BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF033A20

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771911.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    362   1e-120   Nicotiana sylvestris
ref|XP_009758663.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    362   1e-120   Nicotiana sylvestris
ref|XP_002515525.1|  dead box ATP-dependent RNA helicase, putative      356   2e-120   
gb|EPS57760.1|  hypothetical protein M569_17057                         353   2e-120   Genlisea aurea
ref|XP_009606356.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    361   3e-120   Nicotiana tomentosiformis
ref|XP_011070464.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   5e-120   Sesamum indicum [beniseed]
ref|XP_009783372.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   6e-120   Nicotiana sylvestris
ref|XP_011081570.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   1e-119   Sesamum indicum [beniseed]
ref|XP_009624283.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    359   1e-119   Nicotiana tomentosiformis
ref|XP_002285072.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    359   1e-119   Vitis vinifera
gb|KDP33603.1|  hypothetical protein JCGZ_07174                         359   1e-119   Jatropha curcas
ref|XP_006361727.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    359   2e-119   Solanum tuberosum [potatoes]
gb|KJB65812.1|  hypothetical protein B456_010G114300                    352   5e-119   Gossypium raimondii
ref|XP_008806594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   1e-118   Phoenix dactylifera
ref|XP_010924921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   1e-118   Elaeis guineensis
ref|XP_010254382.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   1e-118   Nelumbo nucifera [Indian lotus]
ref|XP_006353691.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   1e-118   Solanum tuberosum [potatoes]
ref|XP_009758660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   2e-118   Nicotiana sylvestris
ref|XP_009595644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   2e-118   Nicotiana tomentosiformis
ref|XP_007011880.1|  DEAD/DEAH box RNA helicase family protein is...    357   2e-118   
ref|XP_007011879.1|  DEAD/DEAH box RNA helicase family protein is...    356   2e-118   Theobroma cacao [chocolate]
ref|XP_004245029.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    356   3e-118   Solanum lycopersicum
ref|XP_006346265.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    356   3e-118   Solanum tuberosum [potatoes]
gb|KDP37097.1|  hypothetical protein JCGZ_06153                         355   5e-118   Jatropha curcas
gb|KJB54996.1|  hypothetical protein B456_009G057600                    353   5e-118   Gossypium raimondii
gb|KJB27350.1|  hypothetical protein B456_004G292500                    355   8e-118   Gossypium raimondii
gb|KCW80390.1|  hypothetical protein EUGRSUZ_C01749                     355   9e-118   Eucalyptus grandis [rose gum]
ref|XP_010048208.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    355   1e-117   Eucalyptus grandis [rose gum]
gb|KHG04363.1|  DEAD-box ATP-dependent RNA helicase 56                  350   1e-117   Gossypium arboreum [tree cotton]
gb|KJB54999.1|  hypothetical protein B456_009G057600                    355   1e-117   Gossypium raimondii
ref|XP_007023165.1|  DEAD/DEAH box RNA helicase family protein is...    350   1e-117   
dbj|BAJ53224.1|  JHL06P13.3                                             355   2e-117   Jatropha curcas
ref|XP_004241774.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    354   2e-117   Solanum lycopersicum
gb|KJB65811.1|  hypothetical protein B456_010G114300                    354   2e-117   Gossypium raimondii
ref|XP_010267037.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    353   2e-117   Nelumbo nucifera [Indian lotus]
gb|KJB82814.1|  hypothetical protein B456_013G215200                    353   6e-117   Gossypium raimondii
ref|XP_009392978.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   7e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412246.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   1e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324856.1|  hypothetical protein POPTR_0018s01620g             352   1e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010250100.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    351   2e-116   
ref|XP_008797870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    351   2e-116   Phoenix dactylifera
ref|XP_002309623.1|  hypothetical protein POPTR_0006s26940g             351   2e-116   Populus trichocarpa [western balsam poplar]
gb|ABK93079.1|  unknown                                                 351   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_004171175.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    350   4e-116   
ref|XP_002268833.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    350   5e-116   Vitis vinifera
ref|XP_010696045.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    350   5e-116   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007023164.1|  DEAD/DEAH box RNA helicase family protein is...    349   6e-116   
ref|XP_007023163.1|  DEAD/DEAH box RNA helicase family protein is...    350   1e-115   Theobroma cacao [chocolate]
gb|KCW81408.1|  hypothetical protein EUGRSUZ_C02784                     348   1e-115   Eucalyptus grandis [rose gum]
gb|KJB70602.1|  hypothetical protein B456_011G082500                    348   4e-115   Gossypium raimondii
ref|XP_010048977.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    347   7e-115   Eucalyptus grandis [rose gum]
ref|XP_007137031.1|  hypothetical protein PHAVU_009G093800g             347   1e-114   Phaseolus vulgaris [French bean]
ref|XP_010912069.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    347   2e-114   Elaeis guineensis
ref|XP_003522620.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    346   2e-114   Glycine max [soybeans]
ref|XP_003526412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    346   2e-114   Glycine max [soybeans]
ref|XP_010519944.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    346   3e-114   Tarenaya hassleriana [spider flower]
gb|KCW81407.1|  hypothetical protein EUGRSUZ_C02784                     350   3e-114   Eucalyptus grandis [rose gum]
ref|XP_011459186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    345   7e-114   Fragaria vesca subsp. vesca
ref|XP_010519138.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    344   8e-114   
ref|XP_007222437.1|  hypothetical protein PRUPE_ppa006122mg             344   2e-113   Prunus persica
gb|KEH35921.1|  DEAD-box ATP-dependent RNA helicase-like protein        340   2e-113   Medicago truncatula
ref|XP_006450447.1|  hypothetical protein CICLE_v10008383mg             340   3e-113   
ref|XP_004303319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    343   4e-113   Fragaria vesca subsp. vesca
ref|XP_008243728.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    343   4e-113   Prunus mume [ume]
ref|XP_003588757.1|  DEAD-box ATP-dependent RNA helicase                343   4e-113   Medicago truncatula
gb|AGV54235.1|  DEAD-box ATP-dependent RNA helicase 56                  343   4e-113   Phaseolus vulgaris [French bean]
ref|XP_011459188.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    344   4e-113   Fragaria vesca subsp. vesca
gb|AFV30230.1|  ATP-dependent RNA helicase                              343   5e-113   Medicago sativa [alfalfa]
ref|XP_009365409.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    343   5e-113   Pyrus x bretschneideri [bai li]
ref|XP_007215422.1|  hypothetical protein PRUPE_ppa006077mg             342   6e-113   Prunus persica
ref|XP_004498731.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    342   7e-113   Cicer arietinum [garbanzo]
ref|XP_006450448.1|  hypothetical protein CICLE_v10008383mg             342   7e-113   Citrus clementina [clementine]
gb|EYU32343.1|  hypothetical protein MIMGU_mgv1a006879mg                342   8e-113   Erythranthe guttata [common monkey flower]
ref|XP_009376926.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    342   9e-113   Pyrus x bretschneideri [bai li]
ref|XP_008394071.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    342   1e-112   Malus domestica [apple tree]
ref|XP_006450446.1|  hypothetical protein CICLE_v10008383mg             341   1e-112   
ref|XP_003603412.1|  DEAD-box ATP-dependent RNA helicase                341   2e-112   Medicago truncatula
ref|XP_009334641.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   2e-112   Pyrus x bretschneideri [bai li]
ref|XP_006853982.1|  hypothetical protein AMTR_s00036p00225190          341   2e-112   Amborella trichopoda
gb|EYU24648.1|  hypothetical protein MIMGU_mgv1a006871mg                340   6e-112   Erythranthe guttata [common monkey flower]
gb|AFK41905.1|  unknown                                                 340   7e-112   Medicago truncatula
ref|XP_004498730.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    342   7e-112   
ref|XP_004501319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    340   1e-111   Cicer arietinum [garbanzo]
ref|XP_006483351.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   2e-111   Citrus sinensis [apfelsine]
ref|XP_004501320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    339   2e-111   
ref|XP_008362046.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    338   2e-111   Malus domestica [apple tree]
ref|XP_004501318.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    339   3e-111   
emb|CAN76234.1|  hypothetical protein VITISV_030204                     335   1e-110   Vitis vinifera
gb|ACU23008.1|  unknown                                                 332   1e-110   Glycine max [soybeans]
emb|CAA09205.1|  RNA helicase                                           337   1e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002517619.1|  dead box ATP-dependent RNA helicase, putative      336   2e-110   Ricinus communis
ref|XP_006585633.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    333   2e-110   
ref|XP_002873498.1|  hypothetical protein ARALYDRAFT_909079             335   4e-110   Arabidopsis lyrata subsp. lyrata
ref|NP_568245.1|  DEAD-box ATP-dependent RNA helicase 56                335   4e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CAB96655.1|  DEAD BOX RNA helicase RH15                             335   4e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CAB96652.1|  DEAD BOX RNA helicase RH15-like protein                335   5e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419672.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    335   6e-110   Camelina sativa [gold-of-pleasure]
ref|XP_006409182.1|  hypothetical protein EUTSA_v10022698mg             334   8e-110   Eutrema salsugineum [saltwater cress]
ref|XP_006399618.1|  hypothetical protein EUTSA_v10013628mg             334   9e-110   Eutrema salsugineum [saltwater cress]
ref|XP_002871462.1|  hypothetical protein ARALYDRAFT_487950             334   9e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_003528338.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    334   1e-109   Glycine max [soybeans]
ref|NP_001154706.1|  DEAD-box ATP-dependent RNA helicase 56             336   1e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54745.1|  DEAD-box ATP-dependent RNA helicase 56-like protein     333   2e-109   Phaseolus vulgaris [French bean]
ref|XP_003531708.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    333   2e-109   Glycine max [soybeans]
ref|XP_006287808.1|  hypothetical protein CARUB_v10001023mg             333   2e-109   Capsella rubella
ref|NP_001154707.1|  DEAD-box ATP-dependent RNA helicase 56             335   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585632.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    333   2e-109   
ref|XP_010453157.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    333   3e-109   Camelina sativa [gold-of-pleasure]
gb|KHN47769.1|  DEAD-box ATP-dependent RNA helicase 56                  333   5e-109   Glycine soja [wild soybean]
ref|XP_010453161.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    332   6e-109   Camelina sativa [gold-of-pleasure]
gb|ADE76139.1|  unknown                                                 332   1e-108   Picea sitchensis
ref|XP_010491834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    332   1e-108   Camelina sativa [gold-of-pleasure]
gb|ACK38186.1|  unknown                                                 326   1e-108   Medicago truncatula
ref|XP_004960988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    330   4e-108   
gb|KEH28678.1|  DEAD-box ATP-dependent RNA helicase-like protein        332   6e-108   Medicago truncatula
gb|KHN01339.1|  DEAD-box ATP-dependent RNA helicase 56                  331   7e-108   Glycine soja [wild soybean]
ref|XP_004960987.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    330   8e-108   
ref|NP_001141599.1|  uncharacterized protein LOC100273717               329   1e-107   
gb|AFW81342.1|  spliceosome RNA helicase BAT1 isoform 1                 329   1e-107   
ref|NP_001149406.1|  spliceosome RNA helicase BAT1                      328   1e-107   
ref|XP_001781775.1|  predicted protein                                  328   2e-107   
ref|XP_010097240.1|  DEAD-box ATP-dependent RNA helicase 56             331   3e-107   
ref|XP_010419674.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    328   3e-107   Camelina sativa [gold-of-pleasure]
ref|XP_007161216.1|  hypothetical protein PHAVU_001G051700g             327   5e-107   Phaseolus vulgaris [French bean]
ref|XP_001770294.1|  predicted protein                                  327   6e-107   
ref|XP_007135742.1|  hypothetical protein PHAVU_010G154700g             327   7e-107   Phaseolus vulgaris [French bean]
ref|XP_004506912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    327   8e-107   
ref|XP_009125794.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    326   2e-106   Brassica rapa
ref|XP_009125790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    324   9e-106   Brassica rapa
ref|XP_002969825.1|  hypothetical protein SELMODRAFT_146823             323   2e-105   Selaginella moellendorffii
ref|XP_009121980.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    322   2e-105   Brassica rapa
ref|XP_009121981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    323   3e-105   Brassica rapa
ref|XP_002985161.1|  hypothetical protein SELMODRAFT_446187             324   4e-105   
emb|CDX85725.1|  BnaA02g00880D                                          322   6e-105   
ref|XP_010231899.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    320   4e-104   Brachypodium distachyon [annual false brome]
ref|XP_009131197.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    320   7e-104   Brassica rapa
emb|CDY51112.1|  BnaCnng20150D                                          319   1e-103   Brassica napus [oilseed rape]
ref|XP_003569187.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    318   2e-103   Brachypodium distachyon [annual false brome]
ref|XP_003569186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    317   4e-103   Brachypodium distachyon [annual false brome]
gb|KDO61715.1|  hypothetical protein CISIN_1g014314mg                   315   2e-102   Citrus sinensis [apfelsine]
emb|CDM83038.1|  unnamed protein product                                312   3e-102   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004968948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    315   4e-102   
ref|NP_001170610.1|  uncharacterized protein LOC100384654               315   5e-102   Zea mays [maize]
gb|AFW82994.1|  hypothetical protein ZEAMMB73_566534                    315   8e-102   
ref|XP_004968947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    314   1e-101   
ref|XP_006644282.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    313   1e-101   Oryza brachyantha
ref|XP_006644281.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    312   4e-101   Oryza brachyantha
emb|CDX85726.1|  BnaA02g00870D                                          313   1e-100   
emb|CDX70383.1|  BnaC03g04670D                                          311   3e-100   
ref|XP_009121982.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    310   3e-100   Brassica rapa
sp|Q0JM17.2|RH56_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    310   3e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009121985.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    310   3e-100   Brassica rapa
ref|NP_001043298.1|  Os01g0550000                                       310   4e-100   
emb|CDX78412.1|  BnaA03g03240D                                          311   1e-99    
ref|NP_001043297.1|  Os01g0549700                                       310   3e-99    
gb|EEE54779.1|  hypothetical protein OsJ_02176                          305   2e-98    Oryza sativa Japonica Group [Japonica rice]
emb|CDX69778.1|  BnaA10g21270D                                          307   2e-98    
emb|CDX69777.1|  BnaA10g21260D                                          307   5e-98    
gb|EMS64048.1|  DEAD-box ATP-dependent RNA helicase 56                  288   4e-91    Triticum urartu
gb|EMS68248.1|  DEAD-box ATP-dependent RNA helicase 56                  292   8e-91    Triticum urartu
gb|EMT33323.1|  DEAD-box ATP-dependent RNA helicase 56                  288   1e-90    
gb|KHG15649.1|  DEAD-box ATP-dependent RNA helicase 56 -like protein    283   7e-90    Gossypium arboreum [tree cotton]
ref|NP_998142.1|  ATP-dependent RNA helicase DDX39                      278   9e-88    Danio rerio [leopard danio]
ref|XP_010744670.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    278   1e-87    
ref|XP_010744669.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    276   1e-87    
pdb|1T6N|A  Chain A, Crystal Structure Of The N-Terminal Domain O...    270   1e-87    Homo sapiens [man]
gb|EDL10915.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isofor...    270   2e-87    Mus musculus [mouse]
ref|XP_006631613.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    275   9e-87    Lepisosteus oculatus
ref|XP_007231785.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    275   1e-86    Astyanax mexicanus [blind cave fish]
ref|XP_001516247.2|  PREDICTED: spliceosome RNA helicase DDX39B         270   1e-86    
ref|NP_001134851.1|  ATP-dependent RNA helicase DDX39                   275   2e-86    Salmo salar
gb|EGV95298.1|  Spliceosome RNA helicase BAT1                           270   2e-86    Cricetulus griseus [Chinese hamsters]
ref|XP_008314982.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       274   3e-86    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003515868.2|  PREDICTED: spliceosome RNA helicase DDX39B-like    267   4e-86    Cricetulus griseus [Chinese hamsters]
gb|EAX03412.1|  hCG2005638, isoform CRA_d                               269   4e-86    Homo sapiens [man]
ref|XP_005470227.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    266   5e-86    
ref|NP_001133080.1|  ATP-dependent RNA helicase DDX39                   273   5e-86    Salmo salar
emb|CDQ90161.1|  unnamed protein product                                273   6e-86    Oncorhynchus mykiss
ref|XP_008853627.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       273   6e-86    Nannospalax galili
dbj|BAE42496.1|  unnamed protein product                                270   6e-86    Mus musculus [mouse]
ref|XP_010744288.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    272   7e-86    
ref|XP_007612851.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    267   7e-86    
ref|XP_005515740.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    265   7e-86    Columba livia [carrier pigeon]
ref|XP_006080887.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    268   8e-86    
gb|ACO09904.1|  ATP-dependent RNA helicase DDX39                        273   8e-86    Osmerus mordax
ref|XP_010101269.1|  DEAD-box ATP-dependent RNA helicase 56             275   9e-86    
ref|XP_003443119.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    273   9e-86    Oreochromis niloticus
ref|XP_006993135.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    273   1e-85    Peromyscus maniculatus bairdii
ref|XP_007647292.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    268   1e-85    Cricetulus griseus [Chinese hamsters]
ref|XP_008303441.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       273   1e-85    Stegastes partitus
ref|XP_001366378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    272   1e-85    Monodelphis domestica
ref|XP_007229864.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    272   1e-85    Astyanax mexicanus [blind cave fish]
ref|XP_004073639.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       272   1e-85    
dbj|BAD92454.1|  HLA-B associated transcript 1 variant                  268   1e-85    Homo sapiens [man]
ref|XP_004715629.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       267   2e-85    Echinops telfairi [lesser hedgehog tenrec]
ref|NP_932099.2|  ATP-dependent RNA helicase DDX39A                     272   2e-85    Mus musculus [mouse]
dbj|BAE23239.1|  unnamed protein product                                272   2e-85    Mus musculus [mouse]
ref|XP_004872546.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    274   2e-85    
gb|ACM09195.1|  ATP-dependent RNA helicase DDX39                        272   2e-85    Salmo salar
gb|ACN58701.1|  ATP-dependent RNA helicase DDX39                        272   2e-85    Salmo salar
ref|XP_004628303.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    272   2e-85    
ref|XP_006161075.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       272   2e-85    Tupaia chinensis
ref|XP_004748289.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    274   2e-85    Mustela putorius furo [black ferret]
ref|XP_010744287.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    272   2e-85    Larimichthys crocea [croceine croaker]
ref|XP_004635679.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       272   2e-85    Octodon degus
dbj|BAE31182.1|  unnamed protein product                                272   2e-85    Mus musculus [mouse]
ref|NP_001133398.1|  Spliceosome RNA helicase BAT1                      272   2e-85    Salmo salar
gb|EGW00654.1|  ATP-dependent RNA helicase DDX39                        271   3e-85    Cricetulus griseus [Chinese hamsters]
dbj|BAE43010.1|  unnamed protein product                                271   3e-85    Mus musculus [mouse]
ref|XP_004711745.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   3e-85    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003501931.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   3e-85    Cricetulus griseus [Chinese hamsters]
ref|XP_003760703.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   3e-85    Sarcophilus harrisii
dbj|BAG16272.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 transc...    266   3e-85    Homo sapiens [man]
ref|XP_010871406.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   3e-85    
ref|XP_006874383.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   3e-85    Chrysochloris asiatica
ref|XP_004277466.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   3e-85    Orcinus orca [Orca]
ref|XP_005381156.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   3e-85    Chinchilla lanigera
ref|XP_004060213.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   4e-85    
ref|XP_002738626.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    271   4e-85    Saccoglossus kowalevskii
ref|XP_010611745.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   4e-85    Fukomys damarensis [Damara mole rat]
ref|NP_957237.1|  HLA-B associated transcript 1                         271   4e-85    Danio rerio [leopard danio]
ref|XP_001178866.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    271   4e-85    
ref|XP_005160298.1|  PREDICTED: DEAD (Asp-Glu-Ala-Asp) box polype...    271   4e-85    
gb|AAL98920.1|  Bat1                                                    271   4e-85    Rattus norvegicus [brown rat]
ref|XP_006904735.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   5e-85    Pteropus alecto
ref|XP_005802856.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   5e-85    Xiphophorus maculatus
gb|EPY85364.1|  v-type proton ATPase subunit G 2 isoform 1              270   5e-85    Camelus ferus
emb|CDQ82873.1|  unnamed protein product                                271   5e-85    Oncorhynchus mykiss
ref|XP_004748290.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   5e-85    Mustela putorius furo [black ferret]
