFTG IP  +QNLT L  LN
Sbjct  144  PRLNALDFSYNSFTGIIPTTLQNLTRLAILN  174



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK  ++  T  L + V+LF  V+ DL +D+QALLDFA+A PH R L W+   S+C SWVG
Sbjct  24   MKFLSTSVTSFLFVIVILFPLVIGDLSSDKQALLDFANAIPHRRNLMWNPSTSVCESWVG  83

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+E+ +RVV +RLPGVG  G IP N +G+LDA+  +SLRSNLLSG+LP+D+ SLPSLQ
Sbjct  84   ITCNENRTRVVNVRLPGVGLVGTIPSNILGKLDAVKIISLRSNLLSGNLPADIASLPSLQ  143

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SGDIP++LSP+L  +DLS+NSF+G IP   QN + LT LN
Sbjct  144  YLYLQHNNLSGDIPASLSPQLVVLDLSYNSFSGGIPETFQNFSELTSLN  192



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 116/158 (73%), Gaps = 0/158 (0%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L +  +L    +SDL +D+QALLDFA+A PH R L W    SICTSW+G+TC+++G+RVV
Sbjct  21   LFVIAILLPLAISDLNSDKQALLDFANAVPHRRNLMWDPSTSICTSWIGITCNQNGTRVV  80

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             +RLPG+G  G IP NT+G+LDA+  +SLRS       P+D+ SLPSLQ +YLQ NNFSG
Sbjct  81   NVRLPGIGLIGSIPSNTLGKLDAVKIISLRSXXXXXXXPADIASLPSLQYLYLQHNNFSG  140

Query  597  DIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            DIP++LS +L  +DLS+NSFTG IP  +QNLT L  L+
Sbjct  141  DIPTSLSDQLIVLDLSYNSFTGRIPKTLQNLTELNSLD  178



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 128/171 (75%), Gaps = 3/171 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLL--FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
            MKL  S   +P+ L  +L  F  VV+DL +D+QALLDFA A PH R+LNW+  A +C+SW
Sbjct  1    MKLQISM-VVPIFLFTVLPIFPTVVADLNSDKQALLDFADAVPHARKLNWNAAAPVCSSW  59

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            +GVTC+ + SRV+ + LPG+GF+GPIP N+IG+LDAL  LSLRSN L+G+LPSD+ S+ S
Sbjct  60   IGVTCNVNRSRVIGIHLPGIGFTGPIPANSIGKLDALKILSLRSNYLNGTLPSDITSISS  119

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            LQ +YLQ N FSG +P+  S +L+ +DLSFN+FTGNIP   QNLT L  LN
Sbjct  120  LQYVYLQNNYFSGVLPAFRSLQLNALDLSFNAFTGNIPPGFQNLTRLHLLN  170



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK++        ++  ++F    +DLK+D+QALLDFA+A PH R+LNW+  +S+C SWVG
Sbjct  1    MKIFLGSVIYFFIILTIIFPFAFADLKSDKQALLDFATAVPHLRKLNWNPASSVCNSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+ + +RV +LRLPGVG  G IP NT+G+LDAL  LSLRSN+L G LPSD+ SLPSL 
Sbjct  61   VTCNSNRTRVSQLRLPGVGLVGHIPPNTLGKLDALRVLSLRSNVLEGDLPSDITSLPSLT  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N++LQ NNFSG IP++ S +L+ +DLSFNSFTGNIP  + NLT L GL+
Sbjct  121  NLFLQHNNFSGGIPTSFSLQLNVLDLSFNSFTGNIPQTLANLTQLIGLS  169



>ref|XP_002520893.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF41602.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=581

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +S STL  +  +L +  ++++DL +D+QALLDFA+A PH R+LNW+   S+C+SW 
Sbjct  1    MKLQSSTSTLAFLFFILCIVPQIIADLNSDKQALLDFAAAVPHIRKLNWNTSISVCSSWF  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+ +G+RV+ + LPGVG  G IP NT+ RLDAL  LSLRSN L+G LPSD+ S+PSL
Sbjct  61   GVTCNSNGTRVMAIHLPGVGLYGRIPSNTLARLDALRILSLRSNYLNGHLPSDIPSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            Q +YLQ NNFSG  P+ LS +L+ +DLSFNSFTG IP  VQN + L+ L
Sbjct  121  QFLYLQHNNFSGAFPAALSLQLNVLDLSFNSFTGRIPATVQNSSQLSAL  169



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 128/170 (75%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL+++F+ L  +   L    ++++DL +DRQALLDFA + PH R+LNWS  A IC SW 
Sbjct  1    MKLHSTFAVLLFLFLQLSSLHQIIADLNSDRQALLDFAKSVPHLRKLNWSSGAQICRSWN  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC++D +RV  + LPGVG  GPIPENTIG+LD L  LSLRSN L+GSLPSD+LS+PSL
Sbjct  61   GITCNKDRTRVTAIHLPGVGLRGPIPENTIGKLDTLRILSLRSNYLNGSLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +++YL  NNFSG++P + SP L  +DLSFNSFTG IP  + NLT L+ LN
Sbjct  121  RSLYLHHNNFSGELPHSFSPRLGVMDLSFNSFTGEIPSTIMNLTRLSVLN  170



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 0/157 (0%)
 Frame = +3

Query  240  VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVE  419
            V+  L   + ++D+ +D+QALLDF S+ PHGRR+NW     +C SWVG+TC+ DG+RV+ 
Sbjct  10   VILFLFLCRTIADIDSDKQALLDFISSVPHGRRVNWDPANPVCKSWVGITCTLDGTRVLS  69

Query  420  LRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGD  599
            +RLPG    GPIP NT+GRLDAL  LSLRSN LSG+LPSD+ SLPSL+ IYLQ NN +G+
Sbjct  70   VRLPGARLFGPIPANTLGRLDALMILSLRSNGLSGNLPSDIFSLPSLRYIYLQNNNLTGN  129

Query  600  IPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            IPS+L+P L F+DLS NS TGNIP  +QN T L GLN
Sbjct  130  IPSSLTPSLIFLDLSSNSITGNIPATIQNFTRLRGLN  166



>ref|XP_011001671.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011001672.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=632

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+ L +DRQALL+FASA PH  +LNW     ICTSWVG+TC+  GSRV+ + LPGVG  G
Sbjct  23   VAALLSDRQALLEFASAVPHSPKLNWKSSIPICTSWVGITCNTKGSRVIAVHLPGVGLYG  82

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP  T+G+LD+LT LSLRSN LSG LP+D+LSLPSL ++YLQ NNFSG+IPS+ SP   
Sbjct  83   PIPAKTLGKLDSLTILSLRSNFLSGDLPADLLSLPSLHSMYLQHNNFSGNIPSSFSPRTS  142

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLSFNSFTG IP  +QNLTHLT L+
Sbjct  143  MLDLSFNSFTGLIPAAIQNLTHLTSLS  169



>gb|EYU36891.1| hypothetical protein MIMGU_mgv1a0177022mg, partial [Erythranthe 
guttata]
Length=369

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL ++ QALL F++ATPHGR+LNWS    +CTSW+G+ CS DG+ VV LRLPGVG +GP
Sbjct  10   ADLSSETQALLAFSTATPHGRKLNWSPALPVCTSWIGINCSTDGTTVVGLRLPGVGLTGP  69

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP+NT+G+L +L  LSLRSN LSGSLP D+LSLPSL  ++LQ NNFSGDIP++LSP+L+ 
Sbjct  70   IPQNTLGKLTSLKVLSLRSNRLSGSLPPDILSLPSLNYLFLQNNNFSGDIPASLSPQLNV  129

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLSFNS TG IP+  +NLT L  L
Sbjct  130  LDLSFNSLTGAIPLTFRNLTQLAAL  154



>ref|XP_011001674.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=631

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+ L +DRQALL+FASA PH  +LNW     ICTSWVG+TC+  GSRV+ + LPGVG  G
Sbjct  23   VAALLSDRQALLEFASAVPHSPKLNWKSSIPICTSWVGITCNTKGSRVIAVHLPGVGLYG  82

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP  T+G+LD+LT LSLRSN LSG LP+D+LSLPSL ++YLQ NNFSG+IPS+ SP   
Sbjct  83   PIPAKTLGKLDSLTILSLRSNFLSGDLPADLLSLPSLHSMYLQHNNFSGNIPSSFSPRTS  142

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLSFNSFTG IP  +QNLTHLT L+
Sbjct  143  MLDLSFNSFTGLIPAAIQNLTHLTSLS  169



>gb|EMT17815.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=634

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +3

Query  201  RMKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
             + L  S S   L  C+L  +   +DL +D+QALL FA++ PHGR+LNWS    +CTSWV
Sbjct  3    HLTLAASLSAAVLFACILYAES--ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+ D SRV  LRLP VG  GPIP +T+G+LDAL  LSLRSN L+  LP DV S+PSL
Sbjct  61   GVTCTPDNSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSNRLTVDLPPDVGSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             ++YLQ NN SG IP+TLS  L F+DLS+N+F G IP++VQNLT LT +
Sbjct  121  HSLYLQHNNLSGIIPTTLSSSLTFLDLSYNTFDGEIPLRVQNLTGLTAI  169



>gb|KEH35517.1| receptor-like kinase [Medicago truncatula]
Length=635

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 130/169 (77%), Gaps = 3/169 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVS--DLKADRQALLDFASATPHGRRLNWSMKASICTS  374
            MKL  S  +L L++  L LF  +VS  DL +DRQALL+FASA PH  RLNW+  +SICTS
Sbjct  1    MKLQLSNVSLVLLISTLSLFGLIVSAADLNSDRQALLEFASAVPHAPRLNWNESSSICTS  60

Query  375  WVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslp  554
            WVGVTC+ + +RVV + LPG+G +G IPENTIG+LDAL  LSL SN L G+LPS++LS+P
Sbjct  61   WVGVTCNSNHTRVVGIHLPGIGLTGSIPENTIGKLDALRVLSLHSNGLGGNLPSNILSIP  120

Query  555  slQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLT  701
            SLQ  +LQ+NNFSG IPS++SP+L  +D+SFNSF+G+IP   QNL  LT
Sbjct  121  SLQFAHLQKNNFSGLIPSSVSPKLVALDISFNSFSGSIPSAFQNLRRLT  169



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK++        V+  ++F    +DLK+D+QALLDFA+A PH R+LNW+  +S+C SWVG
Sbjct  1    MKIFLGSVIYFFVILTIIFPFAFADLKSDKQALLDFATAVPHLRKLNWNPASSVCNSWVG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+ + +RV +LRLPGVG  G IP NT+G+LDAL  LSLRSN+L G LPS++ SLPSL 
Sbjct  61   VTCNSNRTRVSQLRLPGVGLVGRIPPNTLGKLDALRVLSLRSNVLEGDLPSEITSLPSLT  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N++LQ NNFSG IP++ S +L+ +DLSFNSF GNIP  + NLT L GL+
Sbjct  121  NLFLQHNNFSGGIPTSFSLQLNVLDLSFNSFAGNIPQTLANLTQLIGLS  169



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK +++     L + V+LF   ++DL +D+QALLDFA+A PH R L W+   S+CTSWVG
Sbjct  37   MKFHSTSVASFLFVIVILFPLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVG  96

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+E+ +RVV++RLPGVG  G IP NT+G+L A+  +SLRSNLLSG+LP+D+ SLPSLQ
Sbjct  97   ITCNENRTRVVKVRLPGVGLVGTIPSNTLGKLGAVKIISLRSNLLSGNLPADIGSLPSLQ  156

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SGDIP++LS +L  +DLS+NSFTG IP   QNL+ LT LN
Sbjct  157  YLYLQHNNLSGDIPASLSLQLVVLDLSYNSFTGVIPTTFQNLSELTSLN  205



>gb|KJB20519.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=460

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 122/169 (72%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK   S     LV+  +    +V+DL +D+QALL+F +A PH R LNW+    ICT+WVG
Sbjct  20   MKFCMSSVFYFLVIITIFLPLIVADLNSDKQALLEFHAAVPHRRNLNWNSTNPICTTWVG  79

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC++D S V+ LRLPGVGF G IP NT+G+L AL  LSLRSN   G LPSD+ +LPSLQ
Sbjct  80   ITCAQDNSSVLALRLPGVGFIGRIPSNTLGKLGALKILSLRSNRFIGDLPSDITTLPSLQ  139

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNF+GD+P++ S +L+ +DLSFNSFTGNI   +QNLT LT LN
Sbjct  140  YLYLQHNNFTGDLPASFSLQLNVLDLSFNSFTGNISETIQNLTSLTRLN  188



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK +++     L + V+LF   ++DL +D+QALLDFA+A PH R L W+   S+CTSWVG
Sbjct  24   MKFHSTSVASFLFVIVILFPLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVG  83

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+E+ +RVV++RLPGVG  G IP NT+G+L A+  +SLRSNLLSG+LP+D+ SLPSLQ
Sbjct  84   ITCNENRTRVVKVRLPGVGLVGTIPSNTLGKLGAVKIISLRSNLLSGNLPADIGSLPSLQ  143

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SGDIP++LS +L  +DLS+NSFTG IP   QNL+ LT LN
Sbjct  144  YLYLQHNNLSGDIPASLSLQLVVLDLSYNSFTGVIPTTFQNLSELTSLN  192



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK +++     L + V+LF   ++DL +D+QALLDFA+A PH R L W+   S+CTSWVG
Sbjct  38   MKFHSTSVASFLFVIVILFPLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVG  97

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+E+ +RVV++RLPGVG  G IP NT+G+L A+  +SLRSNLLSG+LP+D+ SLPSLQ
Sbjct  98   ITCNENRTRVVKVRLPGVGLVGTIPSNTLGKLGAVKIISLRSNLLSGNLPADIGSLPSLQ  157

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SGDIP++LS +L  +DLS+NSFTG IP   QNL+ LT LN
Sbjct  158  YLYLQHNNLSGDIPASLSLQLVVLDLSYNSFTGVIPTTFQNLSELTSLN  206



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK +++     L + V+LF   ++DL +D+QALLDFA+A PH R L W+   S+CTSWVG
Sbjct  10   MKFHSTSVASFLFVIVILFPLAIADLSSDKQALLDFANAVPHRRNLMWNPSTSVCTSWVG  69

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+E+ +RVV++RLPGVG  G IP NT+G+L A+  +SLRSNLLSG+LP+D+ SLPSLQ
Sbjct  70   ITCNENRTRVVKVRLPGVGLVGTIPSNTLGKLGAVKIISLRSNLLSGNLPADIGSLPSLQ  129

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SGDIP++LS +L  +DLS+NSFTG IP   QNL+ LT LN
Sbjct  130  YLYLQHNNLSGDIPASLSLQLVVLDLSYNSFTGVIPTTFQNLSELTSLN  178



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLL--FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
            MKL  S   +P+ L  +L  F  VV+DL +D+QALLDFA A PH R+LNW+  A +C+SW
Sbjct  1    MKLQISM-VVPIFLFTVLPIFPTVVADLNSDKQALLDFADAVPHARKLNWNAAAPVCSSW  59

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            +GVTC+ + SRV+ + LPG+GF+GPIP N+IG+LDAL  LSLRSN L+G+LPSD+ S+ S
Sbjct  60   IGVTCNVNRSRVIGIHLPGIGFTGPIPANSIGKLDALKILSLRSNYLNGTLPSDITSISS  119

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            LQ +YLQ N FSG +P+  S +L+ +DLSFN+FTGNIP   QNL  L  LN
Sbjct  120  LQYVYLQNNYFSGVLPAFRSLQLNALDLSFNAFTGNIPPGFQNLARLHLLN  170



>gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            + + + LF    +DL +D+QALL+F++A PH R LNW+  +S+C SWVGVTC  + +RV+
Sbjct  10   IFVLIPLFPLANADLNSDKQALLNFSAAVPHRRLLNWNSTSSVCNSWVGVTCDSNHTRVI  69

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             LRLPGVGF G IP NT+ +LDAL  LSLRSNLL G LPSD+ SLPSL  +YLQRNNFSG
Sbjct  70   RLRLPGVGFVGHIPANTLSKLDALRVLSLRSNLLYGDLPSDITSLPSLHYLYLQRNNFSG  129

Query  597  DIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             IP++ S +L+ +DLSFNSF+GNIP  + NLT LTGLN
Sbjct  130  KIPTSFSSQLNVLDLSFNSFSGNIPQTIANLTQLTGLN  167



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLL--FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
            MKL  S   +P+ L  +L  F  VV+DL +D+QALLDFA A PH R+LNW+  A +C+SW
Sbjct  12   MKLQISM-VVPIFLFTVLPIFPTVVADLNSDKQALLDFADAVPHARKLNWNAAAPVCSSW  70

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            +GVTC+ + SRV+ + LPG+GF+GPIP N+IG+LDAL  LSLRSN L+G+LPSD+ S+ S
Sbjct  71   IGVTCNVNRSRVIGIHLPGIGFTGPIPANSIGKLDALKILSLRSNYLNGTLPSDITSISS  130

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            LQ +YLQ N FSG +P+  S +L+ +DLSFN+FTGNIP   QNL  L  LN
Sbjct  131  LQYVYLQNNYFSGVLPAFRSLQLNALDLSFNAFTGNIPPGFQNLARLHLLN  181



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y+    + L   ++L   V++DL +D+QALLDFASA PH R L W    SICT+WVG
Sbjct  22   MKFYSPSLQVFLFTIIILSPLVIADLNSDKQALLDFASAIPHRRNLKWDSATSICTAWVG  81

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+ + +RVV +RLPGVG  G IP +T+G++D+L T+SLRSNLLSGSLP D+ SLPSLQ
Sbjct  82   ITCNPNQTRVVSVRLPGVGLVGTIPADTLGKIDSLKTISLRSNLLSGSLPPDITSLPSLQ  141

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SG+IP++LSP+L+ + LS+NSFTG+IP  +QNLT LT L+
Sbjct  142  YLYLQHNNLSGEIPTSLSPQLNTLVLSYNSFTGSIPKTLQNLTQLTRLS  190



>ref|XP_004502808.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502809.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502810.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=644

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 130/171 (76%), Gaps = 3/171 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVS--DLKADRQALLDFASATPHGRRLNWSMKASICTS  374
            MKL  S ++L L++  L LF  +V+  DL +DRQALL+FASA PH  RLNW+    ICTS
Sbjct  1    MKLQFSIASLVLLISTLSLFGLIVASADLNSDRQALLEFASAVPHAPRLNWNDSFPICTS  60

Query  375  WVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslp  554
            WVGVTC+ + +RVV L LPG+G +G IPENTIG+LDAL  LSL SN L G+LPS++LS+P
Sbjct  61   WVGVTCNSNQTRVVGLHLPGIGLTGSIPENTIGKLDALRVLSLHSNGLKGNLPSNILSIP  120

Query  555  slQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            SLQ  +LQ+NNFSG IPS++SP+L  +D+SFNSF+G+IP   QNL  LT L
Sbjct  121  SLQFAHLQKNNFSGPIPSSVSPKLIALDISFNSFSGSIPPAFQNLRRLTWL  171



>ref|XP_011095165.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011095166.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=643

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            ++DLK+D QALLDFASA  H  +LNW   +S+C+SWVGV+C+ D +RV+ LRLP  G  G
Sbjct  30   IADLKSDTQALLDFASAVAHAPKLNWKNTSSVCSSWVGVSCTSDATRVMALRLPAFGLIG  89

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP+NT+GRLDAL TLSLRSN L+ +LPSD+LSL SL+ I LQ N+FSG IPS LS  L+
Sbjct  90   PIPQNTLGRLDALITLSLRSNYLNATLPSDLLSLASLRYINLQHNHFSGHIPSFLSTHLN  149

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGL  707
             ID SFNS TGNIP+ +QNLT+LT L
Sbjct  150  VIDFSFNSLTGNIPLTIQNLTYLTTL  175



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
             ++DL +DRQALL FA++ PH RRLNW+    IC SWVGVTC+ DG+RV+ LRLPG+G  
Sbjct  41   AIADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTRVLALRLPGIGLL  100

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            GPIP NT+G+L++L  LSLRSNLLSG LP D+ SLPSL  IYLQ NNFSG++P  +SP+L
Sbjct  101  GPIPPNTLGKLESLRILSLRSNLLSGYLPPDIHSLPSLDYIYLQHNNFSGEVPPFVSPQL  160

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            + +DLSFNSFTG IP   Q L  LTGL+
Sbjct  161  NILDLSFNSFTGKIPATFQKLKQLTGLS  188



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score =   158 bits (400),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 6/176 (3%)
 Frame = +3

Query  201  RMKLYTSFS-TLPLVLCV-LLF---QKVVSDLKADRQALLDFASATPHGRRLNWSMKASI  365
            RM+LY  F  TL  V  V +LF       +DL +D+QALL F +A PH RRLNW+    +
Sbjct  24   RMQLYLQFGYTLRSVFLVSILFTLSSLAAADLVSDQQALLAFVAAVPHRRRLNWNSTNHV  83

Query  366  CTSWVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvl  545
            C SWVGVTC+ DG+RV+ LRLPG+G  GPIP NT+G+LD+L  LSLRSNLLSG LP D+ 
Sbjct  84   CKSWVGVTCTPDGARVLALRLPGIGLVGPIPPNTLGKLDSLRVLSLRSNLLSGHLPPDIP  143

Query  546  slpslQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIP-VKVQNLTHLTGLN  710
            S+PSL  ++LQ NNFSG+IPS+ SP L+ +DLSFNSF G IP   +QNLT LTGL+
Sbjct  144  SIPSLHYLFLQHNNFSGEIPSSFSPRLNILDLSFNSFMGKIPAAALQNLTQLTGLS  199



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            L +S   L   L   LF   ++DL +DRQALL FA++ PH RRLNW+    IC SWVGVT
Sbjct  16   LKSSKCFLSACLVSFLFVTSIADLNSDRQALLAFAASAPHLRRLNWNSTNHICKSWVGVT  75

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C+ DG+RV+ LRLPG+G  GPIP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL+ +
Sbjct  76   CTSDGTRVLALRLPGIGLVGPIPPNTLGKLESLRILSLRSNLLSGNLPPDLPSLPSLRYL  135

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +LQ NNFSG++PS LS +L+ +DLSFNSFTG IP  +QN   LTGL+
Sbjct  136  FLQHNNFSGEVPSFLSSQLNVLDLSFNSFTGKIPKTLQNQKQLTGLS  182



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y+S     L + V+LF   ++DL +D+QALLDFA+A PH R L W+    IC+SWVG
Sbjct  22   MKFYSSQVHRFLFIIVILFPLAIADLSSDKQALLDFAAAVPHRRNLKWNPATPICSSWVG  81

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+ +G+RVV +RLPG+G  G IP NT+G++D+L  +SLR+NLLSGSLP D+ SLPSLQ
Sbjct  82   ITCNPNGTRVVSVRLPGIGLVGTIPANTLGKIDSLRNISLRANLLSGSLPPDITSLPSLQ  141

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SG +P++LS  L+ +DLS+NSF+G IP  +QN+T L  LN
Sbjct  142  YLYLQHNNLSGSVPTSLSTRLNVLDLSYNSFSGAIPKTLQNITQLIKLN  190



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            L      +DL +DRQALL FAS+ PH RRLNW+    IC SWVGVTC+ DG+RV+ LRLP
Sbjct  34   LFVTTATADLNSDRQALLAFASSVPHLRRLNWNSTNQICKSWVGVTCTSDGTRVLALRLP  93

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPST  611
            G+G  GPIP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL  IYLQ NNFSG++P  
Sbjct  94   GIGLLGPIPPNTLGKLESLRILSLRSNLLSGNLPPDIHSLPSLDYIYLQHNNFSGEVPPF  153

Query  612  LSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +SP+L+ +DLSFNSFTG IP   Q L  LTGL+
Sbjct  154  VSPQLNILDLSFNSFTGKIPETFQKLKQLTGLS  186



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   157 bits (398),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 123/169 (73%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            ++L   F +  LV   L      +DL +DRQALL FA++ PH RRLNW+    IC SWVG
Sbjct  19   LRLSKEFLSACLV-SFLFVTTATADLNSDRQALLAFAASVPHLRRLNWNSTNQICKSWVG  77

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+ DG+RV+ LRLPG+G  GPIP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL 
Sbjct  78   VTCTSDGTRVLALRLPGIGLLGPIPPNTLGKLESLKILSLRSNLLSGNLPPDIHSLPSLD  137

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             IYLQ NNFSG++P  +SP+L+ +DLSFNSFTG IP   Q L  LTGL+
Sbjct  138  YIYLQHNNFSGEVPPFVSPQLNILDLSFNSFTGKIPETFQKLKQLTGLS  186



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL    +T+  +L +L +   ++++L +D+ ALL FA++ PH R+LNW+   SIC SW+
Sbjct  1    MKLQDLRATIVFLLSLLAILPHIIANLDSDKHALLQFAASVPHLRKLNWNSALSICNSWI  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC++DG+RVV + LPGVG +G IP N+IG+LDAL  LSLR+N L+G+LPSD+LS+PSL
Sbjct  61   GITCNKDGTRVVAIHLPGVGLTGHIPANSIGKLDALQVLSLRANNLNGNLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +IYLQ NNFSGDIP + S  L  +DLSFNSFTG IP K++NL  L+ LN
Sbjct  121  YSIYLQHNNFSGDIPVSFSSTLGVVDLSFNSFTGEIPPKIKNLPRLSMLN  170



>ref|XP_008366817.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
 ref|XP_008366818.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=636

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  240  VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVE  419
            V+  L   + ++D+ +D++ALLDF SA PHGRR+NW     +C SWVG+TC+ DG+RVV 
Sbjct  10   VILFLFLCRTIADIDSDKKALLDFISAVPHGRRVNWDPANPVCKSWVGITCTLDGTRVVS  69

Query  420  LRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGD  599
            +RLPG G  GPIP NT+G+LDAL  LSLRSN L G+LPSD+ SLPSL+ I LQ NN +G+
Sbjct  70   VRLPGAGLFGPIPANTLGKLDALMILSLRSNGLGGNLPSDIFSLPSLRYIXLQNNNLTGN  129

Query  600  IPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            IPS+LSP L F+DLS NS TG IP  +QN T L GLN
Sbjct  130  IPSSLSPNLIFLDLSSNSITGXIPATIQNFTRLXGLN  166



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L + V+ F   ++DL +D+QALL+FA+A PH R L W+   S+C+SWVG+TC+E+ +RVV
Sbjct  49   LFVIVIFFPLAIADLSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNENRTRVV  108

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
            ++RLPGVG  G IP NT+G+LDA+  +SLRSNLLSG+LP+D+ SLPSLQ +YLQ NN SG
Sbjct  109  KVRLPGVGLVGTIPSNTLGKLDAVKIISLRSNLLSGNLPADIGSLPSLQYLYLQHNNLSG  168

Query  597  DIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            DIP++LSP+L  +DLS+NSFTG IP   QN++ LT LN
Sbjct  169  DIPASLSPQLIVLDLSYNSFTGVIPKTFQNMSVLTSLN  206



>ref|XP_006374053.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP51850.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+ L +DRQALL+FASA PH  +LNW+    ICTSWVG+ C+ +GSRVV + LPGVG  G
Sbjct  22   VAALLSDRQALLEFASAVPHSPKLNWNSSTPICTSWVGIACNTEGSRVVAVHLPGVGLYG  81

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP  T+G+LD+LT LSLRSN LSG LP+D+LSLPSL +IYLQ NNFSG+IPS+ SP   
Sbjct  82   PIPAKTLGKLDSLTILSLRSNFLSGDLPADLLSLPSLHSIYLQHNNFSGNIPSSFSPRTS  141

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLSFNSFTG IP  +QNLT LT L+
Sbjct  142  MLDLSFNSFTGLIPAAMQNLTRLTSLS  168



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L + V+ F   ++DL +D+QALL+FA+A PH R L W+   S+C+SWVG+TC+E+ +RVV
Sbjct  48   LFVIVIFFPLAIADLSSDKQALLNFANAVPHRRNLMWNPSTSVCSSWVGITCNENRTRVV  107

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
            ++RLPGVG  G IP NT+G+LDA+  +SLRSNLLSG+LP+D+ SLPSLQ +YLQ NN SG
Sbjct  108  KVRLPGVGLVGTIPSNTLGKLDAVKIISLRSNLLSGNLPADIGSLPSLQYLYLQHNNLSG  167

Query  597  DIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            DIP++LSP+L  +DLS+NSFTG IP   QN++ LT LN
Sbjct  168  DIPASLSPQLIVLDLSYNSFTGVIPKTFQNMSVLTSLN  205



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 125/169 (74%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y       L + V+L   V +DL +D+QALLDFA+A PH R L W+   SICTSWVG
Sbjct  22   MKFYFPRVHPFLFIIVILCPMVFADLSSDKQALLDFAAAVPHRRDLKWNPATSICTSWVG  81

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTC+ +G+RVV +RLPG+G  G IP NT+G++D+L  +SLR+NLLSGSLP D+ SLPSL+
Sbjct  82   VTCNPNGTRVVSVRLPGIGLVGTIPANTLGKIDSLKNISLRANLLSGSLPPDISSLPSLE  141

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SG+IP++LS  L+ +DLS+N FTG IP  +QNLT LT LN
Sbjct  142  YLYLQHNNLSGNIPTSLSTHLNVLDLSYNCFTGAIPKTLQNLTQLTRLN  190



>gb|EMT10528.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=640

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FAS+ P  R++NW++   +CTSWVGVTC+ DG RV  LRLP VG  GP
Sbjct  25   ADLNSDKQALLAFASSLPRARKINWTLTTQVCTSWVGVTCTPDGKRVRMLRLPAVGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            +P N +G+LDAL  LSLRSN L+ SLP DV S+PSL ++YLQRNN SG IP++LS  L +
Sbjct  85   MPSNILGKLDALEVLSLRSNRLTVSLPPDVASIPSLHSLYLQRNNLSGIIPTSLSSNLAY  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLS+NSF G IP+KVQN+T LTGL+
Sbjct  145  LDLSYNSFVGEIPLKVQNMTELTGLS  170



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK   S     LV+  +    +V+DL +D+QALL+F +A PH R LNW+    ICTSWVG
Sbjct  20   MKFCMSSVFYFLVIISIFLPLIVADLNSDKQALLEFHAAVPHRRNLNWNSTNPICTSWVG  79

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC++D S V+ LRLPGVGF G IP NT+G+L AL  LSLRSN  +G LPSD+ +LPSLQ
Sbjct  80   ITCTQDNSSVLALRLPGVGFIGRIPSNTLGKLGALNILSLRSNRFNGDLPSDITTLPSLQ  139

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNF+GD+P++ S +L+ +DLSFNSFTGNI   +QNLT LT LN
Sbjct  140  YLYLQHNNFTGDLPASFSLQLNVLDLSFNSFTGNISEAIQNLTSLTRLN  188



>ref|XP_010109178.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC21107.1| putative inactive receptor kinase [Morus notabilis]
Length=635

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 129/170 (76%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLP-LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL++S + L  L   + +F  V++DLK+DRQALL+F+++  H +RLNW+    +C+SW+
Sbjct  1    MKLHSSIAALSSLFFTISVFSPVLADLKSDRQALLNFSASIIHTKRLNWNASTPVCSSWI  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+  G+RVV +RLPG+G +G IP N+IG+L AL  LSLRSNLL+G+LPSD+ S+PSL
Sbjct  61   GVTCNAKGTRVVSIRLPGIGLAGSIPANSIGKLHALRDLSLRSNLLNGNLPSDIPSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q +YLQRNNFSG++PST S +L   DLS NS +GNIP  +QNLT L  L 
Sbjct  121  QFLYLQRNNFSGELPSTFSHKLVVFDLSSNSISGNIPTTIQNLTRLAKLK  170



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 122/169 (72%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK   S     LV+  +    +V+DL +D+QALL+F +A PH R LNW+    ICT+WVG
Sbjct  20   MKFCMSSVFYFLVIITIFLPLIVADLNSDKQALLEFHAAVPHRRNLNWNSTNPICTTWVG  79

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC++D S V+ LRLPGVGF G IP NT+G+L AL  LSLRSN   G LPSD+ +LPSLQ
Sbjct  80   ITCAQDNSSVLALRLPGVGFIGRIPSNTLGKLGALKILSLRSNRFIGDLPSDITTLPSLQ  139

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNF+GD+P++ S +L+ +DLSFNSFTGNI   +QNLT LT LN
Sbjct  140  YLYLQHNNFTGDLPASFSLQLNVLDLSFNSFTGNISETIQNLTSLTRLN  188



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = +3

Query  204  MKLYTSFS-TLPLVLCV-LLF---QKVVSDLKADRQALLDFASATPHGRRLNWSMKASIC  368
            M+LY  F  TL  V  V +LF       +DL +D+QALL F +A PH RRLNW+    +C
Sbjct  1    MQLYLQFGYTLRSVFLVSILFTLSSLAAADLVSDQQALLAFVAAVPHRRRLNWNSTNHVC  60

Query  369  TSWVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvls  548
             SWVGVTC+ DG+RV+ LRLPG+G  GPIP NT+G+LD+L  LSLRSNLLSG LP D+ S
Sbjct  61   KSWVGVTCTPDGARVLALRLPGIGLVGPIPPNTLGKLDSLRVLSLRSNLLSGHLPPDIPS  120

Query  549  lpslQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIP-VKVQNLTHLTGLN  710
            +PSL  ++LQ NNFSG+IPS+ SP L+ +DLSFNSF G IP   +QNLT LTGL+
Sbjct  121  IPSLHYLFLQHNNFSGEIPSSFSPRLNILDLSFNSFMGKIPAAALQNLTQLTGLS  175



>ref|XP_004961732.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=632

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA++ PHGR+LNW+    +CTSWVG+TC+ +G RV E+RLP +G  GP
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWTSTTQVCTSWVGITCTPNGKRVREVRLPAIGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP  T+G+LDAL  LSLRSN L+ +LP DV S+PSL ++YLQ NN SG IPSTLS  L F
Sbjct  85   IPGGTLGKLDALEVLSLRSNRLTINLPPDVASIPSLHSLYLQHNNLSGIIPSTLSSSLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+KVQ++T LT L
Sbjct  145  LDLSYNSFNGEIPLKVQDITELTAL  169



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 121/149 (81%), Gaps = 2/149 (1%)
 Frame = +3

Query  264  KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGF  443
            + +++L +D+QALL+F +A PH ++LNWS   S+CTSW+G+TC  +GS V+ +RLPGVG 
Sbjct  21   QTIANLYSDKQALLNFVAAVPHSQKLNWSSTTSVCTSWIGITC--NGSHVLAVRLPGVGL  78

Query  444  SGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPE  623
             G IP NT+G+LD L TLSLRSN L+G LPSD+LSLPSLQ ++LQ NNFSG IPS+LSP+
Sbjct  79   YGHIPANTLGKLDGLMTLSLRSNRLNGDLPSDMLSLPSLQYVFLQHNNFSGTIPSSLSPQ  138

Query  624  LDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ +DLSFN F+GNIP  +QNLT+LT LN
Sbjct  139  LNSLDLSFNFFSGNIPATIQNLTNLTSLN  167



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+DL +D+QALL FA++ PH RRLNW+    IC SWVGVTC+ DG+RV+ LRLPG+G  G
Sbjct  44   VADLNSDKQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVLALRLPGIGLVG  103

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
             IP NT+G+L++LTTLSLRSNLL G+LP D+ SLPSL  +YLQ NNFSG++PS LS  LD
Sbjct  104  QIPPNTLGKLESLTTLSLRSNLLGGNLPPDIPSLPSLAYLYLQHNNFSGEVPSFLSQHLD  163

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLSFNSFTG IP  +QN   LT L+
Sbjct  164  ILDLSFNSFTGKIPEALQNQKKLTALS  190



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            ++DL +DRQALL FA++ PH RRLNW+    IC SWVGVTC+ DG  V  LRLPG+G  G
Sbjct  42   IADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGLSVHALRLPGIGLLG  101

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL  I+LQ NNFSG++PS +SP+L+
Sbjct  102  PIPPNTLGKLESLRILSLRSNLLSGNLPPDIHSLPSLDYIFLQHNNFSGEVPSFVSPQLN  161

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLSFNSFTG IP   QNL  LTGL+
Sbjct  162  ILDLSFNSFTGKIPATFQNLKQLTGLS  188



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = +3

Query  231  LPLVLCVLLFQKV-VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGS  407
            +PL + VL  Q + + +L +D QALL FA++ PHGR+LNWS + S+C+SWVGVTC+ D +
Sbjct  9    IPLNILVLCLQALAIGNLTSDMQALLKFAASIPHGRKLNWSSRTSVCSSWVGVTCTPDQT  68

Query  408  RVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNN  587
            RV  LRLPGVG  G +P +++G+LDAL  LSLRSN L   L  DV S+PSL ++YLQ N 
Sbjct  69   RVRSLRLPGVGLLGQVPTDSLGKLDALEVLSLRSNRLVADLSPDVPSIPSLHSLYLQHNK  128

Query  588  FSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             SG+IPS+LS +L F+DLS+NSF G IP+ +QNLT LT L
Sbjct  129  LSGNIPSSLSSKLTFLDLSYNSFMGEIPLSIQNLTQLTAL  168



>emb|CDX88667.1| BnaA03g09820D [Brassica napus]
Length=625

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
             V+DL +D+QALL FA++ PH RRLNW+    IC SWVGVTC+ DG+RV+ LRLPG+G  
Sbjct  43   AVADLNSDKQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVLALRLPGIGLV  102

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP NT+G+L++LTTLSLRSNLL G+LP D+ SLPSL  +YLQ NNFSG++PS LS  L
Sbjct  103  GQIPPNTLGKLESLTTLSLRSNLLGGNLPPDIPSLPSLAYLYLQHNNFSGEVPSFLSQHL  162

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            D +DLSFNSFTG IP  +QN   LT L+
Sbjct  163  DILDLSFNSFTGKIPEALQNQKKLTALS  190



>ref|XP_002864562.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            ++DL +DRQALL FA++ PH RRLNW+    IC SWVGVTC+ DG  V  LRLPG+G  G
Sbjct  42   IADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGLSVHALRLPGIGLLG  101

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL  I+LQ NNFSG++PS +SP+L+
Sbjct  102  PIPPNTLGKLESLRILSLRSNLLSGNLPPDIHSLPSLDYIFLQHNNFSGEVPSFVSPQLN  161

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLSFNSFTG IP   QNL  LTGL+
Sbjct  162  ILDLSFNSFTGKIPATFQNLKQLTGLS  188



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +DRQALL FA++ PH RRLNW+    IC SW GVTC+ DG+RV+ LRLPG+G  GP
Sbjct  46   ADLNSDRQALLAFAASVPHLRRLNWNSTNQICKSWFGVTCTSDGTRVLALRLPGIGLLGP  105

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL  IYLQ NNFSG++P  +SP+L+ 
Sbjct  106  IPPNTLGKLESLKILSLRSNLLSGNLPPDIHSLPSLDYIYLQHNNFSGEVPPFVSPQLNI  165

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLSFNSFTG IP   Q L  LTGL+
Sbjct  166  LDLSFNSFTGKIPETFQKLKQLTGLS  191



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            + DL +DRQALL+FA+A PHG ++NW+    IC+SWVG+TCS DG+ VV +RLPGVG  G
Sbjct  24   LGDLNSDRQALLNFAAAVPHGLKINWNPATPICSSWVGITCSTDGAHVVAVRLPGVGLVG  83