gb|ELK18937.1|  Spliceosome RNA helicase BAT1                           271   5e-85    Pteropus alecto
ref|XP_006178881.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   5e-85    
ref|XP_010599849.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   5e-85    
ref|XP_008992391.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    271   5e-85    Callithrix jacchus [common marmoset]
dbj|BAE39902.1|  unnamed protein product                                271   5e-85    Mus musculus [mouse]
ref|NP_062667.1|  spliceosome RNA helicase Ddx39b                       271   5e-85    Mus musculus [mouse]
emb|CDQ66513.1|  unnamed protein product                                271   5e-85    Oncorhynchus mykiss
ref|XP_006875676.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   5e-85    Chrysochloris asiatica
ref|XP_003985959.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   5e-85    Felis catus [cat]
gb|EFB18180.1|  hypothetical protein PANDA_020423                       271   5e-85    Ailuropoda melanoleuca
ref|NP_004631.1|  spliceosome RNA helicase DDX39B                       271   5e-85    Homo sapiens [man]
ref|XP_006154309.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    271   5e-85    Tupaia chinensis
dbj|BAD96632.1|  HLA-B associated transcript 1 variant                  271   5e-85    Homo sapiens [man]
ref|XP_008328948.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   5e-85    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006738543.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    271   5e-85    Leptonychotes weddellii
ref|XP_004621320.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    271   5e-85    Sorex araneus [Eurasian shrew]
gb|AAA41787.1|  liver nuclear protein p47                               270   5e-85    Rattus norvegicus [brown rat]
ref|XP_004442630.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   5e-85    Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AAP36788.1|  Homo sapiens HLA-B associated transcript 1              271   5e-85    synthetic construct
ref|NP_001014399.1|  spliceosome RNA helicase DDX39B                    271   5e-85    Canis lupus familiaris [dogs]
ref|XP_006896266.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   5e-85    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008054817.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   5e-85    Carlito syrichta
emb|CAA84355.1|  BAT1                                                   271   6e-85    Sus scrofa [pigs]
ref|XP_004624380.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   6e-85    Octodon degus
ref|XP_005995919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   6e-85    Latimeria chalumnae
ref|XP_006821292.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    271   6e-85    Saccoglossus kowalevskii
gb|EHH52904.1|  hypothetical protein EGM_13439                          271   6e-85    Macaca fascicularis [crab eating macaque]
ref|XP_007537232.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   6e-85    
dbj|BAE37719.1|  unnamed protein product                                271   6e-85    Mus musculus [mouse]
ref|XP_007098876.1|  PREDICTED: spliceosome RNA helicase DDX39B         271   6e-85    Panthera tigris altaica
gb|ERE79092.1|  ATP-dependent RNA helicase DDX39A                       271   7e-85    Cricetulus griseus [Chinese hamsters]
ref|XP_008535724.1|  PREDICTED: spliceosome RNA helicase DDX39B         270   7e-85    Equus przewalskii [Przewalski horse]
ref|XP_005339077.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   7e-85    Ictidomys tridecemlineatus
ref|XP_003474035.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   7e-85    Cavia porcellus [guinea pig]
gb|EPQ03753.1|  Spliceosome RNA helicase DDX39B                         271   7e-85    Myotis brandtii
gb|AIC55357.1|  hypothetical protein                                    270   7e-85    synthetic construct
ref|XP_010899336.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   8e-85    Esox lucius
ref|XP_006995295.1|  PREDICTED: spliceosome RNA helicase Ddx39b         270   8e-85    
gb|ACO09679.1|  ATP-dependent RNA helicase DDX39                        270   8e-85    Osmerus mordax
ref|NP_446015.2|  ATP-dependent RNA helicase DDX39A                     270   8e-85    Rattus norvegicus [brown rat]
ref|XP_007489116.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    273   8e-85    
ref|XP_006738542.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   8e-85    Leptonychotes weddellii
ref|XP_004415272.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   8e-85    Odobenus rosmarus divergens
ref|XP_002921018.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       270   9e-85    
ref|XP_004999904.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   9e-85    Cavia porcellus [guinea pig]
gb|EFB28644.1|  hypothetical protein PANDA_009904                       270   9e-85    Ailuropoda melanoleuca
ref|XP_005086851.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   9e-85    Mesocricetus auratus [Syrian golden hamster]
ref|XP_006052355.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    270   9e-85    
ref|XP_005370902.1|  PREDICTED: spliceosome RNA helicase DDX39B         270   9e-85    Microtus ochrogaster [prairie voles]
ref|XP_005696667.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   1e-84    
ref|XP_005696668.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   1e-84    
ref|XP_010611744.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   1e-84    
ref|XP_010611743.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   1e-84    
ref|XP_007576497.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       270   1e-84    
ref|NP_001079623.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A         270   1e-84    
gb|ABU86917.1|  Bat1                                                    271   1e-84    
ref|NP_001080733.1|  nuclear RNA helicase                               270   1e-84    
ref|XP_003218034.1|  PREDICTED: spliceosome RNA helicase DDX39B         270   1e-84    
gb|AAC16391.1|  nuclear RNA helicase                                    270   1e-84    
ref|NP_001028801.1|  spliceosome RNA helicase DDX39B                    270   1e-84    
ref|XP_004389822.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       270   1e-84    
ref|XP_009239916.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   1e-84    
ref|XP_006036655.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    270   1e-84    
ref|XP_007182118.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   1e-84    
ref|NP_001016000.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A         270   2e-84    
ref|XP_008709919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       271   2e-84    
ref|XP_005627100.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   2e-84    
ref|XP_008508629.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   2e-84    
ref|XP_533895.2|  PREDICTED: ATP-dependent RNA helicase DDX39A is...    270   2e-84    
gb|AAH71505.1|  Ddx39a protein                                          270   2e-84    
gb|ELT91951.1|  hypothetical protein CAPTEDRAFT_165082                  270   2e-84    
ref|XP_007952615.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       269   2e-84    
ref|XP_008955196.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   2e-84    
ref|XP_005632846.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   2e-84    
ref|XP_006918833.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       269   2e-84    
ref|XP_006173093.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       269   2e-84    
ref|XP_004688293.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       269   2e-84    
ref|XP_009239915.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   2e-84    
ref|XP_003461865.2|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   2e-84    
ref|XP_005661287.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    269   2e-84    
ref|XP_005661286.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    269   2e-84    
gb|AAH32128.1|  DDX39 protein                                           266   3e-84    
ref|XP_010976510.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    270   3e-84    
ref|XP_008260767.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    269   3e-84    
ref|XP_006100393.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    269   3e-84    
ref|NP_989072.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B            269   3e-84    
ref|XP_004748288.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    271   3e-84    
ref|NP_001087845.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B         269   3e-84    
gb|EHH18152.1|  hypothetical protein EGK_14701                          269   3e-84    
ref|XP_006100392.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    269   3e-84    
ref|XP_005665849.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   3e-84    
ref|XP_004673033.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       269   3e-84    
ref|NP_001029924.1|  ATP-dependent RNA helicase DDX39A                  269   3e-84    
ref|XP_005953207.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    264   4e-84    
ref|XP_006779616.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    269   4e-84    
ref|XP_004008522.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       269   4e-84    
ref|XP_002127634.2|  PREDICTED: spliceosome RNA helicase DDX39B         268   4e-84    
ref|XP_010330591.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    270   4e-84    
ref|XP_007569619.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   5e-84    
ref|XP_005463663.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    267   5e-84    
ref|XP_003413378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       268   5e-84    
ref|XP_003123418.3|  PREDICTED: ATP-dependent RNA helicase DDX39A...    270   5e-84    
ref|XP_003941746.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   5e-84    
ref|NP_005795.2|  ATP-dependent RNA helicase DDX39A                     268   6e-84    
ref|XP_004539320.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   6e-84    
sp|Q5ZHZ0.1|DX39B_CHICK  RecName: Full=Spliceosome RNA helicase D...    268   6e-84    
gb|EAW84415.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isofor...    265   6e-84    
ref|XP_003972140.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   6e-84    
ref|XP_008289807.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       268   6e-84    
ref|XP_011399824.1|  DEAD-box ATP-dependent RNA helicase 56             268   6e-84    
ref|XP_009449127.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    268   6e-84    
ref|XP_007069230.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       268   6e-84    
gb|EHH29721.1|  ATP-dependent RNA helicase DDX39                        270   7e-84    
ref|XP_005865907.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   7e-84    
ref|XP_010350775.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    269   8e-84    
ref|XP_010350778.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    269   8e-84    
gb|ELK26087.1|  ATP-dependent RNA helicase DDX39A                       268   8e-84    
ref|XP_004065549.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       268   8e-84    
ref|XP_005888083.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       268   8e-84    
ref|XP_004595622.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   9e-84    
ref|XP_004905482.1|  PREDICTED: spliceosome RNA helicase Ddx39b i...    270   1e-83    
ref|XP_008564250.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       268   1e-83    
ref|XP_009449126.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    268   1e-83    
ref|XP_003787565.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    267   1e-83    
ref|XP_004616874.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       267   1e-83    
ref|XP_007253188.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   1e-83    
ref|XP_003217350.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   1e-83    
ref|XP_007436162.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       267   1e-83    
gb|ETM48634.1|  ATP-dependent RNA helicase uap56                        267   1e-83    
ref|XP_005086850.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    269   1e-83    
ref|XP_008903594.1|  ATP-dependent RNA helicase uap56                   267   2e-83    
ref|XP_004286664.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   2e-83    
ref|XP_010871251.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       267   2e-83    
ref|XP_007459648.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    270   2e-83    
ref|XP_008985661.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    267   2e-83    
ref|XP_005463661.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    267   2e-83    
ref|XP_009449125.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    268   2e-83    
ref|XP_008171663.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       266   2e-83    
ref|XP_010853738.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   2e-83    
ref|XP_004781072.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    269   2e-83    
gb|ELK06762.1|  ATP-dependent RNA helicase DDX39                        268   2e-83    
ref|XP_007129491.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    266   2e-83    
ref|XP_009827129.1|  DEAD-box ATP-dependent RNA helicase 15             266   2e-83    
emb|CCA18117.1|  predicted protein putative                             266   2e-83    
ref|XP_006066605.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   3e-83    
ref|XP_008412609.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       266   3e-83    
ref|XP_005208677.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   3e-83    
ref|XP_010738714.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    266   3e-83    
ref|XP_005797553.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    266   3e-83    
ref|XP_001635457.1|  predicted protein                                  266   3e-83    
ref|XP_010853737.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   3e-83    
ref|XP_005865906.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    268   3e-83    
gb|ADB44901.1|  DEAD(Asp-Glu-Ala-Asp) box polypeptide 39                266   4e-83    
dbj|BAG63290.1|  unnamed protein product                                267   4e-83    
ref|XP_006066604.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   4e-83    
ref|XP_004671945.1|  PREDICTED: spliceosome RNA helicase DDX39B         266   4e-83    
gb|AAM18861.1|AF391287_2  unknown                                       266   4e-83    
gb|EHH59286.1|  ATP-dependent RNA helicase DDX39                        267   4e-83    
ref|XP_004573690.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    266   5e-83    
ref|XP_002164853.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    266   5e-83    
ref|XP_005389371.1|  PREDICTED: spliceosome RNA helicase DDX39B         269   5e-83    
ref|XP_006106715.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    265   6e-83    
gb|EMP26984.1|  ATP-dependent RNA helicase DDX39A                       269   6e-83    
ref|XP_007907581.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       265   6e-83    
ref|XP_004467949.1|  PREDICTED: spliceosome RNA helicase DDX39B         268   7e-83    
gb|KFM82349.1|  Spliceosome RNA helicase DDX39B                         265   8e-83    
ref|XP_006086100.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    265   9e-83    
ref|XP_005661285.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    267   9e-83    
ref|XP_008065870.1|  PREDICTED: spliceosome RNA helicase DDX39B         268   1e-82    
ref|XP_008868859.1|  DEAD-box ATP-dependent RNA helicase 56             265   1e-82    
gb|AAB50231.1|  nuclear RNA helicase                                    265   1e-82    
ref|XP_007532506.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       265   1e-82    
ref|XP_010853736.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    266   1e-82    
gb|EIE79315.1|  ATP-dependent RNA helicase uap56                        265   1e-82    
ref|XP_002109407.1|  conserved hypothetical protein                     264   2e-82    
dbj|BAB15509.1|  unnamed protein product                                265   2e-82    
ref|XP_006066602.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    266   2e-82    
ref|XP_006096516.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    264   2e-82    
ref|XP_006085397.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    264   3e-82    
ref|XP_002505759.1|  predicted protein                                  263   3e-82    
ref|XP_002296387.1|  dead box family RNA helicase                       263   6e-82    
gb|KFO21034.1|  Spliceosome RNA helicase DDX39B                         271   6e-82    
ref|XP_005643776.1|  nuclear RNA helicase-like protein Bat1             263   8e-82    
gb|EIE84435.1|  ATP-dependent RNA helicase uap56                        263   9e-82    
ref|XP_003747488.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    262   9e-82    
ref|XP_002185552.1|  predicted protein                                  262   1e-81    
ref|XP_008613771.1|  DEAD-box ATP-dependent RNA helicase 15             262   1e-81    
pdb|1XTJ|A  Chain A, Structure Of Human Uap56 In Complex With Adp       261   1e-81    
pdb|1XTK|A  Chain A, Structure Of Decd To Dead Mutation Of Human ...    261   1e-81    
pdb|1XTI|A  Chain A, Structure Of Wildtype Human Uap56                  261   1e-81    
gb|EHB16049.1|  Spliceosome RNA helicase Bat1                           262   2e-81    
ref|XP_974045.1|  PREDICTED: ATP-dependent RNA helicase WM6             261   2e-81    
ref|XP_007129489.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    265   2e-81    
ref|XP_006108869.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    261   3e-81    
emb|CEI95093.1|  Putative ATP dependent RNA helicase                    261   3e-81    
emb|CEI88988.1|  Putative ATP-dependent RNA helicase                    261   3e-81    
gb|ACO11252.1|  ATP-dependent RNA helicase DDX39                        261   3e-81    
emb|CEG73344.1|  Putative ATP dependent RNA helicase                    261   3e-81    
gb|ACO10850.1|  ATP-dependent RNA helicase DDX39                        261   4e-81    
ref|XP_009048437.1|  hypothetical protein LOTGIDRAFT_225638             261   4e-81    
ref|XP_011414939.1|  PREDICTED: spliceosome RNA helicase DDX39B         261   5e-81    
ref|XP_006132079.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    261   5e-81    
ref|XP_007534285.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    260   6e-81    
ref|XP_003972172.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    260   7e-81    
gb|EJK56348.1|  hypothetical protein THAOC_23784                        259   7e-81    
ref|XP_003063800.1|  predicted protein                                  260   8e-81    
gb|ELR50186.1|  Spliceosome RNA helicase BAT1                           260   8e-81    
gb|AGM32791.1|  DEAD box ATP-dependent RNA helicase-like protein        254   9e-81    
ref|XP_003148938.1|  hypothetical protein LOAG_13381                    255   9e-81    
ref|XP_001515366.2|  PREDICTED: ATP-dependent RNA helicase DDX39A       260   9e-81    
gb|EPB87931.1|  ATP-dependent RNA helicase uap56                        260   1e-80    
ref|XP_006902690.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    259   1e-80    
dbj|BAF31287.1|  BAT1 protein                                           260   1e-80    
ref|XP_006886475.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    259   1e-80    
emb|CEI95092.1|  Putative ATP-dependent RNA helicase SUB2               261   1e-80    
emb|CEG73343.1|  Putative ATP-dependent RNA helicase SUB2               261   1e-80    
ref|XP_003791455.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    260   1e-80    
emb|CBY38854.1|  unnamed protein product                                259   1e-80    
emb|CEP12723.1|  hypothetical protein                                   259   1e-80    
gb|EIE91029.1|  ATP-dependent RNA helicase uap56                        259   2e-80    
ref|XP_006107502.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    259   2e-80    
dbj|GAN02806.1|  ATP-dependent RNA helicase Uap56                       259   2e-80    
ref|XP_001942765.1|  PREDICTED: ATP-dependent RNA helicase WM6          259   2e-80    
gb|EYC23928.1|  hypothetical protein Y032_0014g2222                     253   3e-80    
gb|EYC23929.1|  hypothetical protein Y032_0014g2222                     255   3e-80    
gb|EKC20273.1|  Spliceosome RNA helicase BAT1                           260   3e-80    
ref|XP_006107135.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    258   3e-80    
emb|CDQ80585.1|  unnamed protein product                                272   4e-80    
emb|CDQ82872.1|  unnamed protein product                                251   5e-80    
ref|XP_004872545.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    259   8e-80    
gb|KIH42433.1|  DEAD/DEAH box helicase                                  250   9e-80    
gb|EFX64849.1|  hypothetical protein DAPPUDRAFT_219465                  257   1e-79    
ref|XP_004872547.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    258   1e-79    
ref|XP_005845689.1|  hypothetical protein CHLNCDRAFT_136793             259   1e-79    
ref|XP_004872544.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    259   1e-79    
gb|KFH69832.1|  ATP-dependent RNA helicase SUB2                         257   1e-79    
ref|XP_001606676.1|  PREDICTED: ATP-dependent RNA helicase WM6-like     257   1e-79    
emb|CDJ83122.1|  DNA RNA helicase domain containing protein             257   2e-79    
ref|XP_002906628.1|  DEAD/DEAH box RNA helicase, putative               257   2e-79    
ref|XP_004872541.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    259   2e-79    
gb|ADD24298.1|  Spliceosome RNA helicase BAT1                           256   2e-79    
gb|AEE63533.1|  unknown                                                 256   2e-79    
emb|CDP13502.1|  unnamed protein product                                254   2e-79    
gb|EMS20830.1|  ATP-dependent rna helicase sub2                         256   2e-79    
gb|KDD77120.1|  DEAD/DEAH box helicase                                  256   3e-79    
ref|XP_009020730.1|  hypothetical protein HELRODRAFT_112849             256   3e-79    
ref|XP_004902967.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       257   4e-79    
gb|KDR23694.1|  ATP-dependent RNA helicase WM6                          256   4e-79    
ref|NP_001021986.1|  Protein HEL-1, isoform b                           250   4e-79    
gb|EJW87829.1|  spliceosome RNA helicase BAT1                           255   4e-79    
emb|CDQ03226.1|  Protein BM-HEL-1, isoform a                            255   4e-79    
gb|EJD74236.1|  spliceosome RNA helicase BAT1                           255   5e-79    
gb|EIF49828.1|  atp-dependent rna helicase sub2                         255   7e-79    
gb|ETN83397.1|  spliceosome RNA helicase BAT1                           255   8e-79    
ref|XP_008545539.1|  PREDICTED: ATP-dependent RNA helicase WM6          254   9e-79    
ref|XP_006613137.1|  PREDICTED: ATP-dependent RNA helicase WM6-like     254   1e-78    
ref|XP_011502327.1|  PREDICTED: ATP-dependent RNA helicase WM6          254   1e-78    
emb|CDS11016.1|  Putative ATP-dependent RNA helicase uap56              255   1e-78    
ref|XP_003704829.1|  PREDICTED: ATP-dependent RNA helicase WM6-like     255   1e-78    
ref|XP_011303769.1|  PREDICTED: ATP-dependent RNA helicase WM6          254   2e-78    
emb|CDH51210.1|  atp-dependent rna helicase uap56                       254   2e-78    
ref|XP_011149846.1|  PREDICTED: ATP-dependent RNA helicase WM6          254   2e-78    
gb|KHN85147.1|  Spliceosome RNA helicase DDX39B -like protein           254   2e-78    
ref|XP_624894.1|  PREDICTED: ATP-dependent RNA helicase WM6-like ...    254   2e-78    
ref|XP_002175680.1|  ATP-dependent RNA helicase Uap56                   254   3e-78    
emb|CEG02049.1|  Helicase, C-terminal                                   255   3e-78    
ref|XP_011349350.1|  PREDICTED: ATP-dependent RNA helicase WM6          253   4e-78    
gb|EKD02297.1|  ATP dependent RNA helicase                              252   4e-78    
emb|CDH58367.1|  atp-dependent rna helicase uap56                       253   4e-78    
emb|CDS12473.1|  Putative ATP-dependent RNA helicase uap56              253   5e-78    
gb|ELR62017.1|  ATP-dependent RNA helicase DDX39                        253   5e-78    



>ref|XP_009771911.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
 ref|XP_009771912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
Length=428

 Score =   362 bits (930),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 194/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGENKENDAYEEELLDYEE+DEKAPDSV  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+L+
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRVLS  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHF+LDE
Sbjct  181  LARDKDLSLRNVRHFVLDE  199



>ref|XP_009758663.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Nicotiana sylvestris]
Length=428

 Score =   362 bits (929),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KENDAYEEELLDYEE+DEKAPDS++AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENDAYEEELLDYEEDDEKAPDSISAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAMV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRMLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_002515525.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF46974.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=275

 Score =   356 bits (913),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSVAAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVAAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGV+I IHKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVHIKIHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>gb|EPS57760.1| hypothetical protein M569_17057, partial [Genlisea aurea]
Length=206

 Score =   353 bits (906),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KEN+AYEEELLDYEEE+EK PDS AAK NGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEEEEKVPDSAAAKTNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  181  LTREKDLSLRNVRHFILDE  199



>ref|XP_009606356.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009606362.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
Length=428

 Score =   361 bits (927),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 196/199 (98%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG++KENDAYEEELLDYEE+DEKAPDS++AKV+GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDSKENDAYEEELLDYEEDDEKAPDSISAKVSGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAMV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_011070464.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Sesamum indicum]
Length=428

 Score =   360 bits (925),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KENDAYEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENDAYEEELLDYEEEDEKAPDSVNAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I IHKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVSIKIHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_009783372.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
 ref|XP_009783373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
Length=428

 Score =   360 bits (925),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGENKENDAYEEELLDYEE+DEK PDSV  KVNG+SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKLPDSVTGKVNGDSAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_011081570.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Sesamum indicum]
Length=428

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETKDNDAYEEELLDYEEEDEKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTY+P+IKVAVFYGGVNI IHKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYIPEIKVAVFYGGVNIKIHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_009624283.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGENKENDAYEEELLDYEE+DEKAPD V  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKAPDLVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+L+
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRVLS  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHF+LDE
Sbjct  181  LARDKDLSLRNVRHFVLDE  199



>ref|XP_002285072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
Length=428

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE++KAPDSV  KVNGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEDKAPDSVTGKVNGEAAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVTGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L+L NVRHFILDE
Sbjct  181  LARDKDLALKNVRHFILDE  199



>gb|KDP33603.1| hypothetical protein JCGZ_07174 [Jatropha curcas]
Length=428

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSVAAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVAAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTTGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  181  LAREKDLSLKNVRHFILDE  199



>ref|XP_006361727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=427

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/199 (94%), Positives = 193/199 (97%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGENKENDAYEEELLDYEE+DEK PDS A KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKIPDS-ATKVNGESAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLRNVRHFILDE  198



>gb|KJB65812.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=273

 Score =   352 bits (904),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPTPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_008806594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
 ref|XP_008806602.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
Length=428

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +ENDAYEEELLDYEE++EKAPDSVAAK N ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKAPDSVAAKANNESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIAKHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_010924921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
 ref|XP_010924922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
Length=428

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +ENDAYEEELLDYEE++EKAPDSVAAK N ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKAPDSVAAKANNESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIAKHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_010254382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nelumbo nucifera]
Length=428

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +ENDAYEEELLDYEEE+EKAPDSVAAK  GE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVRENDAYEEELLDYEEEEEKAPDSVAAKGTGEAAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L+L NVRHFILDE
Sbjct  181  LARDKDLALKNVRHFILDE  199



>ref|XP_006353691.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Solanum 
tuberosum]
Length=428

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KEN+AYEEELLDYEE+DEKAPDSV  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVPGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPH+VVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHVVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  181  LAREKDLSLKNVRHFILDE  199



>ref|XP_009758660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009758661.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Nicotiana sylvestris]
Length=534

 Score =   360 bits (925),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 195/199 (98%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KENDAYEEELLDYEE+DEKAPDS++AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENDAYEEELLDYEEDDEKAPDSISAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAMV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRMLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_009595644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
 ref|XP_009595645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGENKENDAYEEELLDYEE+DEK  DS + KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKLHDSFSGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>ref|XP_007011880.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY29499.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
Length=429

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_007011879.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29498.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_004245029.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
 ref|XP_010324987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
Length=427

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 185/199 (93%), Positives = 192/199 (96%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGENKENDAYEEELLDYEE+DEK PDS   KVNGES+KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGENKENDAYEEELLDYEEDDEKIPDS-TTKVNGESSKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLRNVRHFILDE  198



>ref|XP_006346265.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346266.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=428

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M + KENDAYEEELLDYEE+DEKAPDS++ K+NGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDTKENDAYEEELLDYEEDDEKAPDSISGKINGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQIEPVAGQVAA+V
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIEPVAGQVAAIV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLRNVRHFILDE  199



>gb|KDP37097.1| hypothetical protein JCGZ_06153 [Jatropha curcas]
Length=428

 Score =   355 bits (912),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVKDNDAYEEELLDYEEEDEKAPDSVSAKAGAESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKDLGLKNVRHFILDE  199



>gb|KJB54996.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=382

 Score =   353 bits (907),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEGGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LTRDKDLSLKNVRHFILDE  199



>gb|KJB27350.1| hypothetical protein B456_004G292500 [Gossypium raimondii]
Length=428

 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGDAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVVALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPH+VVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHVVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LTRDKDLSLKNVRHFILDE  199



>gb|KCW80390.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=430

 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++NDAYEEELLDYEEE++KAPDSV AK NGE+AK+GY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNDAYEEELLDYEEEEDKAPDSVNAKANGEAAKRGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLPDIKVAVFYGGVNI IHK+LLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSVYLPDIKVAVFYGGVNIKIHKELLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_010048208.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 ref|XP_010048209.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 gb|KCW80388.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
 gb|KCW80389.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=427

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++NDAYEEELLDYEEE++KAPDSV AK NGE+AK+GY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNDAYEEELLDYEEEEDKAPDSVNAKANGEAAKRGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLPDIKVAVFYGGVNI IHK+LLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSVYLPDIKVAVFYGGVNIKIHKELLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>gb|KHG04363.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum]
Length=290

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EK PDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKVPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPTPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>gb|KJB54999.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=428

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEGGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LTRDKDLSLKNVRHFILDE  199



>ref|XP_007023165.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY25787.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
Length=290

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSVSAKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKV+VFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVSVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>dbj|BAJ53224.1| JHL06P13.3 [Jatropha curcas]
Length=455

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/199 (92%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   ESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVKDNDAYEEELLDYEEEDEKAPDSVSAKAGAESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKDLGLKNVRHFILDE  199



>ref|XP_004241774.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Solanum lycopersicum]
Length=428

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KEN+AYEEELLDYEE+DEKAPDSV  KVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEDDEKAPDSVNGKVNGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVPGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKLHKELLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKDLPLKNVRHFILDE  199



>gb|KJB65811.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=428

 Score =   354 bits (908),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPTPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_010267037.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +EN+AYEEELLDYEEE+EKAPDS+ AK  GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRENEAYEEELLDYEEEEEKAPDSIGAKGTGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI IHK++LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKIHKEMLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L+L NVRHFILDE
Sbjct  181  LARDKDLALKNVRHFILDE  199