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            P+PENT+G++DA+  LSLRSN LSG+LPSD+ SLPSLQ ++LQ NN SG IPS+ S +L 
Sbjct  84   PLPENTLGKMDAVRILSLRSNRLSGNLPSDITSLPSLQYLFLQHNNLSGPIPSSFSNKLS  143

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLS NSF G IPV +QNLT LT L+
Sbjct  144  VLDLSHNSFIGKIPVTIQNLTQLTSLS  170



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 127/169 (75%), Gaps = 0/169 (0%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y+  +   L + V+L   V++DL +D+QALLDFA+A PH R L W+    IC+SWVG
Sbjct  22   MKFYSLQAHRFLFIIVILCPLVIADLSSDKQALLDFAAAVPHRRNLKWNPATPICSSWVG  81

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+ + +RVV +RLPG+G  G IP NT+G++D+L  +SLR+NLLSGSLP+D+ SLPSLQ
Sbjct  82   ITCNLNDTRVVSVRLPGIGLVGTIPANTLGKIDSLRNISLRANLLSGSLPADITSLPSLQ  141

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SG+IP++LS  L+ +DLS+NSFTG IP  +QNLT L  LN
Sbjct  142  YLYLQHNNLSGNIPTSLSTRLNVLDLSYNSFTGAIPKTLQNLTQLIKLN  190



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
             ++DL +DRQALL FA++ PH RRLNW+    IC SWVGVTC+ DG+RV+ LRLPG+G  
Sbjct  41   ALADLNSDRQALLSFAASVPHLRRLNWNSTNHICKSWVGVTCTPDGTRVLALRLPGIGLV  100

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP NT+G+L++L TLSLRSNLL GSLP D+ SLPSL  +YLQ NNFSG++PS LS  L
Sbjct  101  GQIPPNTLGKLESLKTLSLRSNLLGGSLPPDIPSLPSLSYLYLQHNNFSGEVPSFLSQHL  160

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            D +DLSFNSFTG IP  +QN   LT L+
Sbjct  161  DILDLSFNSFTGKIPATLQNQKKLTALS  188



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
             ++DL +DRQALL FA++ PH RRLNW+    IC SWVGVTC+ DG+ V  LRLPG+G  
Sbjct  41   AIADLNSDRQALLAFAASVPHLRRLNWNSTNHICKSWVGVTCTSDGTSVHALRLPGIGLL  100

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            GPIP NT+G+L++L  LSLRSNLLSG+LP D+ SLPSL  IYLQ NNFSG++PS +S +L
Sbjct  101  GPIPPNTLGKLESLRILSLRSNLLSGNLPPDIHSLPSLDYIYLQHNNFSGEVPSFVSRQL  160

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            + +DLSFNSFTG IP   QNL  LTGL+
Sbjct  161  NILDLSFNSFTGKIPATFQNLKQLTGLS  188



>ref|XP_009607078.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=625

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 126/174 (72%), Gaps = 5/174 (3%)
 Frame = +3

Query  189  RIC*RMKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASIC  368
            RIC   +L  S     L +   L    + D+ +++QALLDFA+A PHG ++NW+    IC
Sbjct  2    RICYAHQLLHS-----LFIVATLLPLSLGDINSEKQALLDFAAALPHGWKINWNPATPIC  56

Query  369  TSWVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvls  548
            +SWVG+TCS DG+ VV +RLPGVG  GP+PENT+G++DA+  LSLRSN LSG+LPSD+ S
Sbjct  57   SSWVGITCSTDGAHVVAVRLPGVGLIGPLPENTLGKIDAIRILSLRSNRLSGNLPSDIAS  116

Query  549  lpslQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            LPSLQ ++LQ NN SG IP++ S +L+ +DLS NSF G IPV +Q LT LTGL+
Sbjct  117  LPSLQYLFLQHNNLSGTIPASFSNKLNVLDLSHNSFVGKIPVTIQKLTQLTGLS  170



>ref|XP_004302522.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466405.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=633

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 122/169 (72%), Gaps = 3/169 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK Y   +T   VL +      ++DL +D+QALLDF S  PHGR++NW     +C +WVG
Sbjct  1    MKPYLVCAT---VLFLSFLCHSIADLSSDKQALLDFISVVPHGRKVNWDSTTPVCNTWVG  57

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+ +G+RV+ +RLPGVG  G IP NT+G+LDAL  LSLRSNLLSGSLPSD+ SLPSL+
Sbjct  58   ITCTLNGTRVLAVRLPGVGLYGQIPSNTLGKLDALMVLSLRSNLLSGSLPSDIFSLPSLR  117

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             IYL  NN +G IPS+L P L  +DLS NS TG+IP  +QNLTHL GLN
Sbjct  118  YIYLHNNNLTGSIPSSLPPNLTVLDLSSNSLTGSIPATIQNLTHLNGLN  166



>gb|EYU35188.1| hypothetical protein MIMGU_mgv1a002709mg [Erythranthe guttata]
Length=645

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            LVL + +   V SDL +D +ALL+F +  PH R+LNW+   SIC SW+G+TC++D +RV 
Sbjct  13   LVLLLTISSTVNSDLDSDAEALLEFVAKVPHARKLNWNSTNSICNSWIGITCTKDKTRVH  72

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             + LPG+G  GPIP NTIG+LDAL TLSLRSN L+G+ P D+L +PSLQ+++LQ NNFSG
Sbjct  73   GIHLPGIGLFGPIPSNTIGKLDALKTLSLRSNYLNGNFPRDILEIPSLQSLFLQNNNFSG  132

Query  597  DIP-STLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++P ++LSP L  IDLS+NSFTG IP  ++NLT L+ LN
Sbjct  133  ELPLTSLSPRLSIIDLSYNSFTGEIPFALENLTRLSVLN  171



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D++ALL FA+A PHG +LNWS K  IC+SWVGVTC+ + SRV+ LRLP VG  GP
Sbjct  25   ADLNSDKEALLAFAAAIPHGHKLNWSSKTPICSSWVGVTCTPNHSRVLTLRLPAVGLVGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+LDAL  LSLRSN L+  LP DV SLPSL +++LQ NN SG IP+ LS  L F
Sbjct  85   IPANTLGQLDALKVLSLRSNRLTVHLPPDVASLPSLHSLFLQHNNLSGIIPTALSSNLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+ +QNLT LT L
Sbjct  145  LDLSYNSFMGEIPLTIQNLTQLTAL  169



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK ++      L + V+L    ++DL +D+QALLDFASA PH R L W    SICTSW+G
Sbjct  22   MKFFSPLQAF-LFIIVILSPLAIADLNSDKQALLDFASAIPHRRNLKWDPATSICTSWIG  80

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TC+ + +RVV +RLPGVG  G IP NT+G+LD+L T+SLRSNLLSGS+P D+ SLPSLQ
Sbjct  81   ITCNPNSTRVVSVRLPGVGLVGTIPSNTLGKLDSLKTISLRSNLLSGSIPHDITSLPSLQ  140

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SG++P++L  +L+ + LS+NSFTG+IP  +QNLT LT L+
Sbjct  141  YLYLQHNNLSGELPTSLPSQLNALILSYNSFTGSIPKTLQNLTQLTRLS  189



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL F +A PH R+LNWS K  IC+SWVGVTC+ D +RV  LRLPGVG  GP
Sbjct  25   ADLNSDKQALLAFVAAIPHERKLNWSSKTPICSSWVGVTCTPDKTRVCTLRLPGVGLLGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+LDAL  LSLR NLL+  LP DV SLPSL +++LQ NN SG IP++LS  L F
Sbjct  85   IPPNTLGKLDALEVLSLRFNLLTVYLPPDVASLPSLHSLFLQHNNLSGIIPTSLSSNLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP+ +QNLT LT L
Sbjct  145  LDLSYNSFMGEIPLMMQNLTQLTSL  169



>ref|XP_007136405.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 ref|XP_007136406.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08399.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08400.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
Length=640

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 123/158 (78%), Gaps = 5/158 (3%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSM-KASICTSWVGVTCSEDGSRV  413
            L LC L    +V+DLK+D+QALL+FAS+ PH  RLNW    ASICTSWVGVTC+ +G+RV
Sbjct  17   LSLCGL----IVADLKSDQQALLEFASSVPHAPRLNWKNDSASICTSWVGVTCNSNGTRV  72

Query  414  VELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFS  593
            + L LPG+GFSG I E++IG+LDAL  LSL SN L G+LPS++LS+PSLQ +YLQ N+FS
Sbjct  73   IGLHLPGMGFSGTIQESSIGKLDALRVLSLHSNGLRGNLPSNILSIPSLQFVYLQHNSFS  132

Query  594  GDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            G IPS +SP+L  +D+SFNSF+G+IP   QNL  LT L
Sbjct  133  GAIPSPVSPKLFALDISFNSFSGSIPPAFQNLRRLTWL  170



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = +3

Query  204  MKLYTSFS--TLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
            MKL+   +  T   +L  +  Q V  DL  D +ALLDFA+A PH R+LNW    SICTSW
Sbjct  1    MKLWFKLAAVTCLFLLLAVFLQPVNCDLNTDARALLDFAAAVPHVRKLNWESTNSICTSW  60

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            +G+TC++D +RV  + LP  G  GPIP +TIG+LDAL  LSLRSN L+G LPSD+LS+PS
Sbjct  61   IGITCTKDRTRVNGIHLPAFGLYGPIPADTIGKLDALRVLSLRSNRLNGELPSDILSIPS  120

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            LQ+++LQ NNFSG  P +LSP L  IDLSFNSFTG IP  V++L  LT LN
Sbjct  121  LQSVFLQNNNFSGATPVSLSPRLSIIDLSFNSFTGEIPSSVESLKRLTVLN  171



>gb|EPS58213.1| hypothetical protein M569_16602, partial [Genlisea aurea]
Length=493

 Score =   151 bits (381),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 119/160 (74%), Gaps = 2/160 (1%)
 Frame = +3

Query  237  LVLCVLLFQKVVS--DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
            L+  V L   VVS  DL  D+QALLDF+SA PHGR+LNW   + +C++WVGV CS DG R
Sbjct  6    LLWIVGLLCLVVSGGDLNLDKQALLDFSSAVPHGRKLNWDPFSGVCSNWVGVICSSDGGR  65

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            VV LRLPG+G +GPIP NT+GR+D+L  LSLRSN L G LPSDVLS+PSL+ ++LQ N F
Sbjct  66   VVGLRLPGIGLAGPIPINTLGRMDSLAVLSLRSNRLDGDLPSDVLSIPSLRYLFLQDNGF  125

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            SG IPS L P +  +DLSFNS TG IP  V+NLT LT L+
Sbjct  126  SGGIPSELPPGIVVLDLSFNSLTGGIPSSVRNLTRLTTLS  165



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 121/163 (74%), Gaps = 2/163 (1%)
 Frame = +3

Query  222  FSTLPLVLCV-LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            FS +  V  + +L   V SDL +D+QALLDFA+A PH R L W    S+C SWVG+ CS 
Sbjct  6    FSVVSFVFVIAILLPLVFSDLNSDKQALLDFANAVPHRRNLTWDPSTSVC-SWVGIICSP  64

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            + +RV+ +RLPG+G  G IP  T+G+LDAL  LSLRSN LSGSLPSD+ SLP LQ +Y+Q
Sbjct  65   NRTRVISVRLPGIGLIGSIPSYTLGKLDALKNLSLRSNRLSGSLPSDITSLPMLQYLYVQ  124

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            RNNFSGDIPS++  +L+ +DLSFNSFTGNIP  V+NLT LT L
Sbjct  125  RNNFSGDIPSSVPVQLNVLDLSFNSFTGNIPQMVRNLTQLTTL  167



>ref|XP_004492584.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=611

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +++QALLDF  A  HG ++NWS   SICTSWVG++CS DGS V  +RLPG+G  G 
Sbjct  24   ADLNSEKQALLDFIDAVHHGEKVNWSFSTSICTSWVGISCSPDGSHVCSVRLPGIGLRGS  83

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            +PENTIG+L  L  LSLRSN LSG+LPSD+ SLPSL+ +YLQ NNFSG IP  L P L F
Sbjct  84   LPENTIGKLHGLVGLSLRSNTLSGNLPSDIFSLPSLRFLYLQHNNFSGHIPDNLPPHLMF  143

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLS+NSFTG IP  +Q+LT L GL+
Sbjct  144  LDLSYNSFTGKIPSIIQSLTFLIGLD  169



>ref|XP_010558411.1| PREDICTED: probable inactive receptor kinase At3g08680 [Tarenaya 
hassleriana]
Length=603

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 118/157 (75%), Gaps = 0/157 (0%)
 Frame = +3

Query  240  VLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVE  419
            VL  L+    ++D+++D +ALL+FAS  PHGR+LNW+    IC SW GVTCS++ +RVV 
Sbjct  8    VLFFLVLSSTMADIQSDSEALLEFASLVPHGRKLNWNPSNPICDSWTGVTCSQNKTRVVA  67

Query  420  LRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGD  599
            + LPG G +GPIP NT+G+LD L  LSLRSN L G++PSD++SLP L+++YLQ NNFSG+
Sbjct  68   VHLPGFGLTGPIPVNTLGKLDDLMILSLRSNNLHGNIPSDLVSLPFLRSLYLQDNNFSGN  127

Query  600  IPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            IPS LS  L F+DLS NS +G IP  +QNL  LTGLN
Sbjct  128  IPSHLSSRLFFLDLSSNSLSGTIPTSLQNLKRLTGLN  164



>gb|KHN40011.1| Putative inactive receptor kinase [Glycine soja]
Length=449

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = +3

Query  222  FSTLPLVL---CVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTC  392
            F  +P VL    V LF  + +DL +DRQALL+F S  PH  RLNWS    ICTSW GVTC
Sbjct  5    FHAVPFVLLSFTVSLFGLIEADLNSDRQALLEFFSNVPHAPRLNWSDSTPICTSWAGVTC  64

Query  393  SEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIY  572
            +++G+ V+E+ LPG GF G IP+N++G+LD+L  LSL SN L G+LPSD+LS+PSLQ + 
Sbjct  65   NQNGTSVIEIHLPGAGFKGSIPKNSLGKLDSLKILSLHSNGLRGNLPSDILSIPSLQYVN  124

Query  573  LQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            LQ+NNFSG IPST+SP+L  +D+S N+F+G+IP   QNL+ LT L
Sbjct  125  LQQNNFSGLIPSTISPKLIALDISSNNFSGSIPTTFQNLSRLTWL  169



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            ++DL +D+QALL F +A PHGR+LNWS K  IC+SWVG+TC+ + +RV+ LRLPGVG  G
Sbjct  24   IADLNSDKQALLAFLAAIPHGRKLNWSSKTPICSSWVGITCTPNQTRVLNLRLPGVGLLG  83

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP NT+G+LDAL  LSLR N L   LP DV SLPSL +++LQ NN SG IP++L+  L 
Sbjct  84   PIPANTLGKLDALEVLSLRFNRLMLYLPPDVASLPSLHSLFLQHNNLSGIIPTSLTSNLI  143

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGL  707
             +DLS+N F G IP+ +QNLT LT L
Sbjct  144  LLDLSYNYFMGKIPLTIQNLTQLTAL  169



>ref|XP_010921193.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=634

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 122/164 (74%), Gaps = 1/164 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            + ++P +  +L F      DL++D+Q LL F  A  H R+LNW+   SIC+SW+GVTC+ 
Sbjct  8    YFSVPFLFLLLCFPSSATGDLRSDKQLLLAFVDAVHHPRKLNWNTNTSICSSWIGVTCTA  67

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D + V+ LRLPG G SGPIP NT+G+LDAL  LSLRSN L+G+LP+D++SLPSLQN+ LQ
Sbjct  68   DQTHVLALRLPGAGLSGPIPANTLGKLDALEVLSLRSNHLTGNLPADIISLPSLQNLNLQ  127

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             NN SGDIP++LS  L  +DLS+NSFTG IP+ +QNL+ L+ LN
Sbjct  128  HNNLSGDIPASLSLGLTSLDLSYNSFTGEIPLGIQNLSQLSVLN  171



>ref|XP_006842563.1| hypothetical protein AMTR_s00077p00144650 [Amborella trichopoda]
 gb|ERN04238.1| hypothetical protein AMTR_s00077p00144650 [Amborella trichopoda]
Length=399

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 113/159 (71%), Gaps = 3/159 (2%)
 Frame = +3

Query  240  VLCVLLFQ---KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSR  410
            +  +L+FQ   K  +DL +D QALL FA   PHGR+LNWS    IC SW G+TC+ + + 
Sbjct  14   IFFILIFQSTFKAAADLNSDEQALLAFAKEVPHGRKLNWSPLIPICPSWTGITCNPEKTH  73

Query  411  VVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNF  590
            V+ LRLPGVG SGPIP NTI  L +L TLSLRSNLL G+ P ++L+LPSL+ +Y+QRNNF
Sbjct  74   VIALRLPGVGLSGPIPPNTISNLTSLQTLSLRSNLLRGNFPPEILALPSLRYLYIQRNNF  133

Query  591  SGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            SG+IPS LS  L  IDLS N F G IP  + NLT LTGL
Sbjct  134  SGEIPSDLSTNLTQIDLSNNDFVGKIPQTIGNLTQLTGL  172



>ref|XP_003564492.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=633

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 112/151 (74%), Gaps = 0/151 (0%)
 Frame = +3

Query  255  LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPG  434
            L     +DL +D+QALL FA++ PHGR+LNWS    +CTSWVGVTC+ D SRV  LRLP 
Sbjct  18   LLHAESADLNSDKQALLAFAASLPHGRKLNWSSTTPLCTSWVGVTCTPDNSRVHTLRLPA  77

Query  435  VGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTL  614
            VG  GPIP +T+ +LDAL  LSLRSN L+  LP DV S+PSL +++LQ NN SG IP++L
Sbjct  78   VGLFGPIPSDTLSKLDALEVLSLRSNRLTVDLPPDVGSIPSLHSLFLQHNNLSGIIPTSL  137

Query  615  SPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            S  L F+DLS+N+F G IP++VQNLT LT +
Sbjct  138  SSSLTFLDLSYNTFDGEIPLRVQNLTGLTAI  168



>ref|XP_010653700.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Vitis vinifera]
 emb|CBI32886.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MKL+ SF+ L L   +L   + ++DL++D+QALL+FA   PH R +NWS   +IC SWVG
Sbjct  1    MKLH-SFAAL-LFSILLFLHQTIADLESDKQALLEFAFVVPHVRTINWSPATAICISWVG  58

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            + C  DG+RVV LRLPGVG  GPIP NT+G+LDAL TLSLRSN L+G+LPSDVLSLPSLQ
Sbjct  59   IKC--DGNRVVALRLPGVGLYGPIPANTLGKLDALKTLSLRSNHLNGNLPSDVLSLPSLQ  116

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG+IPS+L P L  +DLSFNS  GNIP  +QNLTHLTGLN
Sbjct  117  YMYLQHNNFSGNIPSSLPPLLILLDLSFNSIVGNIPATIQNLTHLTGLN  165



>ref|XP_002456542.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
 gb|EES01662.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
Length=635

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA++ PHGR+LNWS    +CTSWVGVTC+ D SRV  LRLP VG  GP
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPDKSRVHTLRLPAVGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP +T+G+LDAL  LSLRSN L+  LP DV S+P+L ++YLQ NN SG IP++LS  L F
Sbjct  85   IPSDTLGKLDALEVLSLRSNRLTVDLPPDVGSIPALHSLYLQHNNLSGIIPTSLSSSLTF  144

Query  633  IDLSFNSFTGNIPVKVQN  686
            +DLS+N+F G IP+KVQN
Sbjct  145  LDLSYNTFDGEIPLKVQN  162



>ref|XP_009386109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 118/163 (72%), Gaps = 1/163 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQ-KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            F ++PL + +L  Q     +L +D QALL FA++ PHGR+LNWS +  +CTSWVG+TC+ 
Sbjct  7    FLSIPLFVLLLCLQTSAAGNLTSDMQALLKFAASVPHGRKLNWSSRTPVCTSWVGITCTP  66

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D +RV  L LPG+G  G IP +T+G L AL TLSLRSN L G LP+DV  +PSL+++YLQ
Sbjct  67   DRTRVRSLHLPGIGLFGQIPADTLGELGALDTLSLRSNHLVGDLPADVPYIPSLRSLYLQ  126

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             NN SG IPS+LS  L F+DLS+NSF G IP+ ++NLT LT L
Sbjct  127  HNNISGIIPSSLSSNLTFLDLSYNSFIGEIPLTIRNLTQLTAL  169



>ref|XP_006644911.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=630

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA++ PHGR+LNWS  A +CTSWVGVTC+ D SRV  LRLP VG  GP
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSSAPVCTSWVGVTCTPDNSRVQTLRLPAVGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP +T+G+LDAL  LSLRSN ++  LP +V S+PSL ++YLQ NN SG IP+ L+  L F
Sbjct  85   IPSDTLGKLDALEVLSLRSNRITVDLPPEVGSIPSLHSLYLQHNNLSGIIPTALTSSLTF  144

Query  633  IDLSFNSFTGNIPVKVQN  686
            +DLS+N+F G IP++VQN
Sbjct  145  LDLSYNTFDGEIPLRVQN  162



>ref|XP_003544853.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=650

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = +3

Query  222  FSTLPLVL---CVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTC  392
            F  +P VL    V LF  + +DL +DRQALL+F S  PH  RLNWS    ICTSW GVTC
Sbjct  5    FHAVPFVLLSFTVSLFGLIEADLNSDRQALLEFFSNVPHAPRLNWSDSTPICTSWAGVTC  64

Query  393  SEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIY  572
            +++G+ V+E+ LPG GF G IP+N++G+LD+L  LSL SN L G+LPSD+LS+PSLQ + 
Sbjct  65   NQNGTSVIEIHLPGAGFKGSIPKNSLGKLDSLKILSLHSNGLRGNLPSDILSIPSLQYVN  124

Query  573  LQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            LQ+NNFSG IPST+SP+L  +D+S N+F+G+IP   QNL+ LT L
Sbjct  125  LQQNNFSGLIPSTISPKLIALDISSNNFSGSIPTTFQNLSRLTWL  169



>ref|NP_001130388.1| uncharacterized LOC100191484 precursor [Zea mays]
 gb|ACF78585.1| unknown [Zea mays]
 gb|AFW84760.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=637

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA++ PHGR+LNWS    +CTSWVGVTC+ D SRV  LRLP VG  GP
Sbjct  25   ADLNSDKQALLAFAASLPHGRKLNWSSTTPVCTSWVGVTCTPDKSRVHTLRLPAVGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP +T+G+LDAL  LSLRSN L+  LP DV S+P+L ++YLQ NN SG IP++LS  L F
Sbjct  85   IPSDTLGKLDALEVLSLRSNRLTVDLPPDVGSIPALHSLYLQHNNLSGIIPTSLSSSLTF  144

Query  633  IDLSFNSFTGNIPVKVQN  686
            +DLS+N+F G IP+KVQN
Sbjct  145  LDLSYNTFDGEIPLKVQN  162



>ref|XP_010653698.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
 ref|XP_010653699.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 131/169 (78%), Gaps = 4/169 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MKL+ SF+ L L   +L   + ++DL++D+QALL+FA   PH R +NWS   +IC SWVG
Sbjct  34   MKLH-SFAAL-LFSILLFLHQTIADLESDKQALLEFAFVVPHVRTINWSPATAICISWVG  91

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            + C  DG+RVV LRLPGVG  GPIP NT+G+LDAL TLSLRSN L+G+LPSDVLSLPSLQ
Sbjct  92   IKC--DGNRVVALRLPGVGLYGPIPANTLGKLDALKTLSLRSNHLNGNLPSDVLSLPSLQ  149

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NNFSG+IPS+L P L  +DLSFNS  GNIP  +QNLTHLTGLN
Sbjct  150  YMYLQHNNFSGNIPSSLPPLLILLDLSFNSIVGNIPATIQNLTHLTGLN  198



>ref|XP_010670041.1| PREDICTED: probable inactive receptor kinase At5g58300 [Beta 
vulgaris subsp. vulgaris]
Length=635

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 120/170 (71%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVL-CVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL +    + + L  V +   + +DL +DRQALL+FA+  PHGR+LNW++ + ICT+W 
Sbjct  1    MKLQSFLLDISIFLNLVAILPLICADLNSDRQALLNFAANVPHGRKLNWNVASEICTTWA  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+ + +RV+ L LPG+G  G IP  TIG+LDAL  LSLRSN L+G LP+D+  L SL
Sbjct  61   GVTCNTERTRVIALHLPGIGLVGSIPSGTIGKLDALEVLSLRSNSLNGELPADIPCLSSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +++LQ NNFSG IP +LS  L  +DLSFNSFTGNIP  + NLT L  LN
Sbjct  121  HSLFLQSNNFSGSIPKSLSRGLMVLDLSFNSFTGNIPSTINNLTRLIVLN  170



>ref|XP_003523287.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006578848.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006578849.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
 ref|XP_006578850.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
 ref|XP_006578851.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQK-VVSDLKADRQALLDFASATPHGRRLNWSM-KASICTSW  377
            MKL  S   L L+   L F   +V+DL +D+ ALL+FAS+ PH  RLNW    ASICTSW
Sbjct  1    MKLQFSIVALVLLGSTLSFCGLIVADLNSDQHALLEFASSVPHAPRLNWKNDSASICTSW  60

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            VGVTC+ +G+RVV L LPG+G +G IPEN+IG+LDAL  LSL SN L GSLPS+VLS+PS
Sbjct  61   VGVTCNSNGTRVVGLHLPGMGLTGTIPENSIGKLDALRVLSLHSNGLIGSLPSNVLSIPS  120

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            LQ  YLQ N+FSG IPS ++P+L  +D+SFNSF+G IP   QNL  LT L
Sbjct  121  LQFAYLQHNSFSGLIPSPVTPKLMTLDISFNSFSGTIPPAFQNLRRLTWL  170



>ref|XP_003518282.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=648

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 3/165 (2%)
 Frame = +3

Query  222  FSTLPLVL---CVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTC  392
            F  +P VL    V LF  + +DL +D+QALL+F S  PH  RLNWS    ICTSW GVTC
Sbjct  5    FHAVPFVLLSFTVSLFGLIEADLNSDKQALLEFFSNVPHAPRLNWSESTPICTSWAGVTC  64

Query  393  SEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIY  572
            +++G+ V+E+ LPG GF G IPEN++G+LD+L  LSL SN L G+LPSD+LS+PSLQ + 
Sbjct  65   NQNGTSVIEIHLPGAGFKGSIPENSLGKLDSLKILSLHSNGLRGNLPSDILSIPSLQYVN  124

Query  573  LQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            LQ+NNFSG IPS++SP+L  +D+S N+F+G+IP   QNL+ LT L
Sbjct  125  LQQNNFSGLIPSSISPKLIALDISSNNFSGSIPTTFQNLSRLTWL  169



>dbj|BAB62593.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB93368.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY76289.1| hypothetical protein OsI_04221 [Oryza sativa Indica Group]
Length=637

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            + T+F  + L+   +   K  +DL +D+QALL FA++ PHGR+LNWS  A +CTSWVGVT
Sbjct  5    ILTAFLVVSLLFACIPPAKS-ADLNSDKQALLAFAASLPHGRKLNWSSAAPVCTSWVGVT  63

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C+ D SRV  LRLP VG  GP+P +T+G+LDAL  LSLRSN ++  LP +V S+PSL ++
Sbjct  64   CTPDNSRVQTLRLPAVGLFGPLPSDTLGKLDALEVLSLRSNRITVDLPPEVGSIPSLHSL  123

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQN  686
            YLQ NN SG IP++L+  L F+DLS+N+F G IP++VQN
Sbjct  124  YLQHNNLSGIIPTSLTSTLTFLDLSYNTFDGEIPLRVQN  162



>gb|EAZ05160.1| hypothetical protein OsI_27356 [Oryza sativa Indica Group]
Length=640

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+DL +++QALLDFASA   G RLNWS   S+C SW GV CS D S + ELR+PG G  G
Sbjct  28   VADLASEKQALLDFASAVYRGNRLNWSQSTSLC-SWHGVKCSGDQSHIFELRVPGAGLIG  86

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
             IP NT+G+LD+L  LSLRSN L+GSLPSDV +LPSL++IYLQ NNFSGD+PS L+P L 
Sbjct  87   AIPPNTLGKLDSLQVLSLRSNRLAGSLPSDVTTLPSLRSIYLQHNNFSGDLPSFLNPNLS  146

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLS+NSFTG IP+ +QNL+ L+ LN
Sbjct  147  VVDLSYNSFTGEIPISLQNLSQLSVLN  173



>ref|NP_001060650.1| Os07g0681100 [Oryza sativa Japonica Group]
 dbj|BAC80010.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF22564.1| Os07g0681100 [Oryza sativa Japonica Group]
 gb|EAZ41109.1| hypothetical protein OsJ_25602 [Oryza sativa Japonica Group]
Length=640

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+DL +++QALLDFASA   G RLNWS   S+C SW GV CS D S + ELR+PG G  G
Sbjct  28   VADLTSEKQALLDFASAVYRGNRLNWSQSTSLC-SWHGVKCSGDQSHIFELRVPGAGLIG  86

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
             IP NT+G+LD+L  LSLRSN L+GSLPSDV +LPSL++IYLQ NNFSGD+PS L+P L 
Sbjct  87   AIPPNTLGKLDSLQVLSLRSNRLAGSLPSDVTTLPSLRSIYLQHNNFSGDLPSFLNPNLS  146

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLS+NSFTG IP+ +QNL+ L+ LN
Sbjct  147  VVDLSYNSFTGEIPISLQNLSQLSVLN  173



>ref|XP_006658137.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=642

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            ++DL +++QALLDFA+A  HG RL+WS   S+C SW GV CS D S + ELR+PGVG  G
Sbjct  28   LADLASEKQALLDFAAAVYHGNRLDWSQNTSLC-SWHGVKCSGDQSHIFELRIPGVGLIG  86

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
             IP NT+G+LD+L  LSLRSN L+GS PSDV +LP L++IYLQ NNFSGD+PS L+P L 
Sbjct  87   AIPPNTLGKLDSLQVLSLRSNRLAGSFPSDVTTLPLLRSIYLQHNNFSGDLPSFLNPNLS  146

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +DLS+NSF+G IP+ +QNL+ L+ LN
Sbjct  147  VVDLSYNSFSGEIPISLQNLSQLSVLN  173



>gb|KDP21623.1| hypothetical protein JCGZ_03294 [Jatropha curcas]
Length=632

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +3

Query  264  KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGF  443
            ++++DL +D QAL+DFA+A PH R+LNW+   SIC SW G++C  +G+RVV + LPG+G 
Sbjct  24   QIIADLNSDTQALVDFAAAVPHIRKLNWNSGTSICASWFGISCDSNGTRVVAVHLPGIGL  83

Query  444  SGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPE  623
             GPIP NT+GRL AL  LSL SN L+G+LP DV S+PSLQ +YLQ N+FSG  P +L  +
Sbjct  84   YGPIPPNTLGRLGALRILSLHSNNLNGNLPDDVPSMPSLQFLYLQHNSFSGTFPPSLPVQ  143

Query  624  LDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            L  +DLSFNSFTG+IP  +QN+T L+ L
Sbjct  144  LHVLDLSFNSFTGSIPSTIQNMTQLSAL  171



>gb|KHN25793.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 126/172 (73%), Gaps = 6/172 (3%)
 Frame = +3

Query  204  MKLYTSFSTLPLVL---CVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKA-SICT  371
            MKL   FS + LVL    + L   +V+DL +D+QALL+FAS+ PH  RLNW   + SICT
Sbjct  1    MKL--QFSIVALVLLGSTLCLSGLIVADLNSDQQALLEFASSVPHAPRLNWKKDSVSICT  58

Query  372  SWVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlsl  551
            SWVGVTC+ +G+RVV L LPG+G  G IPEN+IG+LDAL  LSL SN L GSLPS++LS+
Sbjct  59   SWVGVTCNSNGTRVVGLHLPGMGLIGTIPENSIGKLDALRVLSLHSNGLIGSLPSNILSI  118

Query  552  pslQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            PSLQ  YLQ N FSG IPS ++P+L  +D+SFN+F+G+IP   QNL  LT L
Sbjct  119  PSLQFAYLQHNGFSGIIPSPVTPKLMALDISFNNFSGSIPPAFQNLRRLTWL  170



>ref|XP_004970381.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=635

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 114/159 (72%), Gaps = 4/159 (3%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKV----VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
             + +  V   LLF  +     +DL +D+QALL FA++ PHG++LNWS    +CT+WVGVT
Sbjct  4    LTVIAFVAASLLFASIPHAKSADLNSDKQALLAFAASLPHGKKLNWSSTTPVCTTWVGVT  63

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C+ D SRV  LRLP VG  GPIP +T+G+LDAL  LSLRSN L+  LP DV S+P+L ++
Sbjct  64   CTPDKSRVHTLRLPAVGLFGPIPSDTLGKLDALEVLSLRSNRLTVDLPPDVGSIPALHSL  123

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQN  686
            YLQ NN SG IP++LS  L F+DLS+N+F G IP+KVQN
Sbjct  124  YLQHNNLSGIIPTSLSSSLTFLDLSYNTFDGEIPLKVQN  162



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 120/170 (71%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTL-PLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            M++Y +   L  L +   L      DL  DRQALLDFA+A PHG ++NW     IC+SWV
Sbjct  1    MRMYCTNQLLHSLFVVATLLSLCRGDLNLDRQALLDFAAAVPHGWKINWDPATPICSSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTCS D + V E+RLPGVG  G +P+NT  ++D+L  +SLRSN LSG+LPS + SLPSL
Sbjct  61   GVTCSNDEAHVAEVRLPGVGLIGSLPKNTFEKMDSLRIISLRSNRLSGNLPSSITSLPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q ++LQ+NN SG IPS+LS +L+ +DLS N FTG IP  +QNL+ LTGL+
Sbjct  121  QYLFLQQNNLSGPIPSSLSNKLNILDLSHNFFTGKIPETIQNLSQLTGLS  170



>ref|XP_010322111.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Solanum lycopersicum]
Length=594

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 124/170 (73%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL    +T+  +L +L +   ++++L +D+ ALL FA + PH  +LNW+   SIC SW+
Sbjct  1    MKLQDLRATIFFLLSLLAILPHIIANLDSDKHALLQFAVSIPHLSKLNWNSALSICNSWI  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC++D +RVV + LPGVG +G IP N+IG+LDAL  L+LR+N L+G+LPSD+LS+PSL
Sbjct  61   GITCNKDKTRVVAIHLPGVGLTGHIPANSIGKLDALQVLNLRANNLNGNLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +IYLQ NNFSGDIP + S  L  ID SFNSFTG IP  ++NL  L+ LN
Sbjct  121  YSIYLQHNNFSGDIPVSFSSTLGVIDFSFNSFTGQIPPTIKNLPRLSMLN  170



>ref|XP_004241083.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Solanum lycopersicum]
Length=593

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 124/170 (73%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL-LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL    +T+  +L +L +   ++++L +D+ ALL FA + PH  +LNW+   SIC SW+
Sbjct  1    MKLQDLRATIFFLLSLLAILPHIIANLDSDKHALLQFAVSIPHLSKLNWNSALSICNSWI  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC++D +RVV + LPGVG +G IP N+IG+LDAL  L+LR+N L+G+LPSD+LS+PSL
Sbjct  61   GITCNKDKTRVVAIHLPGVGLTGHIPANSIGKLDALQVLNLRANNLNGNLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +IYLQ NNFSGDIP + S  L  ID SFNSFTG IP  ++NL  L+ LN
Sbjct  121  YSIYLQHNNFSGDIPVSFSSTLGVIDFSFNSFTGQIPPTIKNLPRLSMLN  170



>ref|XP_009126766.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=651

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 117/159 (74%), Gaps = 1/159 (1%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L + +  +   ++DL +DRQALL FA++ PH R+LNW+    IC SWVGVTC+ DG+ V+
Sbjct  24   LFVTITFYSSAIADLNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDGTGVL  83

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             LRLPG+G  G IP NT+G+L++L TLSLRSNL+ G+LP D+ +LPSL+ +YLQ NNFSG
Sbjct  84   TLRLPGIGLVGTIPPNTLGKLESLETLSLRSNLIGGNLPPDIPTLPSLRYLYLQHNNFSG  143

Query  597  DIPST-LSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++P T LS  L  +DLSFNSFTG IP  +QN   LT L+
Sbjct  144  ELPPTFLSQNLSILDLSFNSFTGKIPTTLQNQKQLTKLS  182



>ref|XP_003526789.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX1 
[Glycine max]
 ref|XP_003526790.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX2 
[Glycine max]
 ref|XP_006581706.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=642

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 124/170 (73%), Gaps = 4/170 (2%)
 Frame = +3

Query  210  LYTSFSTLPLVL---CVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKA-SICTSW  377
            +   FS + LVL    + L   +V+DL +D+QALL+FAS+ PH  RLNW   + SICTSW
Sbjct  1    MKVQFSIVALVLLGSTLCLSGLIVADLNSDQQALLEFASSVPHAPRLNWKKDSVSICTSW  60

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            VGVTC+ +G+RVV L LPG+G  G IPEN+IG+LDAL  LSL SN L GSLPS++LS+PS
Sbjct  61   VGVTCNSNGTRVVGLHLPGMGLIGTIPENSIGKLDALRVLSLHSNGLIGSLPSNILSIPS  120

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            LQ  YLQ N FSG IPS ++P+L  +D+SFN+F+G+IP   QNL  LT L
Sbjct  121  LQFAYLQHNGFSGIIPSPVTPKLMALDISFNNFSGSIPPAFQNLRRLTWL  170



>tpg|DAA57078.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=637

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL +D+QALL FA++ P GR+LNWS    +CTSWVGVTC+ D SRV  LRLP VG  GP
Sbjct  24   ADLNSDKQALLAFAASLPRGRKLNWSSTTPVCTSWVGVTCTPDKSRVHTLRLPAVGLFGP  83

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP +T+G+LDAL  LSLRSN L+  LP +V S+P+L ++YLQ NN SG IP++LS  L F
Sbjct  84   IPSDTLGKLDALEVLSLRSNRLTVDLPPEVGSIPALHSLYLQHNNLSGIIPTSLSSSLTF  143

Query  633  IDLSFNSFTGNIPVKVQN  686
            +DLS+N+F G IP+KVQN
Sbjct  144  LDLSYNTFDGEIPLKVQN  161



>ref|XP_009384331.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384332.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384333.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384334.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384335.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
              +DL +D QALL FA + PHGR+LNW+ ++ IC+SWVGVTC+ D +RV  LRLP VG  
Sbjct  23   ATADLSSDEQALLAFAMSVPHGRKLNWTSQSPICSSWVGVTCTPDKTRVRTLRLPAVGLF  82

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP +T+G+L+AL  LSLRSN L   LPSDV S+P+L ++YLQ NN SG IPSTLS  L
Sbjct  83   GLIPADTLGKLNALEVLSLRSNRLIVGLPSDVASIPALHSLYLQHNNLSGIIPSTLSSNL  142

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             F+DLS+NSFTG +P+ ++NLT L  L
Sbjct  143  TFLDLSYNSFTGELPLTIRNLTRLNAL  169



>emb|CDP06375.1| unnamed protein product [Coffea canephora]
Length=667

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 130/177 (73%), Gaps = 17/177 (10%)
 Frame = +3

Query  231  LPLVLCVLLFQK-----VVSDLKADRQALLDFASATPH--GRRLNWSMK---ASICTSWV  380
            L  +L  +LF K       +DL +D+QALLDFASA PH   R+L+W+ +   +S C SW 
Sbjct  13   LAQLLLHVLFPKHTTVFAAADLSSDKQALLDFASAVPHPRARKLDWNAQPSSSSACRSWA  72