>gb|KJB82814.1| hypothetical protein B456_013G215200 [Gossypium raimondii]
Length=428

 Score =   353 bits (905),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEE+LLDY+EE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDVYEEDLLDYDEEEEKAPDSVTAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LTRDKDLSLKNVRHFILDE  199



>ref|XP_009392978.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   352 bits (904),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDY+E++EKAPDS AAK +GES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYDEDEEKAPDSAAAKASGESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI+DSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIIDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHILKHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_009412246.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDS AAK +GE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYEEEEEKAPDSAAAKASGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIMKHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_002324856.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
 gb|EEF03421.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
Length=428

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEED+KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEDDKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVN+  HKDLLKNECPH+VVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNVKTHKDLLKNECPHVVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_010250100.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
 ref|XP_010250101.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKA DSVAAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKALDSVAAKGAGEVAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L+L NVRHFILDE
Sbjct  181  LARDKDLALKNVRHFILDE  199



>ref|XP_008797870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008797871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
Length=428

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +ENDAYEEELLDYEE++EKAPD+VAAK + E+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKAPDAVAAKASNETAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV+GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVSGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV++  HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHVAKHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_002309623.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
 ref|XP_011039701.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Populus euphratica]
 gb|EEE93146.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
Length=428

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDTYEEELLDYEEEDEKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>gb|ABK93079.1| unknown [Populus trichocarpa]
Length=428

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEEELLDYEEEDEKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDTYEEELLDYEEEDEKAPDSVGAKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP +GQV ALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTSGQVIALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDTKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_004171175.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Cucumis 
sativus]
 ref|XP_008445205.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 ref|XP_008445206.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 gb|KGN62946.1| hypothetical protein Csa_2G381720 [Cucumis sativus]
Length=427

 Score =   350 bits (899),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 191/199 (96%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++N  YEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEEELLDYEEEEEKAPDSVGAKVNGEAGKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI IHKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKIHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            LSR+K LSL NVRHFILDE
Sbjct  180  LSRDKDLSLKNVRHFILDE  198



>ref|XP_002268833.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
 emb|CBI36308.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEEDEKAPDSVA+K  GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYEEEDEKAPDSVASKAAGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVSIKTHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L +VRHFILDE
Sbjct  181  LARDKDLGLKHVRHFILDE  199



>ref|XP_010696045.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=428

 Score =   350 bits (898),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +ENDAYEEELLDY+EE+EK PDS   K NGE+ KKGY+GI+SSGFRDFLLKPELLR
Sbjct  1    MGETRENDAYEEELLDYDEEEEKVPDSAVTKTNGEAGKKGYVGIYSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLP +KVAVFYGGVNI IHKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPGVKVAVFYGGVNIKIHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_007023164.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25786.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=406

 Score =   349 bits (896),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSVSAKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKV+VFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVSVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_007023163.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25785.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
Length=427

 Score =   350 bits (897),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 192/199 (96%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDSV+AK   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSVSAKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKV+VFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVSVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>gb|KCW81408.1| hypothetical protein EUGRSUZ_C02784 [Eucalyptus grandis]
Length=383

 Score =   348 bits (892),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  100  KQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPE  279
            +Q MGE ++NDAYEEELLDYEEE++KA DS +AKVNGE+ KKGY+GIHSSGFRDFLLKPE
Sbjct  114  RQAMGETRDNDAYEEELLDYEEEEDKAMDSASAKVNGEATKKGYVGIHSSGFRDFLLKPE  173

Query  280  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVA  459
            LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE VAGQVA
Sbjct  174  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIETVAGQVA  233

Query  460  ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGR  639
            ALVLCHTRELAYQICHEFERFS YLP+IK+AVFYGGVN+ IHK+LLKNECPHIVVGTPGR
Sbjct  234  ALVLCHTRELAYQICHEFERFSKYLPEIKIAVFYGGVNVRIHKELLKNECPHIVVGTPGR  293

Query  640  ILALSREKHLSLMNVRHFILDE  705
            ILAL+R+K LSL NVRHFILDE
Sbjct  294  ILALARDKDLSLKNVRHFILDE  315



>gb|KJB70602.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=427

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+NDAYEEELLDYEEEDEKAPDS + K   +SAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIKDNDAYEEELLDYEEEDEKAPDSASTKA-ADSAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   SIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LTRDKDLSLKNVRHFILDE  198



>ref|XP_010048977.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Eucalyptus 
grandis]
Length=427

 Score =   347 bits (891),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE++KA DS +AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDNDAYEEELLDYEEEEDKAMDSASAKVNGEATKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE VAGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIETVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLP+IK+AVFYGGVN+ IHK+LLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSKYLPEIKIAVFYGGVNVRIHKELLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_007137031.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
 gb|ESW09025.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
Length=427

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            PD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K LSL NVRHFILDE
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILALTRDKDLSLKNVRHFILDE  198



>ref|XP_010912069.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
 ref|XP_010912075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
Length=428

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +ENDAYEEELLDYEE++EKA D+VAAK   E+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARENDAYEEELLDYEEDEEKASDAVAAKGANETAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV+GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVSGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKD+LKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVHIAKHKDILKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_003522620.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
 gb|KHN08125.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K ++AYEEELLDYEEED+KAPDS  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETK-DEAYEEELLDYEEEDDKAPDSAGAKVNGEATKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LTRDKDLSLKNVRHFILDE  198



>ref|XP_003526412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX1 [Glycine 
max]
 ref|XP_003526413.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX2 [Glycine 
max]
 ref|XP_006581360.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 
[Glycine max]
 gb|KHN07085.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/199 (90%), Positives = 190/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K ++AYEEELLDYEEEDEKAPDS  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETK-DEAYEEELLDYEEEDEKAPDSAGAKVNGEATKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LTRDKDLSLKNVRHFILDE  198



>ref|XP_010519944.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Tarenaya hassleriana]
Length=428

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M + ++N+AYEEELLDYEEED+K PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MADTRDNEAYEEELLDYEEEDDKVPDSAGNKVNGENGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVN+ IHKDLLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNVKIHKDLLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>gb|KCW81407.1| hypothetical protein EUGRSUZ_C02784 [Eucalyptus grandis]
Length=543

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = +1

Query  100  KQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPE  279
            +Q MGE ++NDAYEEELLDYEEE++KA DS +AKVNGE+ KKGY+GIHSSGFRDFLLKPE
Sbjct  114  RQAMGETRDNDAYEEELLDYEEEEDKAMDSASAKVNGEATKKGYVGIHSSGFRDFLLKPE  173

Query  280  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVA  459
            LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE VAGQVA
Sbjct  174  LLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIETVAGQVA  233

Query  460  ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGR  639
            ALVLCHTRELAYQICHEFERFS YLP+IK+AVFYGGVN+ IHK+LLKNECPHIVVGTPGR
Sbjct  234  ALVLCHTRELAYQICHEFERFSKYLPEIKIAVFYGGVNVRIHKELLKNECPHIVVGTPGR  293

Query  640  ILALSREKHLSLMNVRHFILDE  705
            ILAL+R+K LSL NVRHFILDE
Sbjct  294  ILALARDKDLSLKNVRHFILDE  315



>ref|XP_011459186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011459187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
Length=426

 Score =   345 bits (884),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 190/199 (95%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +E D Y+EEL+DYEE+DEKAPDS AAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRE-DVYDEELVDYEEDDEKAPDS-AAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+AL+
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALI  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV I  HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVTIKNHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  179  LARDKDLSLKNVRHFILDE  197



>ref|XP_010519138.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Tarenaya 
hassleriana]
Length=415

 Score =   344 bits (883),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   K NGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTRDNEAYEEELLDYEEEDEKVPDSAGNKTNGENGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD KVAVFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDSKVAVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_007222437.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222438.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222439.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_008219486.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Prunus mume]
 gb|EMJ23636.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23637.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23638.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
Length=426

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 191/199 (96%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE + +D YEEEL+DYEEE+EKAPDS AAKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETR-DDVYEEELVDYEEEEEKAPDS-AAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKLHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  179  LARDKDLSLKNVRHFILDE  197



>gb|KEH35921.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=314

 Score =   340 bits (871),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPD+  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDTNGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            PD+KVAVFYGGVNI +HKDLLKNECP IVVGTPGRILAL+REK+LSL NVRHF+LDE
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPQIVVGTPGRILALAREKNLSLKNVRHFVLDE  198



>ref|XP_006450447.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63687.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
Length=343

 Score =   340 bits (872),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP  GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_004303319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEEEL+DY+EE++ AP+SV+ K NGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIRDNDGYEEELVDYDEEEQNAPNSVSGKPNGESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIEPVAGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLP++KVAVFYGGV+I +H+DLLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPELKVAVFYGGVSIKVHRDLLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKELGLKNVRHFILDE  199



>ref|XP_008243728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Prunus 
mume]
Length=428

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKELGLKNVRHFILDE  199



>ref|XP_003588757.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES59008.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPDSV AKVNGES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGESGKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+AL+LCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALILCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K LSL NVRHFILDE
Sbjct  142  ADLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILALARDKDLSLKNVRHFILDE  198



>gb|AGV54235.1| DEAD-box ATP-dependent RNA helicase 56 [Phaseolus vulgaris]
Length=427

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            PD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K LSL NVR FILDE
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILALTRDKDLSLKNVRTFILDE  198



>ref|XP_011459188.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Fragaria vesca subsp. vesca]
Length=462

 Score =   344 bits (882),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/199 (90%), Positives = 190/199 (95%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +E D Y+EEL+DYEE+DEKAPDS AAKVNGESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRE-DVYDEELVDYEEDDEKAPDS-AAKVNGESAKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+AL+
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALI  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV I  HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVTIKNHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  179  LARDKDLSLKNVRHFILDE  197



>gb|AFV30230.1| ATP-dependent RNA helicase [Medicago sativa]
Length=427

 Score =   343 bits (879),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPDSV AKVNGES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGESGKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+AL+LCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALILCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K LSL NVRHFILDE
Sbjct  142  ADLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILALARDKDLSLKNVRHFILDE  198



>ref|XP_009365409.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009348326.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=428

 Score =   343 bits (879),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKVHKDLLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKELGLKNVRHFILDE  199



>ref|XP_007215422.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
 gb|EMJ16621.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
Length=428

 Score =   342 bits (878),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 190/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEIRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+P+AGQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPIAGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKVHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKELGLKNVRHFILDE  199



>ref|XP_004498731.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K ++AYEEELLDYEEED+KAPDS   KVNGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETK-DEAYEEELLDYEEEDDKAPDSAGTKVNGESGKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_006450448.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63688.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61714.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=427

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP  GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>gb|EYU32343.1| hypothetical protein MIMGU_mgv1a006879mg [Erythranthe guttata]
Length=428

 Score =   342 bits (877),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 186/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ KEN+AYEEELLDYEEE+EKAPDSV AK NGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTKENEAYEEELLDYEEEEEKAPDSVTAKANGESGKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST+QQIEP+AGQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTMQQIEPIAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC EF+RFSTYLP  K AVFYGGV+I  HKD+LKNECP IVVGTPGRILA
Sbjct  121  LCHTRELAYQICSEFDRFSTYLPGTKAAVFYGGVSIKNHKDILKNECPQIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  181  LAREKDLSLKNVRHFILDE  199



>ref|XP_009376926.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009376927.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=426

 Score =   342 bits (877),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 191/199 (96%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE + +D Y+EEL+DYEEE+EKAPDS AAKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETR-DDVYDEELVDYEEEEEKAPDS-AAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVSALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV+I +HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVSIKLHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  179  LARDKDLSLKNVRHFILDE  197



>ref|XP_008394071.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_008394072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_009355726.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
Length=426

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 191/199 (96%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE + +D Y+EEL+DYEEE+EKAPDS AAKVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETR-DDVYDEELVDYEEEEEKAPDS-AAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV+ALV
Sbjct  59   SIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVSALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKLHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  179  LARDKDLSLKNVRHFILDE  197



>ref|XP_006450446.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63686.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61717.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=423

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ EP  GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTEPNPGQVTALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_003603412.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES73663.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPD+  AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDTNGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            PD+KVAVFYGGVNI +HKDLLKNECP IVVGTPGRILAL+REK+LSL NVRHF+LDE
Sbjct  142  PDLKVAVFYGGVNIKVHKDLLKNECPQIVVGTPGRILALAREKNLSLKNVRHFVLDE  198



>ref|XP_009334641.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Pyrus x bretschneideri]
Length=428

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKELGLKNVRHFILDE  199



>ref|XP_006853982.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
 gb|ERN15449.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
Length=428

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 185/199 (93%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ND Y+EELLDYEEE+E APDS+ AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNDTYQEELLDYEEEEEIAPDSITAKGASESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVTGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HK+LLKNECPH+VVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKELLKNECPHVVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+ +K L+L NVRHFILDE
Sbjct  181  LANDKDLNLKNVRHFILDE  199



>gb|EYU24648.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
 gb|EYU24649.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
Length=428

 Score =   340 bits (871),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 177/199 (89%), Positives = 187/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE +EN+AYEEELLDYEEE+EKAPDSV  K   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEVRENEAYEEELLDYEEEEEKAPDSVNGKPAVESVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPV+GQVAALV
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVSGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EFERF+TYLPD+KVAVFYGGV I IHKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICNEFERFNTYLPDVKVAVFYGGVGIKIHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKDLGLKNVRHFILDE  199



>gb|AFK41905.1| unknown [Medicago truncatula]
Length=427

 Score =   340 bits (871),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPDSV AKVNGES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGESGKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+AL+LCHTRELAYQICHEFE FSTYL
Sbjct  82   LGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALILCHTRELAYQICHEFEGFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K LSL NVRHFILDE
Sbjct  142  ADLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILALARDKDLSLKNVRHFILDE  198



>ref|XP_004498730.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=487

 Score =   342 bits (876),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEELLDYEEED+KAPDS   KVNGES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETKD-EAYEEELLDYEEEDDKAPDSAGTKVNGESGKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_004501319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=451

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K ++AYEEELLDYEEED+KAPDS+ AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEPK-DEAYEEELLDYEEEDDKAPDSIGAKVNGEVTKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHF+LDE
Sbjct  180  LARDKDLSLKNVRHFVLDE  198



>ref|XP_006483351.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Citrus 
sinensis]
Length=427

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/199 (88%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++N  YE+ELLDYEEED +APDSVA K NGE+AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGETRDN-EYEDELLDYEEEDAQAPDSVATKANGEAAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ E   GQV ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQTELNPGQVTALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI IHKDLLKNECP IVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKIHKDLLKNECPQIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_004501320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Cicer arietinum]
Length=431

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K ++AYEEELLDYEEED+KAPDS+ AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEPK-DEAYEEELLDYEEEDDKAPDSIGAKVNGEVTKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHF+LDE
Sbjct  180  LARDKDLSLKNVRHFVLDE  198



>ref|XP_008362046.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Malus domestica]
Length=428

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/199 (85%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++ND YEEEL+DYEEED+ AP+SV+AK +G++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNDGYEEELVDYEEEDQNAPNSVSAKPSGDTVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQVAAL+
Sbjct  61   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVAALI  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KVAVFYGGV I +HKDLLKNECPHIVVGTPGR+LA
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDLKVAVFYGGVGIKVHKDLLKNECPHIVVGTPGRVLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKELGLKNVRHFILDE  199



>ref|XP_004501318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=455

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 189/199 (95%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K ++AYEEELLDYEEED+KAPDS+ AKVNGE  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEPK-DEAYEEELLDYEEEDDKAPDSIGAKVNGEVTKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVLSTLQQI+PV GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLSTLQQIDPVPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYL D+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICHEFERFSTYLSDLKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHF+LDE
Sbjct  180  LARDKDLSLKNVRHFVLDE  198