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+ + +RV+ELRLPG GF GPIP NT+GRLDAL +LSLRSN LSG+LP D+LSLPSL
Sbjct  73   GVTCTANATRVLELRLPGFGFDGPIPRNTLGRLDALASLSLRSNRLSGALPYDILSLPSL  132

Query  561  QNIYLQRNNFSG-DIPS-----TLSPELDFIDLSFNSFTGNIPVKV-QNLTHLTGLN  710
            + + LQRNNFSG D+P+     +LSP+L F+DLSFNSF GNIP ++  NLT L GLN
Sbjct  133  RYLDLQRNNFSGWDLPTPSSSISLSPQLTFLDLSFNSFPGNIPDQLFTNLTRLAGLN  189



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKVV-SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            F  LP +  +L    +  +DL +D +ALL FA++ PHGR+LNWS +  IC+SWVGVTC+ 
Sbjct  7    FIALPFIYLMLYLPPLTTADLSSDEEALLAFAASVPHGRKLNWSSQNPICSSWVGVTCTP  66

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D +RV  LRLP VG  G IP +T+G+LDAL  LSLRSN L  +L  DV S+PSL ++YLQ
Sbjct  67   DKTRVHTLRLPAVGLFGSIPSDTLGKLDALEVLSLRSNRLILNLAPDVPSIPSLHSLYLQ  126

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             NN SG +P  LS  L F+DLS+N F G IP+ VQNLT LT L
Sbjct  127  HNNLSGIVPDLLSSNLTFLDLSYNLFVGEIPLTVQNLTLLTAL  169



>ref|XP_008810859.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=644

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKVVS-DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            F ++P +  +L F    + DLK+D+Q LL F  A  HGR+LNW+   S+C+SW+GVTC+ 
Sbjct  11   FPSVPFLFLLLCFPSAATGDLKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSSWIGVTCTA  70

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D +RV+ LRLPGVG  GPIP NT+G+LDAL  LSLRSN L+GSLPSD++SLPSLQ +YLQ
Sbjct  71   DQTRVLALRLPGVGLFGPIPANTLGKLDALRVLSLRSNHLNGSLPSDIMSLPSLQYLYLQ  130

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKV  680
             NN SGDIP++LS  L   DLS+NSFTG IP+ +
Sbjct  131  HNNLSGDIPASLSLSLVSFDLSYNSFTGEIPLGI  164



>ref|XP_009362770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=654

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 120/169 (71%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL  SF TL  +  +  F   V SDL +DRQALL+FA+   H ++LNW+    +CTSWV
Sbjct  20   MKLQVSFCTLIFLFLIPPFPSSVFSDLNSDRQALLNFAATVVHIKKLNWNASTPVCTSWV  79

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TCS + + V  + LP +G  G IP N+IG+L AL  LSLRSN L GSLPSD+LS+PSL
Sbjct  80   GITCSLNKTSVTAIHLPAIGLFGSIPSNSIGKLHALQVLSLRSNFLYGSLPSDILSIPSL  139

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            + +YLQ NNFSG +P++L P L  +D SFNSF+G+IP K+QNLT LT L
Sbjct  140  EYLYLQHNNFSGVLPASLPPNLVVLDFSFNSFSGSIPTKIQNLTRLTTL  188



>gb|KCW50324.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
 gb|KCW50325.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=630

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = +3

Query  249  VLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRL  428
            +LL   VV+DL +D QALL FASA PH R+LNWS    IC+SWVG+TC+ D +RV ++RL
Sbjct  18   LLLIPLVVADLNSDVQALLGFASAVPHARKLNWSPSIPICSSWVGITCNVDKTRVTKVRL  77

Query  429  PGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPS  608
            P VG  G +P NT+ +LDAL  LSLRSN L+G+LPSDV S+PSLQ ++LQ NNFSG +P 
Sbjct  78   PAVGLYGSLPPNTLAKLDALEVLSLRSNYLTGNLPSDVASIPSLQYLFLQHNNFSGSLPI  137

Query  609  TLSPELDFIDLSFNSFTGNIPVKVQNLTHLT  701
            +LS +L+ +DLSFNSF+G IP  +Q L  L 
Sbjct  138  SLSSQLNVLDLSFNSFSGGIPPSIQKLNRLA  168



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            ++DL +D++ALL FA A PHG +LNWS    IC+SWVGV C+ D   V  LRLP VG  G
Sbjct  24   IADLNSDKEALLAFAVAIPHGHKLNWSSNTPICSSWVGVACTPDHMHVHTLRLPAVGLIG  83

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP NT+G+LDAL  LSLRSN L+  LP DV SLPSL +++LQ NN SG +P+ LS  L 
Sbjct  84   PIPANTLGKLDALEVLSLRSNRLTVHLPPDVASLPSLHSLFLQHNNLSGIVPTALSSNLT  143

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGL  707
            F+DLS+NSF+G IP  +QNLT LT L
Sbjct  144  FLDLSYNSFSGEIPPTIQNLTQLTAL  169



>ref|XP_010031063.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031064.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031065.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031066.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW50323.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=633

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = +3

Query  249  VLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRL  428
            +LL   VV+DL +D QALL FASA PH R+LNWS    IC+SWVG+TC+ D +RV ++RL
Sbjct  18   LLLIPLVVADLNSDVQALLGFASAVPHARKLNWSPSIPICSSWVGITCNVDKTRVTKVRL  77

Query  429  PGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPS  608
            P VG  G +P NT+ +LDAL  LSLRSN L+G+LPSDV S+PSLQ ++LQ NNFSG +P 
Sbjct  78   PAVGLYGSLPPNTLAKLDALEVLSLRSNYLTGNLPSDVASIPSLQYLFLQHNNFSGSLPI  137

Query  609  TLSPELDFIDLSFNSFTGNIPVKVQNLTHLT  701
            +LS +L+ +DLSFNSF+G IP  +Q L  L 
Sbjct  138  SLSSQLNVLDLSFNSFSGGIPPSIQKLNRLA  168



>emb|CDY32713.1| BnaA02g07750D [Brassica napus]
Length=651

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 116/159 (73%), Gaps = 1/159 (1%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L +    +   ++DL +DRQALL FA++ PH R+LNW+    IC SWVGVTC+ DG+ V+
Sbjct  24   LFVTTTFYSSAIADLNSDRQALLSFAASVPHLRKLNWNSTNHICKSWVGVTCTSDGTGVL  83

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             LRLPG+G  G IP NT+G+L++L TLSLRSNL+ G+LP D+ +LPSL+ +YLQ NNFSG
Sbjct  84   TLRLPGIGLVGTIPPNTLGKLESLETLSLRSNLIGGNLPPDIPTLPSLRYLYLQHNNFSG  143

Query  597  DIPST-LSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++P T LS  L  +DLSFNSFTG IP  +QN   LT L+
Sbjct  144  ELPPTFLSQNLSILDLSFNSFTGKIPPSLQNQKQLTKLS  182



>ref|XP_009409433.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409434.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009409435.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=644

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 104/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L  D+QALLDF +ATPHGR LNW     +C+SW GVTCS D SRV+ +RLPG+GFSGPIP
Sbjct  33   LAKDKQALLDFLTATPHGRGLNWRRATDVCSSWTGVTCSADDSRVIAVRLPGIGFSGPIP  92

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSP--ELDF  632
             NT+ RL AL  LSLRSN LSG  P+D  +L +L  ++LQ N+FSG +PS  SP   L  
Sbjct  93   PNTLSRLSALRILSLRSNSLSGPFPADFANLTTLTGLHLQFNSFSGSLPSDFSPWKNLTA  152

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLSFN F G+IP  V NLT L+ LN
Sbjct  153  LDLSFNDFNGSIPASVSNLTQLSALN  178



>ref|XP_008810858.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKVVS-DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            F ++P +  +L F    + DLK+D+Q LL F  A  HGR+LNW+   S+C+SW+GVTC+ 
Sbjct  52   FPSVPFLFLLLCFPSAATGDLKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSSWIGVTCTA  111

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D +RV+ LRLPGVG  GPIP NT+G+LDAL  LSLRSN L+GSLPSD++SLPSLQ +YLQ
Sbjct  112  DQTRVLALRLPGVGLFGPIPANTLGKLDALRVLSLRSNHLNGSLPSDIMSLPSLQYLYLQ  171

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKV  680
             NN SGDIP++LS  L   DLS+NSFTG IP+ +
Sbjct  172  HNNLSGDIPASLSLSLVSFDLSYNSFTGEIPLGI  205



>ref|XP_010938046.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=641

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  219  SFSTLPLVLCVLLFQKVVS-DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCS  395
            S +++P +  +L F    + DLK+D+Q LL F  A  HGR+LNW+   S+C+ WVGVTC+
Sbjct  10   SIASVPFLFILLCFPSAATGDLKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSFWVGVTCT  69

Query  396  EDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYL  575
             D +RV+ LRLPGVG SGPIP NT+G+LDAL  LSLRSN L+G+LPSDV+SLPSLQ IYL
Sbjct  70   TDQTRVLALRLPGVGLSGPIPANTLGKLDALRVLSLRSNHLNGNLPSDVISLPSLQYIYL  129

Query  576  QRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQ  683
            Q NN SG IP++LS  L  +DLS+NSFTG IP+ ++
Sbjct  130  QHNNLSGYIPASLSVNLISLDLSYNSFTGEIPLGIR  165



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK+  +F  L L++   + + + +D+++D+QALL+FAS  PH R+LNW+    IC SW G
Sbjct  3    MKIVAAF--LFLLISPFVSRCLSADIESDKQALLEFASLVPHSRKLNWNSSIPICGSWTG  60

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TCS++ +RV  LRLPG G  GP+PE T  +LDAL  +SLRSN L G++PS +LSLP ++
Sbjct  61   ITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNYLQGNIPSVILSLPFIR  120

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            ++Y   NNFSG IP TLS  L  +DLS NS TGNIP  +QNLTHLT L
Sbjct  121  SLYFHDNNFSGTIPPTLSHRLVNLDLSANSLTGNIPASLQNLTHLTDL  168



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK+  +F  L L++   + + + +D+++D+QALL+FAS  PH R+LNW+    IC SW G
Sbjct  4    MKIVAAF--LFLLVSPFVSRCLSADIESDKQALLEFASLVPHSRKLNWNSSIPICDSWTG  61

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TCS++ +RV  LRLPG G  GP+PE T  +LDAL  +SLRSN L G++PS +LSLP ++
Sbjct  62   ITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNYLQGNIPSVILSLPFIR  121

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++Y   NNFSG IP TLS  L  +DLS NS TGNIP  +QNLTHLT L+
Sbjct  122  SLYFHDNNFSGTIPPTLSHRLVNLDLSANSLTGNIPASLQNLTHLTDLS  170



>ref|XP_010938045.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=682

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  219  SFSTLPLVLCVLLFQKVVS-DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCS  395
            S +++P +  +L F    + DLK+D+Q LL F  A  HGR+LNW+   S+C+ WVGVTC+
Sbjct  51   SIASVPFLFILLCFPSAATGDLKSDKQLLLAFVDAVHHGRKLNWNSNTSVCSFWVGVTCT  110

Query  396  EDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYL  575
             D +RV+ LRLPGVG SGPIP NT+G+LDAL  LSLRSN L+G+LPSDV+SLPSLQ IYL
Sbjct  111  TDQTRVLALRLPGVGLSGPIPANTLGKLDALRVLSLRSNHLNGNLPSDVISLPSLQYIYL  170

Query  576  QRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQ  683
            Q NN SG IP++LS  L  +DLS+NSFTG IP+ ++
Sbjct  171  QHNNLSGYIPASLSVNLISLDLSYNSFTGEIPLGIR  206



>ref|XP_007220535.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
 gb|EMJ21734.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
Length=631

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL  S + L  +  +  F   V++DL +DRQALL FA+A  H ++LNW+  A +C SWV
Sbjct  1    MKLQFSIAALIFLFLIRHFPSSVIADLNSDRQALLKFAAAVGHTQKLNWNAAAPVCASWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ + + V  + LP VG  G IP N+IG+L AL  LSL SN L GSLPSD+LS+PSL
Sbjct  61   GITCNLNKTSVTAIHLPAVGLFGSIPANSIGKLAALRVLSLHSNFLYGSLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            + +YLQ NNFSG  P++LSP L  +D SFNSF+G+IP  VQNLT LT L+
Sbjct  121  EYLYLQHNNFSGVFPASLSPNLILLDFSFNSFSGDIPTTVQNLTRLTALS  170



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            L + FS+L  V+  +     +SDL +D++AL+DFA+A PH R LNW++   ICTSW+GV 
Sbjct  42   LTSVFSSL--VIIGIFLPLTISDLNSDKEALVDFAAAVPHRRNLNWNLTNPICTSWIGVK  99

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C++D S V+ LRLPGVG  G IP NT+G+L AL TLSLRSN L+G LPSD+++LPSLQ +
Sbjct  100  CTQDNSSVLALRLPGVGLIGNIPSNTLGKLGALRTLSLRSNRLNGDLPSDIITLPSLQYL  159

Query  570  YLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQ  683
            YLQ NN SGD+P + S +L+ +DLSFNSFTG IP  +Q
Sbjct  160  YLQHNNLSGDLPVSFSLKLNVLDLSFNSFTGKIPKTIQ  197



>ref|XP_009380537.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=639

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L  D+QALLDF +A PHGR LNWS   ++C  W G+TCS DGSRVV +RLPG+GF GP+P
Sbjct  27   LAKDKQALLDFLAAAPHGRGLNWSRATTVCGLWTGITCSADGSRVVAVRLPGIGFRGPVP  86

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS--PELDF  632
             NT+ RL AL  LSLR+N+LSG  P+D  +L +L  ++LQ N FSG +PS  S    L  
Sbjct  87   PNTLSRLSALRILSLRANILSGPFPADFANLTALTGLHLQLNRFSGPLPSDFSRWKNLTV  146

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLSFN F G+IP  + NLTHLT LN
Sbjct  147  LDLSFNDFNGSIPASISNLTHLTALN  172



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 114/159 (72%), Gaps = 1/159 (1%)
 Frame = +3

Query  237  LVLCVLLFQKVVS-DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRV  413
            L L +LL  + +S D+ +D+QALL+FAS  PH R+LNW+    ICTSW G+TCS++ SRV
Sbjct  5    LALIILLASRCLSADIDSDKQALLEFASLVPHARKLNWNTTNPICTSWTGITCSKNNSRV  64

Query  414  VELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFS  593
              LRLPG G  GP+P+ T  +LDAL  +SLRSN L G++P  +LSLP ++++Y   NNFS
Sbjct  65   TALRLPGSGLYGPLPDKTFEKLDALRIISLRSNNLQGNIPLTILSLPFIRSLYFHDNNFS  124

Query  594  GDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            G IP TLSP L  +DLS NS +GNIP  +++LT LT L+
Sbjct  125  GTIPPTLSPRLVNLDLSNNSLSGNIPASLRSLTQLTDLS  163



>gb|AAL09719.1| AT3g08680/F17O14_15 [Arabidopsis thaliana]
 gb|AAN18066.1| At3g08680/F17O14_15 [Arabidopsis thaliana]
Length=382

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK+  +F  L L++   + + + +D+++D+QALL+FAS  PH R+LNW+    IC SW G
Sbjct  2    MKIIAAF--LFLLVTTFVSRCLSADIESDKQALLEFASLVPHSRKLNWNSTIPICASWTG  59

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TCS++ +RV  LRLPG G  GP+PE T  +LDAL  +SLRSN L G++PS +LSLP ++
Sbjct  60   ITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNHLQGNIPSVILSLPFIR  119

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++Y   NNFSG IP  LS  L  +DLS NS +GNIP  +QNLT LT L+
Sbjct  120  SLYFHENNFSGTIPPVLSHRLVNLDLSANSLSGNIPTSLQNLTQLTDLS  168



>ref|XP_007141331.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 ref|XP_007141332.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13325.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13326.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
Length=644

 Score =   140 bits (354),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  255  LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPG  434
            LF  +V+DL +DRQALL+F S  PH  RLNWS    ICTSW GVTC+++ + V+ +RLPG
Sbjct  19   LFGLIVADLNSDRQALLEFFSNVPHAPRLNWSESTPICTSWAGVTCNKNETSVISIRLPG  78

Query  435  VGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTL  614
             GF G IPEN++G+L++L  LSL SN L G+LPSD+LS+PSLQ + LQ+N FSG IPS++
Sbjct  79   AGFKGSIPENSLGKLNSLKILSLHSNGLRGNLPSDILSIPSLQYVNLQQNYFSGLIPSSI  138

Query  615  SPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            SP+L  +D+S N+F+G+IP  +QNL+ LT L
Sbjct  139  SPKLVALDISSNNFSGSIPPTLQNLSRLTWL  169



>ref|XP_004308997.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011470006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=643

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVL--LFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
            MKL +S + L  +  +L  LF  V++DL +D+QALLDFA+   H ++LNW+    +C+SW
Sbjct  1    MKLKSSIAELIFLFPILPFLFSSVIADLNSDKQALLDFAANVFHTQKLNWNGSTPVCSSW  60

Query  378  VGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslps  557
            +G+TC+ + + V+++ LP +G  G IP NTIG+LDAL  LSL SN L+G+LPSDVLS+PS
Sbjct  61   IGITCNLNHTSVIDIHLPAIGLFGSIPNNTIGKLDALRVLSLHSNFLNGTLPSDVLSIPS  120

Query  558  lQNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ +YLQ NNFSG IP++LSP L  ++LSFNS +G IP  + NLT L  L+
Sbjct  121  LKYLYLQNNNFSGAIPASLSPNLIVLELSFNSLSGIIPTIISNLTRLVELS  171



>ref|XP_008376328.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 1/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL      L  +  V+ F   V+SDL +D QALL+FA    H R+LNW+    +CTSWV
Sbjct  1    MKLQVFVRALIFLSLVMPFPSSVLSDLNSDGQALLNFAGTVVHTRKLNWNASIPVCTSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ + + V  + LPG+G  G IP N+IG+L AL  LSL SN L GSLPSD+ S+PSL
Sbjct  61   GITCNLNKTGVTAIHLPGIGLFGSIPSNSIGKLRALRVLSLHSNFLYGSLPSDIPSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            + +YL +NNFSG +P++LSP L  +DLSFNSF+GNIP K+QNLT LT L
Sbjct  121  EFLYLHQNNFSGKLPASLSPNLIVLDLSFNSFSGNIPPKIQNLTRLTTL  169



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK+  +F  L L++   + + + +D+++D+QALL+FAS  PH R+LNW+    IC SW G
Sbjct  2    MKIIAAF--LFLLVTTFVSRCLSADIESDKQALLEFASLVPHSRKLNWNSTIPICASWTG  59

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TCS++ +RV  LRLPG G  GP+PE T  +LDAL  +SLRSN L G++PS +LSLP ++
Sbjct  60   ITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNHLQGNIPSVILSLPFIR  119

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++Y   NNFSG IP  LS  L  +DLS NS +GNIP  +QNLT LT L+
Sbjct  120  SLYFHENNFSGTIPPVLSHRLVNLDLSANSLSGNIPTSLQNLTQLTDLS  168



>ref|XP_010683445.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683446.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683447.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683448.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=643

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL+ D+QALL F++  PHGR++NW+    +CT+WVG+TCS D + V+ +RLPGVG  G 
Sbjct  22   ADLENDKQALLQFSALIPHGRKVNWNSTTPVCTAWVGITCSSDNNSVIAVRLPGVGLKGL  81

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+LD L+ +SLRSNLLSGSLP+D+LSLPSLQ +YLQ+NN SG IPS+LSP+L  
Sbjct  82   IPVNTLGKLDHLSIISLRSNLLSGSLPADLLSLPSLQYVYLQKNNLSGKIPSSLSPQLIT  141