>emb|CAN76234.1| hypothetical protein VITISV_030204 [Vitis vinifera]
Length=383

 Score =   335 bits (859),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 178/199 (89%), Positives = 188/199 (94%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEEDEKAPDSVA+K  GESAKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEARDNDAYEEELLDYEEEDEKAPDSVASKAAGESAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            +IVDSGFEHPSE   +CIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  61   SIVDSGFEHPSE--GKCIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVSIKTHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L +VRHFILDE
Sbjct  179  LARDKDLGLKHVRHFILDE  197



>gb|ACU23008.1| unknown [Glycine max]
Length=310

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVAESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LARDKDLGLKNVRHFILDE  197



>emb|CAA09205.1| RNA helicase [Arabidopsis thaliana]
Length=451

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 188/203 (93%), Gaps = 1/203 (0%)
 Frame = +1

Query  97   NKQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKP  276
            N + MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKP
Sbjct  21   NLRSMGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKP  79

Query  277  ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQV  456
            ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV
Sbjct  80   ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQV  139

Query  457  AALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPG  636
            +ALVLCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPG
Sbjct  140  SALVLCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPG  199

Query  637  RILALSREKHLSLMNVRHFILDE  705
            R+LAL+REK LSL NVRHFILDE
Sbjct  200  RVLALAREKDLSLKNVRHFILDE  222



>ref|XP_002517619.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF44783.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=427

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 188/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M E K+ +AYEEELLDYEEE+EKAPDSV+AK   ++AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEEVKDTEAYEEELLDYEEEEEKAPDSVSAKA-ADTAKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI+DSGFEHPSEVQHECIPQAILGM VICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  60   AIIDSGFEHPSEVQHECIPQAILGMHVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPD+KV+VFYGGVNI IHKDLLKNECPH+VVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFSTYLPDLKVSVFYGGVNIKIHKDLLKNECPHVVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  180  LARDKDLGLKNVRHFILDE  198



>ref|XP_006585633.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 
[Glycine max]
Length=361

 Score =   333 bits (855),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LARDKDLGLKNVRHFILDE  197



>ref|XP_002873498.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49757.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|NP_568245.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 ref|NP_568244.2| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 sp|Q9LFN6.2|RH56_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 56; AltName: 
Full=UAP56 homolog B [Arabidopsis thaliana]
 sp|Q56XG6.3|RH15_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 15; AltName: 
Full=UAP56 homolog A [Arabidopsis thaliana]
 gb|AAK55671.1|AF378868_1 AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAK96496.1| AT5g11170/F2I11_60 [Arabidopsis thaliana]
 gb|AAL15393.1| AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAN46806.1| At5g11170/F2I11_60 [Arabidopsis thaliana]
 dbj|BAE98572.1| DEAD BOX RNA helicase RH15 - like protein [Arabidopsis thaliana]
 gb|AED91642.1| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 gb|AED91645.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=427

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  180  LAREKDLSLKNVRHFILDE  198



>emb|CAB96655.1| DEAD BOX RNA helicase RH15 [Arabidopsis thaliana]
Length=427

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  180  LAREKDLSLKNVRHFILDE  198



>emb|CAB96652.1| DEAD BOX RNA helicase RH15-like protein [Arabidopsis thaliana]
Length=435

 Score =   335 bits (859),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  180  LAREKDLSLKNVRHFILDE  198



>ref|XP_010419672.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
Length=427

 Score =   335 bits (858),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GTKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_006409182.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
 gb|ESQ50635.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
Length=427

 Score =   334 bits (857),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS A KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-ATKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI +HKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFMRFSTYLPDTKVSVFYGGVNIKVHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK+LSL NVRHFILDE
Sbjct  180  LAREKYLSLKNVRHFILDE  198



>ref|XP_006399618.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
 gb|ESQ41071.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
Length=427

 Score =   334 bits (857),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 187/199 (94%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKIPDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IH+DLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHRDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  180  LAREKDLSLKNVRHFILDE  198



>ref|XP_002871462.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47721.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   334 bits (857),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_003528338.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
Length=426

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVAESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LARDKDLGLKNVRHFILDE  197



>ref|NP_001154706.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91646.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=486

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  180  LAREKDLSLKNVRHFILDE  198



>gb|AGV54745.1| DEAD-box ATP-dependent RNA helicase 56-like protein [Phaseolus 
vulgaris]
Length=427

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            KAPDSV AKVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI
Sbjct  22   KAPDSVGAKVNGEATKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  81

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQV+ALVLCHTRELAYQICHEFERFSTYL
Sbjct  82   LGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVSALVLCHTRELAYQICHEFERFSTYL  141

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            PD+KVAVFYGGVNI +HKDLLK ECPHIVV TPGR L L+R + LSL NVRHFILDE
Sbjct  142  PDLKVAVFYGGVNIQVHKDLLKKECPHIVVRTPGRQLTLTRGEDLSLKNVRHFILDE  198



>ref|XP_003531708.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Glycine max]
Length=426

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LARDKDLGLKNVRHFILDE  197



>ref|XP_006287808.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 ref|XP_006289730.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
 gb|EOA20706.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 gb|EOA22628.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
Length=427

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|NP_001154707.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91647.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=468

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  180  LAREKDLSLKNVRHFILDE  198



>ref|XP_006585632.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Glycine max]
Length=440

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LARDKDLGLKNVRHFILDE  197



>ref|XP_010453157.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ + N+AYEEELLDYEEEDEK PDS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARGNEAYEEELLDYEEEDEKVPDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>gb|KHN47769.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=450

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 174/199 (87%), Positives = 185/199 (93%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEEEKAPDS--AKPVTESGKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LARDKDLGLKNVRHFILDE  197



>ref|XP_010453161.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Camelina sativa]
Length=427

 Score =   332 bits (852),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 185/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK PDS   KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL N RHFILDE
Sbjct  180  LARDKDLSLKNARHFILDE  198



>gb|ADE76139.1| unknown [Picea sitchensis]
Length=427

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KE+D Y+EELLDYEEED  A +SVAA+  GE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKESDTYQEELLDYEEEDV-AQESVAARGAGETVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERF TYL D+KVAVFYGGVNI  HK LLKNECPHIVVGTPGRILA
Sbjct  120  LCHTRELAYQICHEFERFITYLTDLKVAVFYGGVNIKTHKSLLKNECPHIVVGTPGRILA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK L+L NVRHFILDE
Sbjct  180  LAREKDLNLKNVRHFILDE  198



>ref|XP_010491834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
 ref|XP_010491835.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Camelina sativa]
Length=427

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 186/199 (93%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS  +KVNGE+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GSKVNGEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>gb|ACK38186.1| unknown [Medicago truncatula]
 gb|ACK77675.1| unknown, partial [Medicago truncatula]
Length=278

 Score =   326 bits (836),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ + YEEEL+DYEEEDEKA DS   K   ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEVYEEELIDYEEEDEKALDS--TKPTTESVKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHE ERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEVERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R++ L L NVRHFILDE
Sbjct  179  LTRDRDLGLKNVRHFILDE  197



>ref|XP_004960988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Setaria italica]
Length=429

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICHEFERFSKYLSEVKVAVFYGGVHIRKHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  182  LAREKDLSLKNVRHFILDE  200



>gb|KEH28678.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=504

 Score =   332 bits (851),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 193/230 (84%), Gaps = 15/230 (7%)
 Frame = +1

Query  19   FSLQNPNP-NPSSFQKA*LVFIVRFD*NKQQMGENKENDAyeeelldyeeedeKAPDSVA  195
            F L+ P   N S FQ+            ++ MGE K+ + YEEEL+DYEEEDEKA DS  
Sbjct  60   FFLKEPEAANSSRFQR------------EENMGELKDTEVYEEELIDYEEEDEKALDS--  105

Query  196  AKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVIC  375
             K   ES KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVIC
Sbjct  106  TKPTTESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVIC  165

Query  376  QAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAV  555
            QAKSGMGKTAVFVLSTLQQI+PV GQVAALVLCHTRELAYQICHE ERFSTYLPDIKVAV
Sbjct  166  QAKSGMGKTAVFVLSTLQQIDPVPGQVAALVLCHTRELAYQICHEVERFSTYLPDIKVAV  225

Query  556  FYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            FYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K L L NVRHFILDE
Sbjct  226  FYGGVNIKVHKDLLKNECPHIVVGTPGRILALTRDKDLGLKNVRHFILDE  275



>gb|KHN01339.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=473

 Score =   331 bits (848),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 186/203 (92%), Gaps = 2/203 (1%)
 Frame = +1

Query  97   NKQQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKP  276
             + +MGE K+ +AYEEEL+DYEEE+EKAPDS  AK   ES KKGY+GIHSSGFRDFLLKP
Sbjct  44   QRNRMGELKDTEAYEEELIDYEEEEEKAPDS--AKPVAESGKKGYVGIHSSGFRDFLLKP  101

Query  277  ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQV  456
            ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQV
Sbjct  102  ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQV  161

Query  457  AALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPG  636
            AALVLCHTRELAYQICHEFERFSTYLPDIK AVF GGVNI +HK+LLKNECPHIVVGTPG
Sbjct  162  AALVLCHTRELAYQICHEFERFSTYLPDIKAAVFCGGVNIKVHKELLKNECPHIVVGTPG  221

Query  637  RILALSREKHLSLMNVRHFILDE  705
            RILAL+R+K L L NVRHFILDE
Sbjct  222  RILALARDKDLGLKNVRHFILDE  244



>ref|XP_004960987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Setaria italica]
Length=456

 Score =   330 bits (847),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 173/199 (87%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICHEFERFSKYLSEVKVAVFYGGVHIRKHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL NVRHFILDE
Sbjct  182  LAREKDLSLKNVRHFILDE  200



>ref|NP_001141599.1| uncharacterized protein LOC100273717 [Zea mays]
 gb|ACN35192.1| unknown [Zea mays]
Length=429

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICHEFERFSKYLTEVKVAVFYGGVHIRKHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  182  LARDKDLSLKNVRHFILDE  200



>gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays]
 gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays]
 gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays]
Length=429

 Score =   329 bits (843),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICHEFERFSKYLTEVKVAVFYGGVHIRKHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  182  LARDKDLSLKNVRHFILDE  200



>ref|NP_001149406.1| spliceosome RNA helicase BAT1 [Zea mays]
 gb|ACG35346.1| spliceosome RNA helicase BAT1 [Zea mays]
Length=399

 Score =   328 bits (840),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 182/199 (91%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND YEEELLDYEE+D+K  D  AAK  GE AKKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKENDVYEEELLDYEEDDDKTVDGSAAKPTGEVAKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YL ++KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSKYLTEVKVAVFYGGVHIRKHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_001781775.1| predicted protein [Physcomitrella patens]
 gb|EDQ53423.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  199  KVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQ  378
            K NGE+ KKGY+GIHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDVICQ
Sbjct  28   KTNGETVKKGYVGIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVICQ  87

Query  379  AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  558
            AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF
Sbjct  88   AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  147

Query  559  YGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            YGGVNI  HKDLLKNECPHIVVGTPGRIL L+R+K LSL +VRHFILDE
Sbjct  148  YGGVNIKTHKDLLKNECPHIVVGTPGRILGLARDKDLSLKSVRHFILDE  196



>ref|XP_010097240.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB67307.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=525

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 191/231 (83%), Gaps = 31/231 (13%)
 Frame = +1

Query  106  QMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELL  285
            +MGE ++ND YEEEL+DYEEED+ AP+S +AK +G+SAKKGY+GIHSSGFRDFLLKPELL
Sbjct  3    RMGEVRDNDGYEEELVDYEEEDQNAPNSASAKPSGDSAKKGYVGIHSSGFRDFLLKPELL  62

Query  286  RAIVDSGFEHPSE-------------------------------VQHECIPQAILGMDVI  372
            RAIVDSGFEHPSE                               VQHECIPQAILGMDVI
Sbjct  63   RAIVDSGFEHPSEGNVINTVSFYVSLVLNLCNHYFHIHDSGKKTVQHECIPQAILGMDVI  122

Query  373  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVA  552
            CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIK+A
Sbjct  123  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKIA  182

Query  553  VFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            VFYGGV+I IHKDLLKNECPHIVVGTPGR+LAL+R+K L L NVRHFILDE
Sbjct  183  VFYGGVSIKIHKDLLKNECPHIVVGTPGRVLALARDKDLGLKNVRHFILDE  233



>ref|XP_010419674.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS  +KVN E+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GSKVNAEAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+ALV
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALV  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVNI IHKDLLKNECPHIVVGTPGR+LA
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNIKIHKDLLKNECPHIVVGTPGRVLA  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL N RHFILDE
Sbjct  180  LARDKDLSLKNARHFILDE  198



>ref|XP_007161216.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
 gb|ESW33210.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
Length=426

 Score =   327 bits (839),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 154/171 (90%), Positives = 164/171 (96%), Gaps = 0/171 (0%)
 Frame = +1

Query  193  AAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI  372
            A KVNGE+ KKGY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI
Sbjct  27   ANKVNGEAVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI  86

Query  373  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVA  552
            CQAKSGMGKTAVFVLSTLQQI+PVAGQV+ALVLCHTRELAYQIC+EFERFSTYLP++KVA
Sbjct  87   CQAKSGMGKTAVFVLSTLQQIDPVAGQVSALVLCHTRELAYQICNEFERFSTYLPELKVA  146

Query  553  VFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            VFYGGVNI +HKDLLKNECP IVVGTPGRIL L+R+K LSL NVRHFILDE
Sbjct  147  VFYGGVNIKVHKDLLKNECPSIVVGTPGRILGLARDKDLSLKNVRHFILDE  197



>ref|XP_001770294.1| predicted protein [Physcomitrella patens]
 gb|EDQ64969.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +1

Query  199  KVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQ  378
            K NGE+ KKGY+GIHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDVICQ
Sbjct  28   KTNGETVKKGYVGIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVICQ  87

Query  379  AKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  558
            AKSGMGKTAVFVLSTLQQIEPV GQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF
Sbjct  88   AKSGMGKTAVFVLSTLQQIEPVTGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVF  147

Query  559  YGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            YGGVNI  HKDLLKNECPHIVVGTPGRIL L+R+K LSL +VRHFILDE
Sbjct  148  YGGVNIKTHKDLLKNECPHIVVGTPGRILGLARDKDLSLKSVRHFILDE  196



>ref|XP_007135742.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
 gb|ESW07736.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
Length=425

 Score =   327 bits (838),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 181/199 (91%), Gaps = 3/199 (2%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ + YEEELLDYEEEDEKAPDS       ES KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTETYEEELLDYEEEDEKAPDSAKP---AESGKKGYVGIHSSGFRDFLLKPELLR  57

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ++PV GQVAALV
Sbjct  58   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQVDPVPGQVAALV  117

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYL DIK AVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  118  LCHTRELAYQICHEFERFSTYLSDIKAAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  177

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  178  LARDKDLGLKNVRHFILDE  196



>ref|XP_004506912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=435

 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 172/199 (86%), Positives = 183/199 (92%), Gaps = 2/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ +AYEEEL+DYEEEDEK  DS   K   E+ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGELKDTEAYEEELIDYEEEDEKTLDS--TKPASETVKKGYVGIHSSGFRDFLLKPELLR  58

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PV GQVAALV
Sbjct  59   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVPGQVAALV  118

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HK+LLKNECPHIVVGTPGRILA
Sbjct  119  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKELLKNECPHIVVGTPGRILA  178

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  179  LTRDKDLGLKNVRHFILDE  197



>ref|XP_009125794.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   326 bits (835),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 171/199 (86%), Positives = 184/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M + ++N+AYEEELLDYEEEDEKAPDS A KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDPRDNEAYEEELLDYEEEDEKAPDS-ANKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK LLKNECPHIVVGTPGR+L 
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKALLKNECPHIVVGTPGRVLG  179

Query  649  LSREKHLSLMNVRHFILDE  705
            LSR+K LSL NVRHFILDE
Sbjct  180  LSRDKDLSLNNVRHFILDE  198



>ref|XP_009125790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
 ref|XP_009125791.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   324 bits (830),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/199 (85%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPHIVVGTPGR+L 
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPHIVVGTPGRVLG  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_002969825.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
 gb|EFJ28949.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
Length=428