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DL+ NS  G IP  V+NLT+L  L
Sbjct  142  LDLASNSLEGEIPSSVRNLTNLNKL  166



>ref|XP_010683449.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=641

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL+ D+QALL F++  PHGR++NW+    +CT+WVG+TCS D + V+ +RLPGVG  G 
Sbjct  22   ADLENDKQALLQFSALIPHGRKVNWNSTTPVCTAWVGITCSSDNNSVIAVRLPGVGLKGL  81

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+LD L+ +SLRSNLLSGSLP+D+LSLPSLQ +YLQ+NN SG IPS+LSP+L  
Sbjct  82   IPVNTLGKLDHLSIISLRSNLLSGSLPADLLSLPSLQYVYLQKNNLSGKIPSSLSPQLIT  141

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DL+ NS  G IP  V+NLT+L  L
Sbjct  142  LDLASNSLEGEIPSSVRNLTNLNKL  166



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = +3

Query  240  VLCVLLFQKVVS--DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRV  413
                LL    VS  DL+ D+QALL+FAS  PH R+LNW+    ICTSW G+TCS++  RV
Sbjct  7    AFVFLLLSPFVSPADLETDKQALLEFASLVPHVRKLNWNTTLPICTSWTGITCSKNNDRV  66

Query  414  VELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFS  593
              LRLPG G  GP+PE T  +LDAL  +SLRSN L GS+PS +LSLP ++++Y   NNFS
Sbjct  67   TALRLPGSGLYGPLPEKTFEKLDALRIISLRSNNLQGSIPSAILSLPFIRSLYFHDNNFS  126

Query  594  GDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            G IP TLSP L  +DLS N+ +GNIP  ++NLT LT L+
Sbjct  127  GSIPPTLSPRLVNLDLSANALSGNIPGTLRNLTQLTDLS  165



>ref|XP_009391668.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391669.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 123/165 (75%), Gaps = 1/165 (1%)
 Frame = +3

Query  219  SFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCS  395
            SF++LP+++ VL F   V +DL +D+Q L+ FA++  H  +L W+   SIC++WVGVTCS
Sbjct  18   SFASLPVLVIVLFFLSAVTADLSSDKQVLIAFANSIHHSSKLKWNSNNSICSTWVGVTCS  77

Query  396  EDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYL  575
             D + V+ LRLPG+G  G IP NT+G+LD L  LSLRSN L+G+LPSD+ SLPSL+ +YL
Sbjct  78   LDRTHVLALRLPGIGLYGSIPANTLGKLDHLRVLSLRSNRLTGNLPSDIFSLPSLKFLYL  137

Query  576  QRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            Q N+FSG++P++L   L+ +DLS+N  TG IP ++QNL+ L+ LN
Sbjct  138  QHNSFSGELPTSLPSALESLDLSYNFLTGEIPTRIQNLSQLSVLN  182



>ref|XP_008234182.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=601

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 118/170 (69%), Gaps = 1/170 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQK-VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL  S + L  +  +  F   V++DL +DRQALL+FA+A  H ++LNW+  A +C SWV
Sbjct  1    MKLQFSIAALIFLFLIRHFSSSVIADLNSDRQALLNFAAAVGHTQKLNWNAAAPVCASWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ + + V  + LP VG  G IP N+IG+L AL  LSL SN L GSLPSD+LS+PSL
Sbjct  61   GITCNLNKTSVTAIHLPAVGLFGSIPANSIGKLAALRVLSLHSNFLYGSLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            + +YLQ NNFSG  P++LS     +D SFNSF+G+IP  VQNLT LT L+
Sbjct  121  EYLYLQHNNFSGVFPASLSHNFILLDFSFNSFSGDIPTTVQNLTRLTALS  170



>ref|XP_008813231.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008813232.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=444

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            + ++P +  +L F      DL++D+Q LL F  A  H  +LNW+   S+C+SW+GVTC+ 
Sbjct  8    YFSVPFLFLLLCFPSSATGDLRSDKQLLLAFVDAVYHPPKLNWNSNTSLCSSWIGVTCTA  67

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D +RV+ LRLPGVG SG IP NT+G+LDAL  LSLRSN LSG+LPSD++SLPSLQN+YLQ
Sbjct  68   DQTRVLALRLPGVGLSGLIPANTLGKLDALQVLSLRSNRLSGNLPSDIISLPSLQNLYLQ  127

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKV  680
             NN SGDIP++LS  L  +DLS+NSFTG IP+ +
Sbjct  128  HNNLSGDIPASLSLGLTSLDLSYNSFTGEIPLGI  161



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = +3

Query  240  VLCVLLFQKVVS--DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRV  413
                LL    VS  D+ +D+QALL+FAS  PH R+LNW+    ICTSW G+TCS++  RV
Sbjct  7    AFVFLLLSPFVSPADIDSDKQALLEFASLVPHVRKLNWNTTLPICTSWTGITCSKNNDRV  66

Query  414  VELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFS  593
              LRLPG G  GP+PE T  +LDAL  +SLRSN L GS+PS +LSLP ++++Y   NNFS
Sbjct  67   TALRLPGSGLYGPLPEKTFEKLDALRIISLRSNNLQGSIPSAILSLPFIRSLYFHDNNFS  126

Query  594  GDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            G IP TLSP L  +DLS N+ +GNIP  ++NLT LT L+
Sbjct  127  GSIPPTLSPRLVNLDLSANALSGNIPGTLRNLTQLTDLS  165



>ref|XP_010543666.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 isoform X2 [Tarenaya hassleriana]
Length=675

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 3/160 (2%)
 Frame = +3

Query  237  LVLCVLLFQ---KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGS  407
            L+   LLF     VV++L +D+QALL+F +A PH R+LNW+    IC SW+GVTC+ + +
Sbjct  55   LIFTGLLFHNSVSVVANLVSDQQALLNFVAAFPHPRKLNWNSGLPICASWIGVTCNMNRT  114

Query  408  RVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNN  587
            RVV +RLPGVG  G IP +TIG+LDAL  LSLRSN LSG+LP+D+ SLPSLQ +YLQ N 
Sbjct  115  RVVAVRLPGVGLYGSIPPDTIGKLDALRVLSLRSNYLSGNLPTDITSLPSLQYLYLQHNG  174

Query  588  FSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             SG++ S+ S +L  +DLS+NSFTGNIP+ V+N + LT L
Sbjct  175  LSGELTSSFSDQLIVLDLSYNSFTGNIPLGVKNSSQLTVL  214



>ref|XP_004958707.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Setaria italica]
 ref|XP_004958708.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Setaria italica]
 ref|XP_004958709.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Setaria italica]
Length=639

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            VV+DL +++QALLDF SA  HG +LNW    S C SW G+ CS D S + ELR+P  G  
Sbjct  27   VVADLASEKQALLDFISAVSHGNKLNWDKNTSSC-SWHGIKCSADQSHIFELRVPAAGLI  85

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP NT+G+LD+L  LSLRSN L+GSLPSDV SLPSL++IYLQ N FS  +PS+ SP L
Sbjct  86   GAIPPNTLGKLDSLQVLSLRSNRLTGSLPSDVASLPSLRSIYLQHNEFSEQLPSSFSPSL  145

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
              IDLS+NSFTG +P  +Q LT LT LN
Sbjct  146  GVIDLSYNSFTGEVPASLQKLTQLTVLN  173



>ref|XP_010543665.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 isoform X1 [Tarenaya hassleriana]
Length=712

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 119/160 (74%), Gaps = 3/160 (2%)
 Frame = +3

Query  237  LVLCVLLFQ---KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGS  407
            L+   LLF     VV++L +D+QALL+F +A PH R+LNW+    IC SW+GVTC+ + +
Sbjct  92   LIFTGLLFHNSVSVVANLVSDQQALLNFVAAFPHPRKLNWNSGLPICASWIGVTCNMNRT  151

Query  408  RVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNN  587
            RVV +RLPGVG  G IP +TIG+LDAL  LSLRSN LSG+LP+D+ SLPSLQ +YLQ N 
Sbjct  152  RVVAVRLPGVGLYGSIPPDTIGKLDALRVLSLRSNYLSGNLPTDITSLPSLQYLYLQHNG  211

Query  588  FSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             SG++ S+ S +L  +DLS+NSFTGNIP+ V+N + LT L
Sbjct  212  LSGELTSSFSDQLIVLDLSYNSFTGNIPLGVKNSSQLTVL  251



>ref|XP_008813233.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=636

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSE  398
            + ++P +  +L F      DL++D+Q LL F  A  H  +LNW+   S+C+SW+GVTC+ 
Sbjct  8    YFSVPFLFLLLCFPSSATGDLRSDKQLLLAFVDAVYHPPKLNWNSNTSLCSSWIGVTCTA  67

Query  399  DGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQ  578
            D +RV+ LRLPGVG SG IP NT+G+LDAL  LSLRSN LSG+LPSD++SLPSLQN+YLQ
Sbjct  68   DQTRVLALRLPGVGLSGLIPANTLGKLDALQVLSLRSNRLSGNLPSDIISLPSLQNLYLQ  127

Query  579  RNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKV  680
             NN SGDIP++LS  L  +DLS+NSFTG IP+ +
Sbjct  128  HNNLSGDIPASLSLGLTSLDLSYNSFTGEIPLGI  161



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +D+ +D+QALL+FAS  PH R+LNW+    ICTSW G+TCS++ +RV+ LRLPG G  GP
Sbjct  22   ADIDSDKQALLEFASLVPHSRKLNWNTTNPICTSWTGITCSKNNARVIALRLPGSGLYGP  81

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            +P+ T  +LDAL  +SLRSN L G++PS +LSLP ++++Y   NNFSG IP TLS  L  
Sbjct  82   LPDQTFEKLDALRIISLRSNNLQGNIPSAILSLPFIRSLYFHDNNFSGTIPPTLSRRLVN  141

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLS NS +GNIP  ++NLT LT L+
Sbjct  142  LDLSTNSLSGNIPTTLRNLTQLTDLS  167



>gb|EYU42048.1| hypothetical protein MIMGU_mgv1a003031mg [Erythranthe guttata]
Length=614

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 120/180 (67%), Gaps = 20/180 (11%)
 Frame = +3

Query  204  MKLYTSFSTLPL-VLCVLLFQ--KVVSDLKADRQALLDFASATPHGRRLNWSMKASICTS  374
            MKL+   S+L +      LFQ  K+ +DL +DR++LLDFAS+ PH  RLNW   +SIC+S
Sbjct  1    MKLFLHSSSLSIWCFFFYLFQVPKITADLNSDRESLLDFASSVPHAPRLNWKNTSSICSS  60

Query  375  WVGVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslp  554
            W GVTC+ D +RV+ LRLP +G  GPIPENT+ RLDALTTLSLRSN L+G LPS +LSLP
Sbjct  61   WSGVTCTPDATRVMALRLPALGLIGPIPENTLTRLDALTTLSLRSNYLNGPLPSHLLSLP  120

Query  555  slQNIYLQRNNFSGDIPSTLS-----------------PELDFIDLSFNSFTGNIPVKVQ  683
            SL+ I LQ NNFSGD+PS  S                 P+L  ++LS N F G+IP  +Q
Sbjct  121  SLRYINLQHNNFSGDVPSFFSSQLNNNSLSGSIPDLNLPKLKQLNLSNNHFNGSIPSHLQ  180



>ref|XP_010055829.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055830.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055831.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 ref|XP_010055832.1| PREDICTED: probable inactive receptor kinase At4g23740 [Eucalyptus 
grandis]
 gb|KCW72378.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72379.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
 gb|KCW72380.1| hypothetical protein EUGRSUZ_E00832 [Eucalyptus grandis]
Length=634

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +DL  D+QALLDFA   PH R LNW+  + +C++WVGVTC +DGSRV+ LRLPGVGF GP
Sbjct  26   ADLAGDKQALLDFADNLPHSRYLNWTESSPVCSNWVGVTCDKDGSRVIALRLPGVGFHGP  85

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS--PEL  626
            IP NT+GRL  L  LSLRSN ++GS PSD  +L +L  +YLQ N FSG +P   S    L
Sbjct  86   IPANTLGRLSDLQILSLRSNAITGSFPSDFANLKNLSYLYLQSNKFSGPLPRDFSVWKNL  145

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
              ++LS N+F G+IP  +  LT L GLN
Sbjct  146  TILNLSNNAFNGSIPSSLATLTQLDGLN  173



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK+  +F  L L++   + +   +D+++D+QALL+FAS  PH R+LNW+    IC SW G
Sbjct  1    MKIIAAF--LFLLVSPFVSRCFSADIESDKQALLEFASLVPHSRKLNWNSTIPICGSWTG  58

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TCS++ +RV  LRLPG G  GP+PE T  +LDAL  +SLRSN L G++PS +LSLP ++
Sbjct  59   ITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNNLQGNIPSVILSLPFIR  118

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++Y   NNFSG IP  LS  L  +DLS NS +GNIP  +QNLT LT L+
Sbjct  119  SLYFHDNNFSGTIPPVLSRRLVNLDLSANSLSGNIPSSLQNLTQLTDLS  167



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            +D+  D+QALL+FAS  PH R+LNW+    ICTSW G+TCS++ +RV  LRLPG G  GP
Sbjct  20   TDIDTDKQALLEFASLVPHVRKLNWNTTIPICTSWTGITCSKNNARVTALRLPGSGLYGP  79

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            +PE T  +LDAL  +SLRSN L GS+PS +LSLP ++++Y   NNFSG IP  LSP L  
Sbjct  80   LPEKTFEQLDALRIISLRSNNLQGSIPSAILSLPFIRSLYFHDNNFSGSIPPALSPRLVN  139

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLS NS +G+IP  ++NLT LT L+
Sbjct  140  LDLSANSLSGSIPGTLRNLTQLTDLS  165



>ref|XP_009399835.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009399836.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L  D+QALLDF ++T H R L+WS    +C+ W GVTCS DGSRV+ +RLPG+GFSGPIP
Sbjct  27   LVEDKQALLDFLASTVHTRSLDWSPITDVCSRWYGVTCSADGSRVITVRLPGIGFSGPIP  86

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSP--ELDF  632
             NT+ RL AL  LS+RSN L+G  P+D  +L +L  ++LQ N+FSG +PS  SP   L  
Sbjct  87   PNTLSRLSALQILSIRSNSLTGPFPADFANLTALTGLHLQLNSFSGPLPSDFSPWKNLTA  146

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +D+SFN F G+IP  + NLT LT LN
Sbjct  147  LDVSFNDFNGSIPTTISNLTQLTALN  172



>ref|NP_001169737.1| uncharacterized LOC100383618 precursor [Zea mays]
 gb|ACN34721.1| unknown [Zea mays]
 tpg|DAA64145.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=636

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            +V++L +++QALLDF SA  HG +LNW    S+C SW GV CSED S+V ELR+P  G  
Sbjct  27   IVANLSSEKQALLDFVSAVYHGNKLNWDKHTSVC-SWHGVKCSEDQSQVFELRVPAAGLI  85

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G I  NT+G+L +L  LSLRSN L+GSLP+DV SLPSL++IYLQ N  SG +PS+ SP L
Sbjct  86   GVISPNTLGKLYSLQVLSLRSNRLTGSLPADVASLPSLRSIYLQHNELSGGLPSSFSPNL  145

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
              ID S+NSFTG +P  +QNLT LT LN
Sbjct  146  SVIDFSYNSFTGEVPASLQNLTQLTVLN  173



>gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 122/162 (75%), Gaps = 4/162 (2%)
 Frame = +3

Query  231  LPLVLCVLLF--QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDG  404
            L L    LLF   +  +DL +D+QALL+FA+A PH R+LNW+    +C +WVG+TC  +G
Sbjct  8    LALTFQSLLFFLPQTSADLNSDKQALLNFAAAVPHRRKLNWNSTTPVCKTWVGITC--NG  65

Query  405  SRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRN  584
            SRV  +RLPG G  G IP NT+ +LDAL TLSLRSN LSG LPSD+LSLPSL+ +YLQ N
Sbjct  66   SRVTSVRLPGTGLYGRIPANTLEKLDALMTLSLRSNRLSGDLPSDLLSLPSLRYVYLQHN  125

Query  585  NFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            NFSG IP +LS  L+ +DLS+NSFTG+IP+ VQNLT+LT LN
Sbjct  126  NFSGTIPLSLSSHLNSLDLSYNSFTGSIPITVQNLTNLTSLN  167



>ref|XP_009399834.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=666

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L  D+QALLDF ++T H R L+WS    +C+ W GVTCS DGSRV+ +RLPG+GFSGPIP
Sbjct  27   LVEDKQALLDFLASTVHTRSLDWSPITDVCSRWYGVTCSADGSRVITVRLPGIGFSGPIP  86

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSP--ELDF  632
             NT+ RL AL  LS+RSN L+G  P+D  +L +L  ++LQ N+FSG +PS  SP   L  
Sbjct  87   PNTLSRLSALQILSIRSNSLTGPFPADFANLTALTGLHLQLNSFSGPLPSDFSPWKNLTA  146

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +D+SFN F G+IP  + NLT LT LN
Sbjct  147  LDVSFNDFNGSIPTTISNLTQLTALN  172



>ref|XP_009628885.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
 ref|XP_009628886.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
tomentosiformis]
Length=625

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 106/166 (64%), Gaps = 2/166 (1%)
 Frame = +3

Query  216  TSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCS  395
            T F  L ++ C  LF    S+   D++ALLDF     H R LNW ++ S C SW GVTC+
Sbjct  3    TKFHFLSVLFCSTLFWLASSEPFEDKEALLDFLDNINHSRYLNWDVQTSACNSWTGVTCN  62

Query  396  EDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYL  575
             D SR++ +RLPGVGF G IP NT+ RL AL  LSLRSN LSG  PS+   L +L ++YL
Sbjct  63   HDNSRIIAVRLPGVGFRGSIPVNTLSRLSALQILSLRSNSLSGPFPSEFAKLGNLTSLYL  122

Query  576  QRNNFSGDIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            Q NN SG +P+  S    L  +DLS+N F+G+IP  V NLTHLT L
Sbjct  123  QSNNISGSLPADFSAWKSLSVLDLSYNDFSGSIPSSVSNLTHLTAL  168



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/169 (49%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            MK+  +F  L L++     +   +D+++D+QALL+FAS  PH R+LNW+    IC SW G
Sbjct  2    MKIVAAF--LFLLVSPFASRCFAADIESDKQALLEFASLVPHSRKLNWNSSIPICNSWTG  59

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            +TCS++ +RV  LRLPG G  GP+PE T  +LDAL  +SLRSN L G++P  +LSLP ++
Sbjct  60   ITCSKNNARVTALRLPGSGLYGPLPEKTFEKLDALRIISLRSNYLQGNIPPVILSLPFIR  119

Query  564  NIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++Y   NNFSG IP   +  L  +DLS NS TG IP  +QNLT LT L+
Sbjct  120  SLYFHDNNFSGTIPPAFAHRLVNLDLSANSLTGKIPASLQNLTQLTDLS  168



>gb|KHF99691.1| hypothetical protein F383_18108 [Gossypium arboreum]
Length=609

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 109/151 (72%), Gaps = 6/151 (4%)
 Frame = +3

Query  258  FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGV  437
            F +VV+DL +D+QALL+FA+  PH ++LNW++   +CTSWVG+TC+ +G+ V+ +RLPGV
Sbjct  20   FVQVVADLDSDKQALLEFANGVPHVKKLNWNLATPVCTSWVGITCNTNGTDVIAVRLPGV  79

Query  438  GFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS  617
            G  G IP NTIG+L AL  LSLRSN ++GSLPSD+ S+PSLQ ++LQ NN S   P T S
Sbjct  80   GLYGTIPSNTIGKLKALKVLSLRSNNINGSLPSDIPSIPSLQCLFLQHNNLSSKFPVTFS  139

Query  618  PELDFIDLSFNSFTGNIP------VKVQNLT  692
            P L  +D S+NS +G IP      VKV N +
Sbjct  140  PRLRIVDFSYNSISGTIPNVDLPSVKVLNFS  170