 Score =   323 bits (828),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND Y+EELLDYEEE+E APD+VAAK   E+ KKGY+GIHSSGFRDFLLKPEL+R
Sbjct  1    MGEAKENDTYQEELLDYEEEEEAAPDAVAAKGAAETVKKGYVGIHSSGFRDFLLKPELVR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVD GFEHPSEVQ ECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP+ GQVAALV
Sbjct  61   AIVDCGFEHPSEVQFECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPLKGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGTPGRIL 
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILQ  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL  VRHFILDE
Sbjct  181  LTREKELSLKGVRHFILDE  199



>ref|XP_009121980.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHKDLLKNECPHIVVGTPGR+L 
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKDLLKNECPHIVVGTPGRVLG  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_009121981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Brassica rapa]
Length=430

 Score =   323 bits (827),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/199 (84%), Positives = 183/199 (92%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHKDLLKNECPHIVVGTPGR+L 
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKDLLKNECPHIVVGTPGRVLG  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  180  LARDKDLSLKNVRHFILDE  198



>ref|XP_002985161.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
 gb|EFJ13655.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
Length=473

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 175/199 (88%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE KEND Y+EELLDYEEE+E APD+VAAK   E+ KKGY+GIHSSGFRDFLLKPEL+R
Sbjct  1    MGEAKENDTYQEELLDYEEEEEAAPDAVAAKGAAETVKKGYVGIHSSGFRDFLLKPELVR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVD GFEHPSEVQ ECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP+ GQVAALV
Sbjct  61   AIVDCGFEHPSEVQFECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPLKGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI  HKDLLKNECPHIVVGTPGRIL 
Sbjct  121  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKTHKDLLKNECPHIVVGTPGRILQ  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+REK LSL  VRHFILDE
Sbjct  181  LTREKELSLKGVRHFILDE  199



>emb|CDX85725.1| BnaA02g00880D [Brassica napus]
Length=442

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 185/203 (91%), Gaps = 5/203 (2%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M + ++N+AYEEELLDYEEEDEKAPDS A KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDPRDNEAYEEELLDYEEEDEKAPDS-ANKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE----VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQV  456
            AIVDSGFEHPSE    VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV
Sbjct  60   AIVDSGFEHPSEGKYGVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQV  119

Query  457  AALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPG  636
            +AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPHIVVGTPG
Sbjct  120  SALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPHIVVGTPG  179

Query  637  RILALSREKHLSLMNVRHFILDE  705
            R+L L+R+K LSL NVRHFILDE
Sbjct  180  RVLGLARDKDLSLKNVRHFILDE  202



>ref|XP_010231899.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010231901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   320 bits (819),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+N+ YE++L+DYEEE E   D+ AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNEVYEDDLVDYEEEVENVVDAAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YL + KVAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSKYLSETKVAVFYGGVNIKNHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_009131197.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
56-like [Brassica rapa]
Length=458

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 182/199 (91%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIH SGFRDFLLKPELLR
Sbjct  32   MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHRSGFRDFLLKPELLR  90

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  91   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPTPGQVSALI  150

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK+LLKNECPHIVVGTPGR+L 
Sbjct  151  LCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKELLKNECPHIVVGTPGRVLG  210

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  211  LARDKDLSLKNVRHFILDE  229



>emb|CDY51112.1| BnaCnng20150D [Brassica napus]
Length=440

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 184/205 (90%), Gaps = 7/205 (3%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M + ++N+AYEEELLDYEEE+EKAPDS A K NG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MEDPRDNEAYEEELLDYEEEEEKAPDS-ATKANGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE------VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAG  450
            AIVDSGFEHPSE      +QHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  G
Sbjct  60   AIVDSGFEHPSEGKCFSLLQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPAPG  119

Query  451  QVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  630
            QV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPHIVVGT
Sbjct  120  QVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPHIVVGT  179

Query  631  PGRILALSREKHLSLMNVRHFILDE  705
            PGR+L L+R+K LSL NVRHFILDE
Sbjct  180  PGRVLGLARDKDLSLKNVRHFILDE  204



>ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+N+ YEE+L+DYEEE E A D  AA  + E  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNEVYEEDLVDYEEEVENAVDGTAANASVEVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EFERFS YL + +VAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICNEFERFSKYLSETRVAVFYGGVHIKKHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
 ref|XP_010231904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
Length=429

 Score =   317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 178/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+N+ YEE+L+DYEEE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MGEAKDNEVYEEDLVDYEEEVENAVDGAAANASVDVVKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  182  LARDKDLSLKNVRHFILDE  200



>gb|KDO61715.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=418

 Score =   315 bits (808),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/161 (93%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = +1

Query  223  KGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT  402
            +GY+GIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT
Sbjct  29   QGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT  88

Query  403  AVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITI  582
            AVFVLSTLQQ EP  GQV ALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI I
Sbjct  89   AVFVLSTLQQTEPNPGQVTALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKI  148

Query  583  HKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            HKDLLKNECP IVVGTPGRILAL+R+K LSL NVRHFILDE
Sbjct  149  HKDLLKNECPQIVVGTPGRILALARDKDLSLKNVRHFILDE  189



>emb|CDM83038.1| unnamed protein product [Triticum aestivum]
Length=337

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/199 (82%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ + YEE+L+DY+EE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDAEVYEEDLVDYDEEVENAVDGAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  181  LARDKDLSLKNVRHFILDE  199



>ref|XP_004968948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Setaria italica]
Length=429

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 175/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M E K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MVEAKDNEVYEEDLVDYEEEVENVADGAPTNGSADVVKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVNIKNHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  182  LARDKDLPLKNVRHFILDE  200



>ref|NP_001170610.1| uncharacterized protein LOC100384654 [Zea mays]
 ref|XP_008655336.1| PREDICTED: uncharacterized protein LOC100384654 isoform X1 [Zea 
mays]
 gb|ACR34212.1| unknown [Zea mays]
 gb|AFW82992.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
 gb|AFW82993.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=427

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDNEVYEEDLVDYEEEVENVIDGAPTNGSSDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  61   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  121  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVHIKNHKDLLKNECPHIVVGTPGRILA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  181  LARDKDLPLKNVRHFILDE  199



>gb|AFW82994.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=446

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 176/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  20   MGEAKDNEVYEEDLVDYEEEVENVIDGAPTNGSSDVVKKGYVGIHSSGFRDFLLKPELLR  79

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  80   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  139

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGV+I  HKDLLKNECPHIVVGTPGRILA
Sbjct  140  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVHIKNHKDLLKNECPHIVVGTPGRILA  199

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  200  LARDKDLPLKNVRHFILDE  218



>ref|XP_004968947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Setaria italica]
Length=457

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/199 (81%), Positives = 175/199 (88%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M E K+N+ YEE+L+DYEEE E   D      + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  2    MVEAKDNEVYEEDLVDYEEEVENVADGAPTNGSADVVKKGYVGIHSSGFRDFLLKPELLR  61

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAALV
Sbjct  62   AIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAALV  121

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFS YLP+++VAVFYGGVNI  HKDLLKNECPHIVVGTPGRILA
Sbjct  122  LCHTRELAYQICHEFERFSKYLPELRVAVFYGGVNIKNHKDLLKNECPHIVVGTPGRILA  181

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K L L NVRHFILDE
Sbjct  182  LARDKDLPLKNVRHFILDE  200



>ref|XP_006644282.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            A  + AA  + + AKKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAIL
Sbjct  29   ADGASAANASADVAKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAIL  88

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YL 
Sbjct  89   GMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLS  148

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +IKVAVFYGGV+I  HKDLLKN+CPHIVVGTPGRILAL+REK LSL NVRHFILDE
Sbjct  149  EIKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPGRILALAREKDLSLKNVRHFILDE  204



>ref|XP_006644281.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   312 bits (800),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            A  + AA  + + AKKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAIL
Sbjct  29   ADGASAANASADVAKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAIL  88

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YL 
Sbjct  89   GMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLS  148

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +IKVAVFYGGV+I  HKDLLKN+CPHIVVGTPGRILAL REK LSL NVRHFILDE
Sbjct  149  EIKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPGRILALVREKDLSLKNVRHFILDE  204



>emb|CDX85726.1| BnaA02g00870D [Brassica napus]
Length=490

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 183/210 (87%), Gaps = 12/210 (6%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE-----------VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI  435
            AIVDSGFEHPSE           +QHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI
Sbjct  60   AIVDSGFEHPSEGKCFSLHFLAFLQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI  119

Query  436  EPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPH  615
            EP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHKDLLKNECPH
Sbjct  120  EPAPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKDLLKNECPH  179

Query  616  IVVGTPGRILALSREKHLSLMNVRHFILDE  705
            IVVGTPGR+L L+R+K LSL NVRHFILDE
Sbjct  180  IVVGTPGRVLGLARDKDLSLKNVRHFILDE  209



>emb|CDX70383.1| BnaC03g04670D [Brassica napus]
Length=447

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 183/219 (84%), Gaps = 21/219 (10%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDTRDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE--------------------VQHECIPQAILGMDVICQAKSGMGKTAV  408
            AIVDSGFEHPSE                    VQHECIPQAILGMDVICQAKSGMGKTAV
Sbjct  60   AIVDSGFEHPSEGKILYASFFVLCLSPMFDKIVQHECIPQAILGMDVICQAKSGMGKTAV  119

Query  409  FVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHK  588
            FVLSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK
Sbjct  120  FVLSTLQQIEPTPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHK  179

Query  589  DLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +LLKNECPHIVVGTPGR+L L+R+K LSL NVRHFILDE
Sbjct  180  ELLKNECPHIVVGTPGRVLGLARDKDLSLKNVRHFILDE  218



>ref|XP_009121982.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
 ref|XP_009121983.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ +E++AYEEELLDYEEEDEK  DS A K NG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRESEAYEEELLDYEEEDEKLLDS-ATKTNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHK+LLKNE PHIVVGTPGR L 
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKELLKNEYPHIVVGTPGRGLG  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R K LSL N RHFILDE
Sbjct  180  LARGKDLSLKNARHFILDE  198



>sp|Q0JM17.2|RH56_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 56 [Oryza sativa 
Japonica Group]
 dbj|BAD88053.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAG90417.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACV83946.1| DExD box helicase protein HLA-B associated transcript 1 [Oryza 
sativa Japonica Group]
Length=432

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  220  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  399
            KKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGK
Sbjct  42   KKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  101

Query  400  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  579
            TAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I 
Sbjct  102  TAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIK  161

Query  580  IHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             HKDLLKN+CPHIVVGTPGRILAL+REK LSL NVRHFILDE
Sbjct  162  KHKDLLKNDCPHIVVGTPGRILALAREKDLSLKNVRHFILDE  203



>ref|XP_009121985.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Brassica rapa]
Length=430

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 165/199 (83%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ +E++AYEEELLDYEEEDEK  DS A K NG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRESEAYEEELLDYEEEDEKLLDS-ATKTNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL+
Sbjct  60   AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSALI  119

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQIC+EF RFSTYLPD +V+VFYGGVN  IHK+LLKNE PHIVVGTPGR L 
Sbjct  120  LCHTRELAYQICNEFVRFSTYLPDTRVSVFYGGVNNKIHKELLKNEYPHIVVGTPGRGLG  179

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R K LSL N RHFILDE
Sbjct  180  LARGKDLSLKNARHFILDE  198



>ref|NP_001043298.1| Os01g0550000 [Oryza sativa Japonica Group]
 sp|Q5JK84.1|RH15_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 15 [Oryza sativa 
Japonica Group]
 dbj|BAD88055.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAD88115.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05212.1| Os01g0550000 [Oryza sativa Japonica Group]
 dbj|BAH00768.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70861.1| hypothetical protein OsI_02373 [Oryza sativa Indica Group]
Length=432

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  220  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  399
            KKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGK
Sbjct  42   KKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  101

Query  400  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  579
            TAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I 
Sbjct  102  TAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIK  161

Query  580  IHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             HKDLLKN+CPHIVVGTPGRILAL+REK LSL NVRHFILDE
Sbjct  162  KHKDLLKNDCPHIVVGTPGRILALAREKDLSLKNVRHFILDE  203



>emb|CDX78412.1| BnaA03g03240D [Brassica napus]
Length=497

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 183/217 (84%), Gaps = 19/217 (9%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE------------------VQHECIPQAILGMDVICQAKSGMGKTAVFV  414
            AIVDSGFEHPSE                  VQHECIPQAILGMDVICQAKSGMGKTAVFV
Sbjct  60   AIVDSGFEHPSEGKYLSVFFELYSTYKRFFVQHECIPQAILGMDVICQAKSGMGKTAVFV  119

Query  415  LSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDL  594
            LSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGGVN  IHK+L
Sbjct  120  LSTLQQIEPTPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGGVNNKIHKEL  179

Query  595  LKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            LKNECPHIVVGTPGR+L L+R+K LSL NVRHFILDE
Sbjct  180  LKNECPHIVVGTPGRVLGLARDKDLSLKNVRHFILDE  216



>ref|NP_001043297.1| Os01g0549700 [Oryza sativa Japonica Group]
 dbj|BAF05211.1| Os01g0549700, partial [Oryza sativa Japonica Group]
Length=495

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = +1

Query  220  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  399
            KKGY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGK
Sbjct  105  KKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  164

Query  400  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  579
            TAVFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I 
Sbjct  165  TAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIK  224

Query  580  IHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             HKDLLKN+CPHIVVGTPGRILAL+REK LSL NVRHFILDE
Sbjct  225  KHKDLLKNDCPHIVVGTPGRILALAREKDLSLKNVRHFILDE  266



>gb|EEE54779.1| hypothetical protein OsJ_02176 [Oryza sativa Japonica Group]
Length=429

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = +1

Query  226  GYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTA  405
            GY+GIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTA
Sbjct  41   GYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTA  100

Query  406  VFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIH  585
            VFVLS+LQQI+PVAGQV ALVLCHTRELAYQICHEFERFS YLP++KVAVFYGGV+I  H
Sbjct  101  VFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKH  160

Query  586  KDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            KDLLKN+CPHIVVGTPGRILAL+REK LSL NVRHFILDE
Sbjct  161  KDLLKNDCPHIVVGTPGRILALAREKDLSLKNVRHFILDE  200



>emb|CDX69778.1| BnaA10g21270D [Brassica napus]
Length=495

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 183/226 (81%), Gaps = 28/226 (12%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+ YEEELLDYEEEDEK  DS A KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDVRDNEVYEEELLDYEEEDEKLLDS-ATKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE---------------------------VQHECIPQAILGMDVICQAKS  387
            AIVDSGFEHPSE                           +QHECIPQAILGMDVICQAKS
Sbjct  60   AIVDSGFEHPSEGKFISLLALFLSLHLDFFVPTTYIIAMLQHECIPQAILGMDVICQAKS  119

Query  388  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  567
            GMGKTAVFVLSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGG
Sbjct  120  GMGKTAVFVLSTLQQIEPSPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGG  179

Query  568  VNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            VN  IHKDLLKNECPHIVVGTPGR+L L+R+K LSL NVRHFILDE
Sbjct  180  VNNKIHKDLLKNECPHIVVGTPGRVLGLARDKDLSLKNVRHFILDE  225



>emb|CDX69777.1| BnaA10g21260D [Brassica napus]
Length=523

 Score =   307 bits (787),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 183/226 (81%), Gaps = 28/226 (12%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MG+ ++N+AYEEELLDYEEEDEK  DS   KVNG++ KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGDARDNEAYEEELLDYEEEDEKVLDS-GNKVNGDAVKKGYVGIHSSGFRDFLLKPELLR  59

Query  289  AIVDSGFEHPSE---------------------------VQHECIPQAILGMDVICQAKS  387
            AIVDSGFEHPSE                           +QHECIPQAILGMDVICQAKS
Sbjct  60   AIVDSGFEHPSEGKFISLLALFLSLHLDFFVPTTYIIAMLQHECIPQAILGMDVICQAKS  119