>ref|XP_002509916.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51303.1| ATP binding protein, putative [Ricinus communis]
Length=536

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 111/171 (65%), Gaps = 4/171 (2%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVG  383
            M+    FS++  V   L    V +D   D+QALLDF +   H R LNW+  + +C++W G
Sbjct  1    MEAKYIFSSIVFVGLALFL--VNADPVEDKQALLDFVNKLHHSRLLNWNESSPVCSNWTG  58

Query  384  VTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQ  563
            VTCS+DGSRV+ LRLPGVGF GPIP NTI RL AL  LSLRSNL+SG  PSD  +L +L 
Sbjct  59   VTCSKDGSRVIALRLPGVGFQGPIPSNTISRLSALQVLSLRSNLISGEFPSDFFNLKNLS  118

Query  564  NIYLQRNNFSGDIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +YLQ NN SG +P   S    L  I+LS N F G+IP+ + NLTHL  LN
Sbjct  119  FLYLQYNNLSGSLPVDFSVWSNLTIINLSNNRFNGSIPLSLSNLTHLAALN  169



>ref|XP_009796898.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796899.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
 ref|XP_009796900.1| PREDICTED: probable inactive receptor kinase At4g23740 [Nicotiana 
sylvestris]
Length=625

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 2/164 (1%)
 Frame = +3

Query  222  FSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSED  401
            F  L ++ C  LF    S+   D++ALLDF     H R LNW ++ S C SW GVTC+ D
Sbjct  5    FHFLSVLFCSTLFWLASSEPFEDKEALLDFLDNINHSRYLNWDVQTSACNSWTGVTCNHD  64

Query  402  GSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQR  581
             SR++ +RLPGVGF G IP NT+ RL AL  LSLRSN LSG  PS+  +L  L ++YLQ 
Sbjct  65   NSRIIAVRLPGVGFRGSIPVNTLSRLSALQILSLRSNSLSGPFPSEFANLGDLTSLYLQS  124

Query  582  NNFSGDIPSTLSP--ELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            NNF+G +P+  S    L  +DLS+N F+G+IP  V NLTHLT L
Sbjct  125  NNFNGSLPADFSAWKSLSVLDLSYNDFSGSIPSSVSNLTHLTAL  168



>ref|XP_002299495.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE84300.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 107/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  240  VLCVLL-----FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDG  404
            +LC++L     F +V SD   D+QALLDF +  PH R LNW+  + +C +W GV CS DG
Sbjct  6    ILCLILLVEFVFFQVNSDPVEDKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDG  65

Query  405  SRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRN  584
            +RV+ +RLPGVGF GPIP NT+ RL AL  LSLRSN +SG  P D+ +L +L  +YLQ N
Sbjct  66   TRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSNGISGEFPFDISNLKNLSFLYLQYN  125

Query  585  NFSGDIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N SG +P   S  P L  ++LS N F G+IP    NL+HL  LN
Sbjct  126  NLSGSLPVDFSLWPNLTIVNLSNNRFNGSIPYSFSNLSHLAALN  169



>ref|XP_002441272.1| hypothetical protein SORBIDRAFT_09g023570 [Sorghum bicolor]
 gb|EES19702.1| hypothetical protein SORBIDRAFT_09g023570 [Sorghum bicolor]
Length=633

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            SDL  D+QALL FA++ PHGR++NW+    +CTSWVG+TC+ DG+RV E+RLP +G  GP
Sbjct  25   SDLNTDKQALLAFAASLPHGRKVNWTSTTQVCTSWVGITCTLDGTRVREVRLPAIGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP  T+G+LDAL  LSLRSN L+ +LP DV S+PSL+++YLQ NN SG IPS+LS  L F
Sbjct  85   IPSGTLGKLDALEVLSLRSNRLTINLPPDVPSIPSLRSLYLQHNNLSGIIPSSLSSSLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP +VQ +T LT L
Sbjct  145  LDLSYNSFNGEIPSEVQAITELTAL  169



>ref|XP_011026938.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
 ref|XP_011026939.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X2 [Populus euphratica]
Length=626

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  240  VLCVLLFQKVV-----SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDG  404
            +LC++L  +VV     SD   D+QALLDF +  PH R LNW+  + +C +W GV CS DG
Sbjct  6    ILCLILLVEVVFFQVNSDPVEDKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDG  65

Query  405  SRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRN  584
            +RV+ +RLPGVGF GPIP NT+ RL AL  LSLRSN +SG  P D+ +L +L  +YLQ N
Sbjct  66   TRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSNGISGEFPFDISNLKNLSFLYLQYN  125

Query  585  NFSGDIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N SG +P   S  P L  ++LS N F G IP    NL+HL  LN
Sbjct  126  NLSGSLPVDFSLWPNLIIVNLSNNRFNGRIPYSFSNLSHLAALN  169



>ref|XP_011026937.1| PREDICTED: probable inactive receptor kinase At4g23740 isoform 
X1 [Populus euphratica]
Length=652

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 106/164 (65%), Gaps = 7/164 (4%)
 Frame = +3

Query  240  VLCVLLFQKVV-----SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDG  404
            +LC++L  +VV     SD   D+QALLDF +  PH R LNW+  + +C +W GV CS DG
Sbjct  32   ILCLILLVEVVFFQVNSDPVEDKQALLDFVNNLPHSRSLNWNESSPVCNNWTGVICSGDG  91

Query  405  SRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRN  584
            +RV+ +RLPGVGF GPIP NT+ RL AL  LSLRSN +SG  P D+ +L +L  +YLQ N
Sbjct  92   TRVIAVRLPGVGFHGPIPPNTLSRLSALQILSLRSNGISGEFPFDISNLKNLSFLYLQYN  151

Query  585  NFSGDIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            N SG +P   S  P L  ++LS N F G IP    NL+HL  LN
Sbjct  152  NLSGSLPVDFSLWPNLIIVNLSNNRFNGRIPYSFSNLSHLAALN  195



>ref|XP_003562443.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233863.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233866.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
 ref|XP_010233870.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=640

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+DL +++QALL FAS    G +LNW    S+C SW GVTCS D SR+ ELR+PG G  G
Sbjct  28   VADLASEKQALLAFASEVYRGNKLNWDQSTSVC-SWHGVTCSGDQSRIFELRVPGAGLIG  86

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
             IP NT+G+LD+L  LSLRSN LSGSLPSDV  LPSL+ IYLQ N  +GD+PS+ +P L 
Sbjct  87   EIPPNTLGKLDSLQVLSLRSNRLSGSLPSDVALLPSLRYIYLQHNELTGDLPSSFNPNLS  146

Query  630  FIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             ++LS+NSF G IP  ++NLT L+ LN
Sbjct  147  VLELSYNSFIGKIPTSLENLTELSLLN  173



>ref|XP_006650037.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=635

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
              +D+ +++QALL FASA  HG +LNW +  S C  W GVTCS D SR+  LR+P  G  
Sbjct  22   AAADITSEKQALLAFASAVYHGNKLNWDLNISSCL-WHGVTCSPDRSRISALRVPAAGLI  80

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP NT+GRL +L  LSLRSN LSGS+PSD+ SLPSLQ+I+LQ N  SGD+PS  SP L
Sbjct  81   GAIPTNTLGRLVSLQVLSLRSNRLSGSIPSDITSLPSLQSIFLQDNELSGDLPSFFSPTL  140

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            + IDLS+NSFTG IP  +QNLT L+ LN
Sbjct  141  NTIDLSYNSFTGQIPASLQNLTQLSTLN  168



>ref|XP_008437363.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437364.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437365.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
 ref|XP_008437367.1| PREDICTED: probable inactive receptor kinase At4g23740 [Cucumis 
melo]
Length=628

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            L+F  +  D   D+ ALLDF    PH R LNW+  + +C  W G+TCS+D SRV+ +RLP
Sbjct  15   LVFSPINGDPVEDKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQDESRVIAVRLP  74

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPST  611
            GVGF GPIP NT+ RL AL  LSLRSN ++G  P D   L +L  +YLQ NNFSG +PS 
Sbjct  75   GVGFHGPIPPNTLSRLSALQILSLRSNRITGDFPLDFSKLSNLSYLYLQFNNFSGPLPSN  134

Query  612  LS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             S    L F++LS N F G IP  + NLT LTGLN
Sbjct  135  FSVWKNLIFVNLSNNGFNGQIPNSLSNLTSLTGLN  169



>ref|XP_006350601.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006350602.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006350603.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X3 [Solanum tuberosum]
Length=629

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 108/171 (63%), Gaps = 2/171 (1%)
 Frame = +3

Query  201  RMKLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            R ++ T F    ++ C  LF    S+   D++ALLDF +   H R LNW  + S C+SW 
Sbjct  2    RRRMATKFLFFSVLFCTALFWLASSEPYEDKEALLDFLNNVNHTRNLNWDERTSACSSWT  61

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            GVTC+ D SR++ +RLPGVGF G IP NT+ RL  L  LSLRSN  SGSLP+D   L +L
Sbjct  62   GVTCNHDKSRIIAIRLPGVGFRGSIPGNTLSRLSDLQILSLRSNSFSGSLPTDFAKLGNL  121

Query  561  QNIYLQRNNFSGDIPSTLSP--ELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             +IYLQ NNF G +P+  S    L  ++LS N F+G+IP  + NLTHLT L
Sbjct  122  TSIYLQSNNFQGPLPADFSAWKSLSVLNLSNNDFSGSIPSSISNLTHLTAL  172



>ref|XP_004143879.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Cucumis 
sativus]
 gb|KGN50039.1| hypothetical protein Csa_5G151550 [Cucumis sativus]
Length=628

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            L+F  +  D   D+ ALLDF    PH R LNW+  + +C  W G+TCS+D SRV+ +RLP
Sbjct  15   LVFSPINGDPVEDKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQDESRVIAVRLP  74

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPST  611
            GVGF GPIP NT+ RL AL  LSLRSN ++G  P D   L +L  +YLQ NNFSG +PS 
Sbjct  75   GVGFHGPIPPNTLSRLSALQILSLRSNRITGDFPLDFSKLSNLSYLYLQFNNFSGPLPSN  134

Query  612  LS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             S    L F++LS N F G IP  + NLT LTGLN
Sbjct  135  FSVWKNLVFVNLSNNGFNGQIPNSLSNLTSLTGLN  169



>ref|XP_004167870.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At4g23740-like [Cucumis sativus]
Length=628

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 100/155 (65%), Gaps = 2/155 (1%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            L+F  +  D   D+ ALLDF    PH R LNW+  + +C  W G+TCS+D SRV+ +RLP
Sbjct  15   LVFSPINGDPVEDKLALLDFVKNLPHSRSLNWNAASPVCHYWTGITCSQDESRVIAVRLP  74

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPST  611
            GVGF GPIP NT+ RL AL  LSLRSN ++G  P D   L +L  +YLQ NNFSG +PS 
Sbjct  75   GVGFHGPIPPNTLSRLSALQILSLRSNRITGDFPLDFSKLSNLSYLYLQFNNFSGPLPSN  134

Query  612  LS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             S    L F++LS N F G IP  + NLT LTGLN
Sbjct  135  FSVWKNLVFVNLSNNGFNGQIPNSLSNLTSLTGLN  169



>ref|NP_001050019.1| Os03g0332900 [Oryza sativa Japonica Group]
 gb|ABF95778.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95779.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11933.1| Os03g0332900 [Oryza sativa Japonica Group]
 dbj|BAG95872.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59003.1| hypothetical protein OsJ_10722 [Oryza sativa Japonica Group]
Length=634

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
             V+D+ +++QALL FASA   G +LNW +  S+C SW GVTCS D SR+  LR+P  G  
Sbjct  22   AVADIASEKQALLAFASAVYRGNKLNWDVNISLC-SWHGVTCSPDRSRISALRVPAAGLI  80

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP NT+GRL +L  LSLRSN L GS+PSD+ SLPSLQ+I+LQ N  SGD+PS  SP L
Sbjct  81   GAIPPNTLGRLVSLQVLSLRSNRLIGSIPSDITSLPSLQSIFLQDNELSGDLPSFFSPTL  140

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            + IDLS+NSF G IP  +QNLT L+ LN
Sbjct  141  NTIDLSYNSFAGQIPASLQNLTQLSTLN  168



>ref|XP_010254253.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nelumbo 
nucifera]
Length=648

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 104/155 (67%), Gaps = 3/155 (2%)
 Frame = +3

Query  249  VLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRL  428
            +LL ++V  +   D+QALLDF S TPH  R  W+  AS C SWVGV C  + S VV LRL
Sbjct  17   LLLGRRVHPEPTQDKQALLDFISLTPHANRPQWNSSASAC-SWVGVECDANQSHVVVLRL  75

Query  429  PGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPS  608
            PGVG  GP+P NT+GRL  L  LSLRSN LSG +P+D   L  L N+YLQ N FSG+ PS
Sbjct  76   PGVGLVGPVPPNTLGRLSQLRVLSLRSNRLSGEIPADFSQLKLLHNLYLQHNLFSGEFPS  135

Query  609  TLSP--ELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            +L+    L  +DLSFN+FTG IP  + NLT LTGL
Sbjct  136  SLTQLTRLTRLDLSFNNFTGKIPFSINNLTRLTGL  170



>ref|XP_009363779.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=635

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 106/147 (72%), Gaps = 0/147 (0%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            V+SDL +D QALL+FA    H R+LNW+    +CTSWVG+TC+ + + V  + LPG+G  
Sbjct  23   VLSDLNSDGQALLNFAGTVVHTRKLNWNASIPVCTSWVGITCNLNKTGVTAIHLPGIGLF  82

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP N+IG+L AL  LSL SN L GSLPSD+ S+PSL+ +YL  NNFSG +P++L   L
Sbjct  83   GSIPSNSIGKLRALRVLSLHSNFLYGSLPSDIPSIPSLEYLYLHHNNFSGMLPASLPANL  142

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGL  707
              +D SFNSF+GNIP K+QNLT LT L
Sbjct  143  IVLDFSFNSFSGNIPPKIQNLTRLTTL  169



>gb|KJB67957.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67958.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67959.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
Length=609

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 6/152 (4%)
 Frame = +3

Query  258  FQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGV  437
            F +VV+DL +D+QALL+FA+  PH ++LNW++   +CTSWVG+TC+ + + V+ +RLPGV
Sbjct  20   FVQVVADLDSDKQALLEFANGVPHVKKLNWNLATPVCTSWVGITCNTNRTDVIAVRLPGV  79

Query  438  GFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS  617
            G  G IP NTIG+L AL  LSLRSN ++GSLPSD+ S+PSLQ ++LQ NN S   P T S
Sbjct  80   GLYGTIPSNTIGKLKALKVLSLRSNNINGSLPSDIPSIPSLQCLFLQHNNLSSKFPVTFS  139

Query  618  PELDFIDLSFNSFTGNIP------VKVQNLTH  695
            P L  +D S+NS +G IP      VKV N ++
Sbjct  140  PMLRIVDFSYNSISGTIPNVDLPSVKVLNFSY  171



>ref|XP_009362808.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Pyrus x bretschneideri]
Length=530

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 113/162 (70%), Gaps = 1/162 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL  S STL  ++ +  F   + S L +DRQALL+FA+   H R+LNW+    +CTSWV
Sbjct  1    MKLQVSVSTLIFLILIPPFPSSLFSYLNSDRQALLNFAATVVHIRKLNWNASTPVCTSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ + + V  + LPG+G  G IP N+IG+L AL  LSLRSN L GSLPSD+ S+PSL
Sbjct  61   GITCNLNKTSVTAIHLPGIGLFGSIPSNSIGKLHALRVLSLRSNFLYGSLPSDIPSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQN  686
              +YLQ NNFSG +P++L P L  +D  FNSF+G+IP +VQN
Sbjct  121  VYLYLQHNNFSGVLPASLPPNLVVLDFPFNSFSGSIPTEVQN  162



>ref|XP_008649769.1| PREDICTED: probable inactive receptor kinase At5g58300 [Zea mays]
 ref|XP_008649770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Zea mays]
 gb|AFW78394.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=634

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 110/145 (76%), Gaps = 0/145 (0%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            SDL  D+QALL FA++ PHGR++NW+    +CTSWVG+TC+ D  RV E+RLP +G  GP
Sbjct  25   SDLNTDKQALLAFAASLPHGRKVNWTSTTQVCTSWVGITCTPDMKRVREVRLPAIGLFGP  84

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP  T+ +LDAL  LSLRSN L+ +LP DV S+PSL+++YLQ NN SG IPS+LS  L F
Sbjct  85   IPSGTLSKLDALEVLSLRSNRLTINLPPDVPSIPSLRSLYLQHNNLSGIIPSSLSSSLTF  144

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGL  707
            +DLS+NSF G IP KVQ++T LT L
Sbjct  145  LDLSYNSFNGEIPSKVQDITELTAL  169



>gb|KDP25339.1| hypothetical protein JCGZ_20495 [Jatropha curcas]
Length=627

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            V +D   D +ALLDFAS  PH R LNW+    +C +W G+TCSED SRV+ +RLPGVGF 
Sbjct  20   VNADPVEDMRALLDFASNLPHSRSLNWNESYPVCNNWTGITCSEDRSRVIAVRLPGVGFQ  79

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS--P  620
            GPIP NT+ RL AL  LSLRSN +SG  P D  +L +L  +YLQ NN SG +PS  S   
Sbjct  80   GPIPPNTLSRLSALQILSLRSNRISGQFPHDFSNLKNLSFLYLQYNNLSGSLPSDFSIWN  139

Query  621  ELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             L  I+LS N F G+IP  + NLTHL  LN
Sbjct  140  NLTIINLSNNRFNGSIPHSLSNLTHLAALN  169



>ref|XP_010452417.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Camelina sativa]
Length=638

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 122/175 (70%), Gaps = 9/175 (5%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQK----VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSW  377
            + +S +      C LL       V +DL +D QALL+FA++ PH  +LNW+   S+CTSW
Sbjct  1    MTSSHTAFAAASCFLLLAATAVLVSADLASDEQALLNFAASVPHPPKLNWNKNLSLCTSW  60

Query  378  VGVTCSEDG--SRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlsl  551
            +G+TC +    SRVV +RLPGVG  G +P  T+G+LDAL  LSLRSN L G+LPSD+LSL
Sbjct  61   IGITCDDTNRTSRVVAVRLPGVGLYGSVPPATLGKLDALKVLSLRSNSLFGTLPSDILSL  120

Query  552  pslQNIYLQRNNFSGDIPSTL---SPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            PSLQ +YLQ NNFSG++ ++L   S +L  +DLS+NSF+GNIP  ++NL+ +T L
Sbjct  121  PSLQYLYLQHNNFSGELANSLPSISTQLVVLDLSYNSFSGNIPSGLRNLSQITVL  175



>ref|XP_002463400.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
 gb|EER99921.1| hypothetical protein SORBIDRAFT_02g043090 [Sorghum bicolor]
Length=639

 Score =   130 bits (326),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            VV+DL +++QALLDF SA  HG +LNW   ASIC SW GV CS D S+V ELR+P  G  
Sbjct  27   VVADLASEKQALLDFVSAVYHGNKLNWDKNASIC-SWHGVKCSADQSQVFELRVPAAGLI  85

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPEL  626
            G IP NT+G+LD+L  LSLRSN L+GSLPSDV  LPSL++IYLQ N  SG +PS+ SP L
Sbjct  86   GAIPPNTLGKLDSLQVLSLRSNRLTGSLPSDVTVLPSLRSIYLQHNELSGRLPSSFSPSL  145

Query  627  DFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
              ID S+NSFTG +P  +QNLT LT LN
Sbjct  146  SVIDFSYNSFTGEVPASLQNLTQLTVLN  173



>ref|XP_011073578.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 101/146 (69%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L++D+ ALLDF +  PH R LNWS +  +C +W G++CSEDGSRVV +RLPGVGF GPIP
Sbjct  31   LESDKNALLDFVNKLPHLRSLNWSEELPVCRNWTGISCSEDGSRVVSVRLPGVGFQGPIP  90

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS--PELDF  632
            ENT+ RL AL  LSLRSN ++G+ P D  +L +L ++YLQ NNFSG +P   S    L  
Sbjct  91   ENTLSRLSALQILSLRSNGINGTFPLDFGNLKNLTSLYLQYNNFSGPLPLDFSVWRNLSV  150

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++LS N F G+IP    +L  LT LN
Sbjct  151  VNLSNNGFNGHIPSSFSSLNQLTALN  176



>ref|XP_006398978.1| hypothetical protein EUTSA_v10012946mg [Eutrema salsugineum]
 gb|ESQ40431.1| hypothetical protein EUTSA_v10012946mg [Eutrema salsugineum]
Length=639

 Score =   129 bits (325),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 115/152 (76%), Gaps = 5/152 (3%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTC--SEDGSRVVELRLPGVG  440
            V +DL +D QALL+FA++ PH  +LNW+   S+C+SW+G+TC  S   SRVV +RLPGVG
Sbjct  27   VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDDSNHTSRVVAVRLPGVG  86

Query  441  FSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTL--  614
              G IP  T+G+L+AL  LSLRSN L G+LPSD+LSLPSLQ +YLQ NNFSG++ ++L  
Sbjct  87   LYGSIPPATLGKLNALKVLSLRSNSLFGTLPSDILSLPSLQYVYLQHNNFSGELTNSLPS  146

Query  615  -SPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
             S +L  +DLS+NSF+GNIP  ++NL+ LT L
Sbjct  147  ISTQLVVLDLSYNSFSGNIPSGLRNLSQLTVL  178



>ref|XP_011080874.1| PREDICTED: probable inactive receptor kinase At4g23740 [Sesamum 
indicum]
Length=631

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L++D+QALLDFAS   H R LNW+ +  +C +W GVTCSEDG+RV+ +RLPG+GF GPIP
Sbjct  31   LESDKQALLDFASKFAHLRPLNWNEQYPVCKNWTGVTCSEDGNRVISVRLPGIGFHGPIP  90

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS--PELDF  632
            ENT+ RL AL  LSLRSN ++G+ P D  +L +L  +YLQ NNFSG +P+  S    L  
Sbjct  91   ENTLSRLSALQILSLRSNGITGTFPLDFGNLKNLTFLYLQHNNFSGPLPANFSVWRNLTI  150

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++LS N F G+IP  + +L  L  LN
Sbjct  151  VNLSNNGFNGSIPRSLSSLNQLIALN  176



>ref|XP_002303623.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE78602.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            L++  +LFQ V +D   D+QALLDF    PH R LNW   + +C +W GV CS DG+RV+
Sbjct  11   LLVGFVLFQ-VNADPVEDKQALLDFVHYLPHSRSLNWKESSPVCNNWSGVICSGDGTRVI  69

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             +RLPGVGF GPIP NT+ RL AL  LSLRSN +SG  P +  +L +L  +YLQ NN SG
Sbjct  70   SVRLPGVGFHGPIPPNTLSRLSALQVLSLRSNGISGEFPFEFSNLKNLSFLYLQYNNLSG  129

Query  597  DIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +P   S  P L  ++LS N F G+IP    NL+HL  LN
Sbjct  130  SLPFDFSVWPNLTIVNLSNNRFNGSIPYSFSNLSHLAVLN  169



>ref|XP_008388375.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 111/162 (69%), Gaps = 1/162 (1%)
 Frame = +3

Query  204  MKLYTSFSTLPLVLCVLLF-QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWV  380
            MKL  S  TL  +  +  F   V SDL +DRQALL+FA+   H  +LNW+    +C SWV
Sbjct  1    MKLQVSXCTLIFLFLIPPFPSSVFSDLNSDRQALLNFAATVVHIXKLNWNXSTPVCXSWV  60

Query  381  GVTCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpsl  560
            G+TC+ + + V  + LPG+G  G IP N+ G+L  L  LSLRSN L GSLPSD+LS+PSL
Sbjct  61   GITCNLNKTSVTAIHLPGIGLFGSIPSNSXGKLHXLQVLSLRSNFLYGSLPSDILSIPSL  120

Query  561  QNIYLQRNNFSGDIPSTLSPELDFIDLSFNSFTGNIPVKVQN  686
            + +YLQ NNFSG +P++L P L  +D SFNSF+G+IP K+QN
Sbjct  121  EYLYLQHNNFSGXLPASLPPNLXVLDFSFNSFSGSIPTKIQN  162



>gb|EPS74415.1| hypothetical protein M569_00340 [Genlisea aurea]
Length=629

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L +D  ALL+FA+A PH R+LNW    SICTSW G+TCS DG+ V+ + LPG+G  G +P
Sbjct  24   LNSDASALLEFAAAVPHVRKLNWQSANSICTSWSGITCSRDGTHVIGIHLPGIGLHGSVP  83

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDFID  638
             NTIG+L AL  LSLRSN LSG LPSD+LS+PSLQ ++LQ NNFSG IP  LSP +  ID
Sbjct  84   VNTIGKLPALQVLSLRSNFLSGDLPSDLLSIPSLQYVFLQNNNFSGRIPLFLSPRISVID  143

Query  639  LSFNSFTGNIPVKVQNLTHLTGLN  710
            L+ NSF+G IP+ +     L+ L+
Sbjct  144  LASNSFSGEIPLGLSKSKRLSELH  167



>ref|XP_011001675.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=586

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = +3

Query  270  VSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSG  449
            V+ L +DRQALL+FASA PH  +LNW     ICTSWVG+TC+  GSRV+ + LPGVG  G
Sbjct  23   VAALLSDRQALLEFASAVPHSPKLNWKSSIPICTSWVGITCNTKGSRVIAVHLPGVGLYG  82

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELD  629
            PIP  T+G+LD+LT LSLRSN LSG LP+D+LSLPSL ++YLQ NNFSG IP   +  L 
Sbjct  83   PIPAKTLGKLDSLTILSLRSNFLSGDLPADLLSLPSLHSMYLQHNNFSGPIPEFNTSRLT  142

Query  630  FIDLSFNSFTGNIPVKVQNL  689
             ++LS N F G+IP  +Q  
Sbjct  143  QLNLSHNLFNGSIPAALQKF  162



>ref|XP_009413825.1| PREDICTED: probable inactive receptor kinase At4g23740 [Musa 
acuminata subsp. malaccensis]
Length=632

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 97/146 (66%), Gaps = 2/146 (1%)
 Frame = +3

Query  279  LKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGPIP  458
            L  D+QAL+DF +A P  R LNWS   ++C  W GVTCS DGSRVV +RLP +GF GPIP
Sbjct  27   LAEDKQALIDFLAAIPLTRGLNWSPSTAVCGRWTGVTCSIDGSRVVAVRLPEIGFGGPIP  86

Query  459  ENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSP--ELDF  632
             NT+ RL AL  LSL SN L+G  P+D  +L +L  ++LQ N+FSG +PS  SP   L  
Sbjct  87   PNTLSRLSALQILSLNSNNLTGPFPADFANLTALTGLHLQLNSFSGPLPSDFSPWKSLTS  146

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLSFN F G IP  +  LT LT LN
Sbjct  147  LDLSFNDFNGEIPASISGLTQLTALN  172



>ref|XP_010249925.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nelumbo 
nucifera]
Length=649

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 103/151 (68%), Gaps = 3/151 (2%)
 Frame = +3

Query  261  QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVG  440
            ++V S+   D+QALLDF S TPH  RL W+  AS C SWVGV C  + S VV LRLPGVG
Sbjct  21   RQVYSEPTQDKQALLDFISRTPHANRLQWNSSASAC-SWVGVECDANQSHVVILRLPGVG  79

Query  441  FSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSP  620
              G I  NT+GRL  L  LSLRSN LSG +P+D   L  L+N+YLQ N FSG+ P++L+ 
Sbjct  80   LMGQISPNTLGRLSQLRVLSLRSNRLSGEIPADFSQLKLLRNLYLQHNLFSGEFPASLTQ  139

Query  621  --ELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
               L  +DLSFN+FTG IP  V NLTHL+GL
Sbjct  140  LTRLVRLDLSFNNFTGKIPFSVNNLTHLSGL  170



>emb|CAN80590.1| hypothetical protein VITISV_040789 [Vitis vinifera]
Length=625

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/146 (65%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = +3

Query  273  SDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFSGP  452
            S ++ ++++L  FA   PH R +NWS   +IC SWVG+ C  DG+RVV LRLPGVG  GP
Sbjct  14   SQMETNKRSL-KFAXVVPHVRTINWSPATAICISWVGIKC--DGNRVVALRLPGVGLYGP  70

Query  453  IPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLSPELDF  632
            IP NT+G+LDAL TLSLRSN L+G+LPSDVLSLPSLQ +YLQ NNFSG+IPS+L P L  
Sbjct  71   IPANTLGKLDALKTLSLRSNHLNGNLPSDVLSLPSLQYMYLQHNNFSGNIPSSLPPLLIL  130

Query  633  IDLSFNSFTGNIPVKVQNLTHLTGLN  710
            +DLSFNS  GNIP  +QNLTHLTGLN
Sbjct  131  LDLSFNSIVGNIPATIQNLTHLTGLN  156



>gb|KDO76442.1| hypothetical protein CISIN_1g006922mg [Citrus sinensis]
Length=625

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            L+F KV ++   D++ALLDF +  PH R LNW+   S+C  W GV CSEDG RVV +RLP
Sbjct  15   LIFSKVNAEPVEDKEALLDFVNNLPHSRSLNWNESTSVCNHWTGVKCSEDGKRVVAVRLP  74

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPS-  608
            GVGFSG IP NTI RL AL  LSLRSN+++G  PSD ++L SL  +YLQ NNFSG +P  
Sbjct  75   GVGFSGLIPPNTISRLSALKILSLRSNVITGYFPSDFINLKSLCYLYLQFNNFSGTLPDF  134

Query  609  TLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            ++   L  I+LS N F G IP  + NLT L  L
Sbjct  135  SVWKNLTIINLSDNGFNGTIPRSLSNLTQLEAL  167



>ref|XP_006439412.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
 gb|ESR52652.1| hypothetical protein CICLE_v10019314mg [Citrus clementina]
Length=625

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +3

Query  252  LLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLP  431
            L+F KV ++   D++ALLDF +  PH R LNW+  AS+C  W GV CSEDG RVV +RLP
Sbjct  15   LIFSKVNAEPVEDKEALLDFVNNLPHSRSLNWNESASVCNHWTGVKCSEDGKRVVAVRLP  74

Query  432  GVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPS-  608
            GVGFSG IP  TI RL AL  LSLRSN+++G  PSD ++L SL  +YLQ NNFSG +P  
Sbjct  75   GVGFSGLIPPKTISRLSALKILSLRSNVITGYFPSDFINLKSLCYLYLQFNNFSGTLPDF  134

Query  609  TLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            ++   L  I+LS N F G IP  + NLT L  L
Sbjct  135  SVWKNLTIINLSNNGFNGTIPRSLSNLTQLEAL  167



>ref|XP_006289209.1| hypothetical protein CARUB_v10002657mg [Capsella rubella]
 gb|EOA22107.1| hypothetical protein CARUB_v10002657mg [Capsella rubella]
Length=635

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 4/148 (3%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVGFS  446
            V +D  +D QALL+FA++ PH  +LNW+   S CTSW+G+TC +D SRVV +RLPGVG  
Sbjct  24   VSADSASDEQALLNFAASVPHPPKLNWNKNLSPCTSWIGITC-DDSSRVVAVRLPGVGLY  82

Query  447  GPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTL---S  617
            G +P  T+G+LDAL  LSLRSN L G+LPSD+LSLPSLQ +YLQ NNFSG++ ++L   S
Sbjct  83   GSVPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLQYLYLQHNNFSGELTNSLPSIS  142

Query  618  PELDFIDLSFNSFTGNIPVKVQNLTHLT  701
             +L  +DLS+NSF+GNIP  ++NL+ +T
Sbjct  143  TQLVVLDLSYNSFSGNIPSGLRNLSQIT  170



>ref|XP_009336254.1| PREDICTED: probable inactive receptor kinase At4g23740 [Pyrus 
x bretschneideri]
Length=654

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 109/160 (68%), Gaps = 2/160 (1%)
 Frame = +3

Query  237  LVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVV  416
            ++L  L+F +  ++   D+QALLDFA+  PH R LNW+  +S+C  W GVTCSED S V+
Sbjct  35   ILLLGLIFLQGNANPVEDKQALLDFANNFPHSRPLNWNQSSSVCDHWTGVTCSEDKSYVI  94

Query  417  ELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSG  596
             +RLPG+GF+G IP NT+ RL  L TLSLRSN++SG  PSD  +L +L  +YLQ NNFSG
Sbjct  95   AVRLPGIGFTGQIPANTLSRLSRLQTLSLRSNVISGEFPSDFSNLKNLSFLYLQFNNFSG  154

Query  597  DIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
             +P   S    L  ++LS N F G+IP  + NLT L+GLN
Sbjct  155  PLPLDFSVWKNLTIVNLSNNHFNGSIPFSLSNLTQLSGLN  194



>ref|XP_004253440.1| PREDICTED: probable inactive receptor kinase At4g23740, partial 
[Solanum lycopersicum]
Length=435

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 107/168 (64%), Gaps = 2/168 (1%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            + T F  + ++    LF    S+   D++ALLDF +   H R LNW  + S C+SW GVT
Sbjct  1    MVTKFLFVSVLFGTALFWLASSEPYEDKEALLDFLNNVNHSRYLNWDERTSACSSWTGVT  60

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C+ + SR++ +RLPGVGF G IP NT+ RL AL  LSLRSN  SGSLP+D   L +L +I
Sbjct  61   CNHEKSRIIAIRLPGVGFRGSIPGNTLSRLSALQILSLRSNSFSGSLPTDFAKLGNLTSI  120

Query  570  YLQRNNFSGDIPSTLSP--ELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            YLQ NNF G +P+  S    L  ++LS N F+G+IP  + NLTHLT L
Sbjct  121  YLQSNNFQGPLPTDFSAWKSLSVLNLSNNDFSGSIPSSISNLTHLTAL  168



>ref|XP_010423497.1| PREDICTED: probable leucine-rich repeat receptor-like protein 
kinase At5g05160 [Camelina sativa]
Length=639

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 113/149 (76%), Gaps = 5/149 (3%)
 Frame = +3

Query  276  DLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDG--SRVVELRLPGVGFSG  449
            DL +D QALL+FA++ PH  +LNW+   S+CTSW+G+TC +    SRVV +RLPGVG  G
Sbjct  27   DLASDEQALLNFAASVPHPPKLNWNKNLSLCTSWIGITCDDTNRTSRVVAVRLPGVGLYG  86

Query  450  PIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTL---SP  620
             +P  T+G+LDAL  LSLRSN L G+LPSD+LSLPSLQ +YLQ NNFSG++ ++L   S 
Sbjct  87   SVPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLQYLYLQHNNFSGELTNSLPSIST  146

Query  621  ELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            +L  +DLS+NSF+GNIP  ++NL+ ++ L
Sbjct  147  QLVVLDLSYNSFSGNIPSGLRNLSQISVL  175



>ref|XP_006343895.1| PREDICTED: probable inactive receptor kinase At4g23740-like [Solanum 
tuberosum]
Length=642

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = +3

Query  261  QKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDGSRVVELRLPGVG  440
            Q  V+ L+ D+QALLDF +  PH   LNW   +S+C +W GV C+EDGSRV+ LRLPGVG
Sbjct  27   QGTVALLENDKQALLDFVNQLPHLHPLNWDANSSVCKNWTGVGCNEDGSRVIALRLPGVG  86

Query  441  FSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPSTLS-  617
            F+GPIP NT+ RL AL  LSLRSN ++G+ P D  +L +L  +YL  NNFSG +P   S 
Sbjct  87   FNGPIPNNTLSRLTALQILSLRSNGINGTFPMDFDNLKNLSYLYLHYNNFSGPLPFDFSV  146

Query  618  -PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
               L  ++LS N F G IP  +  L+HLT LN
Sbjct  147  WQNLTSLNLSNNRFNGTIPSSISGLSHLTALN  178



>ref|XP_008458016.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
melo]
Length=652

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 110/168 (65%), Gaps = 3/168 (2%)
 Frame = +3

Query  210  LYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVT  389
            + T+ S   + L +L+ Q V S+   DRQALLDF S TPH  R+ W++  S+C +WVGV 
Sbjct  1    MATAISLCSVFLLLLMIQWVDSEPTQDRQALLDFFSKTPHANRVQWNLSNSVC-NWVGVE  59

Query  390  CSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNI  569
            C  + S V  LRLPGVG  GPIP NTIG+L  L  LSLRSN LSG +PSD  +L  L+N+
Sbjct  60   CDSNRSFVYSLRLPGVGLVGPIPANTIGKLTQLRVLSLRSNRLSGEIPSDFSNLVMLRNL  119

Query  570  YLQRNNFSGDIPST--LSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            YLQ N FSG+ PS+      L  +DLS N F+G IP  V NLTHL+G+
Sbjct  120  YLQDNAFSGEFPSSLTRLTRLTRLDLSSNEFSGPIPASVDNLTHLSGI  167



>ref|NP_196135.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 sp|Q9FHK7.1|Y5516_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein 
kinase At5g05160; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09692.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|ACN59361.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED90835.1| putative leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=640

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 114/153 (75%), Gaps = 6/153 (4%)
 Frame = +3

Query  267  VVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGVTCSEDG--SRVVELRLPGVG  440
            V +DL +D QALL+FA++ PH  +LNW+   S+C+SW+G+TC E    SRVV +RLPGVG
Sbjct  25   VSADLASDEQALLNFAASVPHPPKLNWNKNLSLCSSWIGITCDESNPTSRVVAVRLPGVG  84

Query  441  FSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQNIYLQRNNFSGDIPS----  608
              G IP  T+G+LDAL  LSLRSN L G+LPSD+LSLPSL+ +YLQ NNFSG++ +    
Sbjct  85   LYGSIPPATLGKLDALKVLSLRSNSLFGTLPSDILSLPSLEYLYLQHNNFSGELTTNSLP  144

Query  609  TLSPELDFIDLSFNSFTGNIPVKVQNLTHLTGL  707
            ++S +L  +DLS+NS +GNIP  ++NL+ +T L
Sbjct  145  SISKQLVVLDLSYNSLSGNIPSGLRNLSQITVL  177



>ref|XP_010925785.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010925786.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=641

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 111/170 (65%), Gaps = 2/170 (1%)
 Frame = +3

Query  207  KLYTSFSTLPLVLCVLLFQKVVSDLKADRQALLDFASATPHGRRLNWSMKASICTSWVGV  386
            KL  S + + LV    +  +  ++   D+Q LLDF +  P  R LNWS   S+C +W GV
Sbjct  5    KLVVSATAILLVCLAAIVSRGAAEPVEDKQTLLDFIARLPPRRVLNWSPFTSVCDTWRGV  64

Query  387  TCSEDGSRVVELRLPGVGFSGPIPENTIGRLDALTTlslrsnllsgslpsdvlslpslQN  566
             CS D +RVV +RLPGVGF+G IP +T+GRL AL  LSLRSN L G +P+D  +L +L  
Sbjct  65   ACSGDRARVVAVRLPGVGFNGRIPPDTLGRLTALQILSLRSNGLFGPIPADFANLTALTG  124

Query  567  IYLQRNNFSGDIPSTLS--PELDFIDLSFNSFTGNIPVKVQNLTHLTGLN  710
            ++LQ N+FSG +PS LS    L  +DLSFN+F G+IP  + NLTHLT LN
Sbjct  125  LHLQLNSFSGPLPSDLSGWKNLTVLDLSFNAFNGSIPTSLSNLTHLTALN  174



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380