Query  388  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  567
            GMGKTAVFVLSTLQQIEP  GQV+AL+LCHTRELAYQIC+EF RFSTYLPD KV+VFYGG
Sbjct  120  GMGKTAVFVLSTLQQIEPSPGQVSALILCHTRELAYQICNEFVRFSTYLPDTKVSVFYGG  179

Query  568  VNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            VN  IHKDLLKNECPHIVVGTPGR+L L+R+K LSL NVRHFILDE
Sbjct  180  VNNKIHKDLLKNECPHIVVGTPGRVLGLARDKDLSLKNVRHFILDE  225



>gb|EMS64048.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=456

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 170/205 (83%), Gaps = 6/205 (3%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ + YEE+L+DY+EE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDAEVYEEDLVDYDEEVENAVDGAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGF------EHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAG  450
            AI D              VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAG
Sbjct  61   AIQDCIISSDIFSRRRGYVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAG  120

Query  451  QVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGT  630
            QVAALVLCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGT
Sbjct  121  QVAALVLCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGT  180

Query  631  PGRILALSREKHLSLMNVRHFILDE  705
            PGRILAL+R+K LSL NVRHFILDE
Sbjct  181  PGRILALARDKDLSLKNVRHFILDE  205



>gb|EMS68248.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=657

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 182/236 (77%), Gaps = 38/236 (16%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESA------KKGYIGIHSSGFRDFLL  270
            MGE KEND YEEELLDYEE+D+KA D+ ++  N + A      KKGY+GIHSSGFRDFLL
Sbjct  1    MGEAKENDVYEEELLDYEEDDDKALDA-SSNANAKPAADASQPKKGYVGIHSSGFRDFLL  59

Query  271  KPELLRAIVDSGFEHPSE-------------------------------VQHECIPQAIL  357
            KPELLRAI D GFEHPSE                               VQHECIPQAIL
Sbjct  60   KPELLRAIQDCGFEHPSEGKPPHIYFFFLDFSRLGTVYFLLTFPVGGKYVQHECIPQAIL  119

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMDVICQAKSGMGKTAVFVLS+LQQI+P AGQV ALVLCHTRELAYQIC+EFERFS +LP
Sbjct  120  GMDVICQAKSGMGKTAVFVLSSLQQIDPTAGQVTALVLCHTRELAYQICNEFERFSKFLP  179

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            ++KVAVFYGGV+I  H+DLLKN+CPHIVVGTPGRILAL+R+K LSL NVRHFILDE
Sbjct  180  ELKVAVFYGGVHIKKHQDLLKNDCPHIVVGTPGRILALARDKDLSLKNVRHFILDE  235



>gb|EMT33323.1| DEAD-box ATP-dependent RNA helicase 56 [Aegilops tauschii]
Length=501

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 169/200 (85%), Gaps = 1/200 (1%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE K+ + YEE+L+DY+EE E A D  AA  + +  KKGY+GIHSSGFRDFLLKPELLR
Sbjct  1    MGEAKDAEVYEEDLVDYDEEVENAVDGAAANPSVDVVKKGYVGIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGF-EHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL  465
             I    F      VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQI+PVAGQVAAL
Sbjct  61   IISSDIFGRRRGYVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIDPVAGQVAAL  120

Query  466  VLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRIL  645
            VLCHTRELAYQIC+EFERFS YL + KVAVFYGGV+I  HKDLLKNECPHIVVGTPGRIL
Sbjct  121  VLCHTRELAYQICNEFERFSKYLSETKVAVFYGGVHIKKHKDLLKNECPHIVVGTPGRIL  180

Query  646  ALSREKHLSLMNVRHFILDE  705
            AL+R+K LSL NVRHFILDE
Sbjct  181  ALARDKDLSLKNVRHFILDE  200



>gb|KHG15649.1| DEAD-box ATP-dependent RNA helicase 56 -like protein [Gossypium 
arboreum]
Length=401

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 163/199 (82%), Gaps = 27/199 (14%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            MGE ++NDAYEEELLDYEEE+EKAPDSV AKVNGE+ KKGY+GIH               
Sbjct  1    MGETRDNDAYEEELLDYEEEEEKAPDSVTAKVNGEAGKKGYVGIH---------------  45

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
                        +QHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQIEP  GQV ALV
Sbjct  46   ------------MQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIEPSPGQVIALV  93

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILA
Sbjct  94   LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIKVHKDLLKNECPHIVVGTPGRILA  153

Query  649  LSREKHLSLMNVRHFILDE  705
            L+R+K LSL NVRHFILDE
Sbjct  154  LTRDKDLSLKNVRHFILDE  172



>ref|NP_998142.1| ATP-dependent RNA helicase DDX39 [Danio rerio]
 gb|AAH44169.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 gb|AAH67555.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 gb|AAI28805.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 emb|CAQ13699.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b [Danio rerio]
 gb|AAI65847.1| Ddx39b protein [Danio rerio]
Length=427

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA V  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPVGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +KVAVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  141  TVKVAVFFGGMSIKKDEDVLKKSCPHIVVGTPGRILALVRNKTLNLKNVKHFVLDE  196



>ref|XP_010744670.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like isoform X2 
[Larimichthys crocea]
Length=429

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG+ I   +++LK  CPHIVVGTPGRILAL+R KHLSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGLAIKKDEEVLKKNCPHIVVGTPGRILALTRSKHLSLKNVKHFVLDE  196



>ref|XP_010744669.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like isoform X1 
[Larimichthys crocea]
Length=388

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 150/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG+ I   +++LK  CPHIVVGTPGRILAL+R KHLSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGLAIKKDEEVLKKNCPHIVVGTPGRILALTRSKHLSLKNVKHFVLDE  196



>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human 
Uap56
 pdb|1T6N|B Chain B, Crystal Structure Of The N-Terminal Domain Of Human 
Uap56
Length=220

 Score =   270 bits (691),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 146/166 (88%), Gaps = 0/166 (0%)
 Frame = +1

Query  208  GESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKS  387
            G   K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKS
Sbjct  1    GSDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKS  60

Query  388  GMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGG  567
            GMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG
Sbjct  61   GMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGG  120

Query  568  VNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            ++I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  121  LSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  166



>gb|EDL10915.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isoform CRA_a [Mus 
musculus]
Length=225

 Score =   270 bits (690),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  37   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  96

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  97   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  156

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  157  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  213



>ref|XP_006631613.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Lepisosteus 
oculatus]
Length=427

 Score =   275 bits (704),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQVA LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVAVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +++LK  CPHIVVGTPGRILAL R K LSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALVRNKTLSLKNVKHFVLDE  196



>ref|XP_007231785.1| PREDICTED: spliceosome RNA helicase DDX39B-like [Astyanax mexicanus]
Length=436

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            A DS A  +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  30   AGDSGAMTIRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  89

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  90   GMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMP  149

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +KVAVF+GG++I   +++LK E PH+VVGTPGRILALSR K L+L +++HFILDE
Sbjct  150  AVKVAVFFGGLSIKKDEEVLKRESPHVVVGTPGRILALSRNKSLNLRHIKHFILDE  205



>ref|XP_001516247.2| PREDICTED: spliceosome RNA helicase DDX39B, partial [Ornithorhynchus 
anatinus]
Length=296

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|NP_001134851.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACI69146.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
Length=427

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  124  ENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDS  303
            ENDA  E L   E+E+ +     AA    +  K  Y+ IHSSGFRDFLLKPELLRAIVD 
Sbjct  3    ENDADNELLDYEEDEEPQGAPETAAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDC  62

Query  304  GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTR  483
            GFEHPSEVQHECIPQAILGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTR
Sbjct  63   GFEHPSEVQHECIPQAILGMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTR  122

Query  484  ELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREK  663
            ELA+QI  E+ERFS Y+P +K AVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K
Sbjct  123  ELAFQISKEYERFSKYMPTVKAAVFFGGLSIKKDEDVLKKNCPHIVVGTPGRILALIRNK  182

Query  664  HLSLMNVRHFILDE  705
             L+L NV+HF+LDE
Sbjct  183  TLNLKNVKHFVLDE  196



>gb|EGV95298.1| Spliceosome RNA helicase BAT1 [Cricetulus griseus]
Length=288

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_008314982.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cynoglossus semilaevis]
Length=424

 Score =   274 bits (700),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 0/167 (0%)
 Frame = +1

Query  205  NGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAK  384
            N +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++CQAK
Sbjct  27   NKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDILCQAK  86

Query  385  SGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYG  564
            SGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+G
Sbjct  87   SGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFG  146

Query  565  GVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            G+ I   +D+LKN CPHIVVGTPGR LAL R K+LS+ N++HF+LDE
Sbjct  147  GMAIKNDEDVLKNNCPHIVVGTPGRTLALIRNKNLSVKNIKHFVLDE  193



>ref|XP_003515868.2| PREDICTED: spliceosome RNA helicase DDX39B-like [Cricetulus griseus]
 gb|EGW15305.1| Spliceosome RNA helicase Bat1 [Cricetulus griseus]
Length=229

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKT VFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTVVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>gb|EAX03412.1| hCG2005638, isoform CRA_d [Homo sapiens]
Length=290

 Score =   269 bits (687),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_005470227.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Oreochromis 
niloticus]
Length=206

 Score =   266 bits (679),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = +1

Query  181  PDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILG  360
            P+S     N +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILG
Sbjct  23   PES-GTPANKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILG  81

Query  361  MDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPD  540
            MD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P 
Sbjct  82   MDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMPT  141

Query  541  IKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +KV+VF+GG+ I   +++LK  CPHIVVGTPGR LAL R K LS+ N++HF+LDE
Sbjct  142  VKVSVFFGGMAIKKDEEVLKKNCPHIVVGTPGRTLALIRNKTLSVKNIKHFVLDE  196



>ref|NP_001133080.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACH70654.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 [Salmo salar]
Length=427

 Score =   273 bits (699),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP++ AA    +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APET-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  141  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGTPGRILALIRNKTLNLKNVKHFVLDE  196



>emb|CDQ90161.1| unnamed protein product [Oncorhynchus mykiss]
Length=427

 Score =   273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/194 (69%), Positives = 156/194 (80%), Gaps = 0/194 (0%)
 Frame = +1

Query  124  ENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDS  303
            ENDA  E L   E+E+ +     +A    +  K  Y+ IHSSGFRDFLLKPELLRAIVD 
Sbjct  3    ENDAENELLDYEEDEEPQGAPETSAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDC  62

Query  304  GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTR  483
            GFEHPSEVQHECIPQAILGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTR
Sbjct  63   GFEHPSEVQHECIPQAILGMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTR  122

Query  484  ELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREK  663
            ELA+QI  E+ERFS Y+P +K AVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K
Sbjct  123  ELAFQISKEYERFSKYMPTVKAAVFFGGLSIKKDEDVLKKNCPHIVVGTPGRILALIRNK  182

Query  664  HLSLMNVRHFILDE  705
             L+L NV+HF+LDE
Sbjct  183  TLNLKNVKHFVLDE  196



>ref|XP_008853627.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Nannospalax galili]
Length=427

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQETTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP++GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPISGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>dbj|BAE42496.1| unnamed protein product [Mus musculus]
Length=324

 Score =   270 bits (690),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_010744288.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Larimichthys 
crocea]
Length=388

 Score =   272 bits (695),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  202  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  381
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  34   IRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  93

Query  382  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  561
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+
Sbjct  94   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFF  153

Query  562  GGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            GG++I   +++LK +CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  154  GGLSIKKDEEVLKKDCPHIVVGTPGRILALTRNKTLNLRHIKHFILDE  201



>ref|XP_007612851.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2, partial 
[Cricetulus griseus]
Length=245

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKT VFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTVVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_005515740.1| PREDICTED: spliceosome RNA helicase DDX39B-like, partial [Columba 
livia]
Length=202

 Score =   265 bits (678),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPH+VVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHVVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_006080887.1| PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Glu-Ala-Asp) box polypeptide 
39B [Bubalus bubalis]
Length=290

 Score =   268 bits (686),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>gb|ACO09904.1| ATP-dependent RNA helicase DDX39 [Osmerus mordax]
Length=427

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP++ A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APEA-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG+ I   +++LK  CPHIVVGTPGRILALSR K LSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGMAIKKDEEVLKKNCPHIVVGTPGRILALSRNKTLSLKNVKHFVLDE  196



>ref|XP_010101269.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB88204.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=518

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 177/254 (70%), Gaps = 55/254 (22%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHS--------------  246
            MGE ++ND Y+EEL+DYEEEDEKAPDSV AKVNGE+ KKGY+GIHS              
Sbjct  1    MGETRDNDVYDEELVDYEEEDEKAPDSVGAKVNGEAPKKGYVGIHSSGFRDFLLKPELLR  60

Query  247  ----SGF---------RDFLLKPELLRAIVDS-----------GFEHPSE----------  324
                SGF           F L   L   I+             G E   E          
Sbjct  61   AIVDSGFEHPSEGNLSNSFSLITRLYCCIIKCAANVNLLACTYGIELSPEPVIVIYCYHY  120

Query  325  -------VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTR  483
                   VQHECIPQAILGMDVICQAKSGMGKTAVFVLS+LQQI+PVAGQV+ALVLCHTR
Sbjct  121  LDFENWYVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVSALVLCHTR  180

Query  484  ELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREK  663
            ELAYQICHEFERFSTYLPD+KVAVFYGGVNI +HKDLLKNECPHIVVGTPGRILAL+R+K
Sbjct  181  ELAYQICHEFERFSTYLPDLKVAVFYGGVNIKLHKDLLKNECPHIVVGTPGRILALARDK  240

Query  664  HLSLMNVRHFILDE  705
             LSL NVRHFILDE
Sbjct  241  DLSLKNVRHFILDE  254



>ref|XP_003443119.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Oreochromis 
niloticus]
 ref|XP_004562993.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Maylandia 
zebra]
 ref|XP_005738104.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Pundamilia 
nyererei]
 ref|XP_005926773.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Haplochromis 
burtoni]
 ref|XP_006805133.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Neolamprologus 
brichardi]
Length=427

 Score =   273 bits (697),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S A     +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             IK AVF+GG+ I   +D+LK  CPHIVVGTPGRILAL R K LSL NV+HF+LDE
Sbjct  141  TIKAAVFFGGLPIKKDEDVLKKNCPHIVVGTPGRILALIRNKTLSLKNVKHFVLDE  196



>ref|XP_006993135.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006993136.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Peromyscus 
maniculatus bairdii]
Length=427

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPQKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPINGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>ref|XP_007647292.1| PREDICTED: LOW QUALITY PROTEIN: spliceosome RNA helicase DDX39B 
isoform X1 [Cricetulus griseus]
Length=290

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPITGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_008303441.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Stegastes partitus]
Length=427

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPTGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG+ I   +++LK  CPHIVVGTPGRILAL R K LSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGLAIKKDEEVLKKNCPHIVVGTPGRILALIRNKTLSLKNVKHFVLDE  196



>ref|XP_001366378.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Monodelphis 
domestica]
 ref|XP_007489117.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Monodelphis 
domestica]
Length=427

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  32   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  91

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P++KV+VF+GG+
Sbjct  92   MGKTAVFVLATLQQIEPVDGQVTVLVMCHTRELAFQISKEYERFSKYMPNVKVSVFFGGL  151

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +D+LK  CPH+VVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  152  SIKKDEDVLKKNCPHVVVGTPGRILALVRNKSLNLKNVKHFVLDE  196



>ref|XP_007229864.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Astyanax mexicanus]
Length=427

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APES-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +++LK  CPHIVVGTPGRILAL R K LSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALIRSKTLSLKNVKHFVLDE  196



>ref|XP_004073639.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Oryzias latipes]
Length=427

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPTGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVTVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG+ I   +D+LK  CPHIVVGTPGRILAL R K L+L N++HF+LDE
Sbjct  141  TVKAAVFFGGMAIKNDEDVLKKNCPHIVVGTPGRILALIRNKTLNLKNIKHFVLDE  196



>dbj|BAD92454.1| HLA-B associated transcript 1 variant [Homo sapiens]
Length=310

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  53   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  112

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  113  MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  172

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  173  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  217



>ref|XP_004715629.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Echinops telfairi]
Length=279

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPVPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDILCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSLNLRNVKHFVLDE  196



>ref|NP_932099.2| ATP-dependent RNA helicase DDX39A [Mus musculus]
 ref|XP_006531395.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Mus 
musculus]
 sp|Q8VDW0.1|DX39A_MOUSE RecName: Full=ATP-dependent RNA helicase DDX39A; AltName: Full=DEAD 
box protein 39 [Mus musculus]
 gb|AAH20134.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 [Mus musculus]
 dbj|BAE30021.1| unnamed protein product [Mus musculus]
 dbj|BAE37049.1| unnamed protein product [Mus musculus]
 dbj|BAE40052.1| unnamed protein product [Mus musculus]
 dbj|BAE26758.1| unnamed protein product [Mus musculus]
 dbj|BAE27051.1| unnamed protein product [Mus musculus]
 gb|EDL10916.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, isoform CRA_b [Mus 
musculus]
Length=427

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>dbj|BAE23239.1| unnamed protein product [Mus musculus]
Length=427

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>ref|XP_004872546.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X6 [Heterocephalus 
glaber]
Length=501

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  69   QAPPESTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  128

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  129  LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  188

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P++KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  189  PNVKVSVFFGGLSIKKDEDVLKRNCPHVVVGTPGRILALVRNRSLNLKNVKHFVLDE  245



>gb|ACM09195.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACN10290.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
 gb|ACN12648.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
Length=427

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP++ A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APET-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  141  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGTPGRILALIRNKTLNLKNVKHFVLDE  196



>gb|ACN58701.1| ATP-dependent RNA helicase DDX39 [Salmo salar]
Length=422

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP++ A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  17   APET-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  75

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  76   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  135

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  136  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGTPGRILALIRNKTLNLKNVKHFVLDE  191



>ref|XP_004628303.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Octodon degus]
Length=427

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPAESTPALPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQVA LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVAVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P IKV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSIKVSVFFGGLSIKKDEEVLKRNCPHVVVGTPGRILALVRNRTLNLKNVKHFVLDE  196



>ref|XP_006161075.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Tupaia chinensis]
Length=427

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HFILDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRNRSLNLKNVKHFILDE  196



>ref|XP_004748289.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Mustela 
putorius furo]
 ref|XP_004824161.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Mustela 
putorius furo]
Length=495

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 159/201 (79%), Gaps = 0/201 (0%)
 Frame = +1

Query  103  QQMGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPEL  282
            QQ G   E D   E L   E+E+ +AP         +  K  Y+ IHSSGFRDFLLKPEL
Sbjct  64   QQQGHMAEQDVENELLDYEEDEEPQAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPEL  123

Query  283  LRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAA  462
            LRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQIEPV+GQV+ 
Sbjct  124  LRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVSGQVSV  183

Query  463  LVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRI  642
            LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG++I   +++LK  CPH+VVGTPGRI
Sbjct  184  LVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEILKKNCPHVVVGTPGRI  243

Query  643  LALSREKHLSLMNVRHFILDE  705
            LAL R + L+L NV+HF+LDE
Sbjct  244  LALVRNRSLNLKNVKHFVLDE  264



>ref|XP_010744287.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Larimichthys 
crocea]
Length=432

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +1

Query  202  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  381
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  34   IRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  93

Query  382  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  561
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+
Sbjct  94   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPTVKVAVFF  153

Query  562  GGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            GG++I   +++LK +CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  154  GGLSIKKDEEVLKKDCPHIVVGTPGRILALTRNKTLNLRHIKHFILDE  201



>ref|XP_004635679.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Octodon degus]
Length=427

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPAESTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQVA LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVAVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKRNCPHVVVGTPGRILALVRNRTLNLKNVKHFVLDE  196



>dbj|BAE31182.1| unnamed protein product [Mus musculus]
Length=427

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>ref|NP_001133398.1| Spliceosome RNA helicase BAT1 [Salmo salar]
 gb|ACI33160.1| Spliceosome RNA helicase BAT1 [Salmo salar]
Length=428

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +1

Query  202  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  381
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  30   IKKERVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  89

Query  382  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  561
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P IKVAVF+
Sbjct  90   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPTIKVAVFF  149

Query  562  GGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            GG++I   +++LK ECPH+VVGTPGRILAL R K L+L +++HFILDE
Sbjct  150  GGLSIKKDEEVLKKECPHVVVGTPGRILALIRNKTLNLRHIKHFILDE  197



>gb|EGW00654.1| ATP-dependent RNA helicase DDX39 [Cricetulus griseus]
Length=424

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPINGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>dbj|BAE43010.1| unnamed protein product [Mus musculus]
Length=427

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+T+QQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATMQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>ref|XP_004711745.1| PREDICTED: spliceosome RNA helicase DDX39B [Echinops telfairi]
Length=428

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 150/182 (82%), Gaps = 8/182 (4%)
 Frame = +1

Query  184  DSVAAKVNGESA--------KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHEC  339
            D V     GE A        K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHEC
Sbjct  16   DEVETAAGGEGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHEC  75

Query  340  IPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFER  519
            IPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ER
Sbjct  76   IPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYER  135

Query  520  FSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFIL  699
            FS Y+P++KVAVF+GG++I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFIL
Sbjct  136  FSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFIL  195

Query  700  DE  705
            DE
Sbjct  196  DE  197



>ref|XP_003501931.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cricetulus griseus]
 ref|XP_005087613.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Mesocricetus auratus]
 ref|XP_005370974.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Microtus ochrogaster]
 ref|XP_007612805.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cricetulus griseus]
Length=427

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEP+ GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPINGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>ref|XP_003760703.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Sarcophilus harrisii]
Length=427

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  32   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  91

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG+
Sbjct  92   MGKTAVFVLATLQQIEPVDGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGL  151

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +D+LK  CPH+VVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  152  SIKKDEDVLKKNCPHVVVGTPGRILALVRNKSLNLKNVKHFVLDE  196



>dbj|BAG16272.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 transcript variant 
[Homo sapiens]
Length=267

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  220  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  399
            K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGK
Sbjct  35   KGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK  94

Query  400  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  579
            TAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG++I 
Sbjct  95   TAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIK  154

Query  580  IHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
              +++LK  CPH+VVGTPGRILAL R +  SL NV+HF+LDE
Sbjct  155  KDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDE  196



>ref|XP_010871406.1| PREDICTED: spliceosome RNA helicase DDX39B [Esox lucius]
Length=430

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 153/181 (85%), Gaps = 7/181 (4%)
 Frame = +1

Query  184  DSVAAKVNGE--SAKKG-----YIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECI  342
            D+V     G+  S KKG     Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECI
Sbjct  19   DAVGDLAGGDVLSVKKGGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECI  78

Query  343  PQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERF  522
            PQAILGMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERF
Sbjct  79   PQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERF  138

Query  523  STYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILD  702
            S Y+P IKVAVF+GG++I   +++LK ECPH+VVGTPGRILAL R K+L+L +++HFILD
Sbjct  139  SKYMPTIKVAVFFGGLSIKKDEEVLKRECPHVVVGTPGRILALIRNKNLNLRHIKHFILD  198

Query  703  E  705
            E
Sbjct  199  E  199



>ref|XP_006874383.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Chrysochloris asiatica]
Length=427

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV+GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVSGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P++KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PNVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSLNLKNVKHFVLDE  196



>ref|XP_004277466.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Orcinus orca]
 ref|XP_004312321.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Tursiops truncatus]
 ref|XP_007469110.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Lipotes vexillifer]
Length=427

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP   A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESAPTAPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDILCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSLNLKNVKHFVLDE  196



>ref|XP_005381156.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Chinchilla 
lanigera]
 ref|XP_005381157.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Chinchilla 
lanigera]
 ref|XP_005381158.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Chinchilla 
lanigera]
Length=427

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPSENTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKRNCPHVVVGTPGRILALVRNRSLNLKNVKHFVLDE  196



>ref|XP_004060213.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform 2 [Gorilla 
gorilla gorilla]
Length=295

 Score =   267 bits (682),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +1

Query  220  KKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGK  399
            K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGK
Sbjct  35   KGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK  94

Query  400  TAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNIT  579
            TAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG++I 
Sbjct  95   TAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIK  154

Query  580  IHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
              +++LK  CPH+VVGTPGRILAL R +  SL NV+HF+LDE
Sbjct  155  KDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDE  196



>ref|XP_002738626.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Saccoglossus 
kowalevskii]
Length=429

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 141/165 (85%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL MDV+CQAKSG
Sbjct  35   KDVKGNYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILSMDVLCQAKSG  94

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQIEPV GQV+ LVLCHTRELA+QI  E+ERFS Y+P IKV VF+GG+
Sbjct  95   MGKTAVFVLATLQQIEPVDGQVSVLVLCHTRELAFQIAKEYERFSKYMPTIKVGVFFGGI  154

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            NI   +  LKN CPHIVVGTPGR+LAL R K LSL +V+HFILDE
Sbjct  155  NIKKDEQTLKNNCPHIVVGTPGRLLALGRNKTLSLKHVKHFILDE  199



>ref|XP_010611745.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Fukomys 
damarensis]
 ref|XP_010611746.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Fukomys 
damarensis]
 ref|XP_010611747.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Fukomys 
damarensis]
Length=427

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP      +  +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPTLPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEEVLKRNCPHVVVGTPGRILALVRNRSLNLKNVKHFVLDE  196



>ref|NP_957237.1| HLA-B associated transcript 1 [Danio rerio]
 gb|AAH55240.1| HLA-B associated transcript 1 [Danio rerio]
 emb|CAM56334.1| HLA-B associated transcript 1 [Danio rerio]
Length=435

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +1

Query  202  VNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA  381
            +  E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct  37   IRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA  96

Query  382  KSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFY  561
            KSGMGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P +KVAVF+
Sbjct  97   KSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPSVKVAVFF  156

Query  562  GGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            GG++I   +++LK E PH+VVGTPGRILALSR K L+L +++HFILDE
Sbjct  157  GGLSIKKDEEVLKKESPHVVVGTPGRILALSRNKSLNLRHIKHFILDE  204



>ref|XP_001178866.1| PREDICTED: spliceosome RNA helicase DDX39B-like [Strongylocentrotus 
purpuratus]
Length=429

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 156/199 (78%), Gaps = 0/199 (0%)
 Frame = +1

Query  109  MGENKENDAyeeelldyeeedeKAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLR  288
            M +N EN+    +  D E ++       A K   E+  KGY+ IHSSGFRDFLLKPELLR
Sbjct  1    MADNDENEQELLDYEDEEAQETADAGGDAVKQQKETKAKGYVSIHSSGFRDFLLKPELLR  60

Query  289  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALV  468
            AIVD GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ++PV GQV+ LV
Sbjct  61   AIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLDPVDGQVSVLV  120

Query  469  LCHTRELAYQICHEFERFSTYLPDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILA  648
            +CHTRELA+QI  E+ERFS Y+P +KV VF+GG++I   +  +K  CPHIVVGTPGR LA
Sbjct  121  MCHTRELAFQIAKEYERFSKYMPTVKVGVFFGGLSIKKDEQTIKTNCPHIVVGTPGRTLA  180

Query  649  LSREKHLSLMNVRHFILDE  705
            L R+K L+L +V+HFILDE
Sbjct  181  LGRQKILNLKHVKHFILDE  199



>ref|XP_005160298.1| PREDICTED: DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa isoform 
X1 [Danio rerio]
Length=427

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = +1

Query  193  AAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI  372
             A    +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++
Sbjct  26   GATTGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIL  85

Query  373  CQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVA  552
            CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+  +K A
Sbjct  86   CQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMSSVKCA  145

Query  553  VFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            VF+GG++I   +D+LK  CPHIVVGTPGRILALSR K L+L NV+HF+LDE
Sbjct  146  VFFGGMSIKKDEDVLKKNCPHIVVGTPGRILALSRNKTLTLKNVKHFVLDE  196



>gb|AAL98920.1| Bat1 [Rattus norvegicus]
Length=428

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_006904735.1| PREDICTED: spliceosome RNA helicase DDX39B [Pteropus alecto]
Length=428

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_005802856.1| PREDICTED: ATP-dependent RNA helicase DDX39A-like [Xiphophorus 
maculatus]
 ref|XP_008413616.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Poecilia reticulata]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S A     +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            ++K AVF+GG+ I   +D LK  CPHIVVGTPGR LAL R K LSL NV+HF+LDE
Sbjct  141  NVKCAVFFGGLAIKKDEDTLKKNCPHIVVGTPGRTLALIRNKTLSLKNVKHFVLDE  196



>gb|EPY85364.1| v-type proton ATPase subunit G 2 isoform 1 [Camelus ferus]
Length=414

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>emb|CDQ82873.1| unnamed protein product [Oncorhynchus mykiss]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP++ A     +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APET-ATPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +D LK  CPHIVVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  141  TVKAAVFFGGLSIKKDEDALKKNCPHIVVGTPGRILALIRNKTLNLKNVKHFVLDE  196



>ref|XP_004748290.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Mustela 
putorius furo]
 ref|XP_004824162.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X3 [Mustela 
putorius furo]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 148/177 (84%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPPESTPAPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV+GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVSGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +++LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEEILKKNCPHVVVGTPGRILALVRNRSLNLKNVKHFVLDE  196



>gb|ELK18937.1| Spliceosome RNA helicase BAT1 [Pteropus alecto]
Length=426

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_006178881.1| PREDICTED: spliceosome RNA helicase DDX39B [Camelus ferus]
Length=426

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_010599849.1| PREDICTED: spliceosome RNA helicase DDX39B [Loxodonta africana]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_008992391.1| PREDICTED: LOW QUALITY PROTEIN: spliceosome RNA helicase DDX39B 
[Callithrix jacchus]
Length=422

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>dbj|BAE39902.1| unnamed protein product [Mus musculus]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = +1

Query  175  KAPDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI  354
            +AP         +  K  Y+ IHSSGFRDF+LKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct  20   QAPQESTPAPPKKDVKGSYVSIHSSGFRDFVLKPELLRAIVDCGFEHPSEVQHECIPQAI  79

Query  355  LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYL  534
            LGMDV+CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+
Sbjct  80   LGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVSVLVMCHTRELAFQISKEYERFSKYM  139

Query  535  PDIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            P +KV+VF+GG++I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  140  PSVKVSVFFGGLSIKKDEDVLKKNCPHVVVGTPGRILALVRSRSLNLRNVKHFVLDE  196



>ref|NP_062667.1| spliceosome RNA helicase Ddx39b [Mus musculus]
 ref|NP_579834.2| spliceosome RNA helicase Ddx39b [Rattus norvegicus]
 ref|NP_001239386.1| spliceosome RNA helicase Ddx39b [Mus musculus]
 sp|Q9Z1N5.1|DX39B_MOUSE RecName: Full=Spliceosome RNA helicase Ddx39b; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56; AltName: Full=HLA-B-associated transcript 1 protein 
[Mus musculus]
 sp|Q63413.3|DX39B_RAT RecName: Full=Spliceosome RNA helicase Ddx39b; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=ATP-dependent 
RNA helicase p47; AltName: Full=DEAD box protein Uap56 [Rattus 
norvegicus]
 gb|AAD30177.1|AC007080_3 BAT1 [Mus musculus]
 gb|AAD13115.1| nuclear RNA helicase Bat1 [Mus musculus]
 gb|AAH11067.1| HLA-B-associated transcript 1A [Mus musculus]
 emb|CAC85694.1| putative RNA helicase [Rattus norvegicus]
 gb|AAH24859.1| HLA-B-associated transcript 1A [Mus musculus]
 dbj|BAC34505.1| unnamed protein product [Mus musculus]
 dbj|BAC40624.1| unnamed protein product [Mus musculus]
 gb|AAP91685.1| HLA-B associated transcript 1 [Mus musculus]
 gb|AAP91686.1| HLA-B associated transcript 1 [Mus musculus]
 gb|AAH80243.1| HLA-B associated transcript 1 [Rattus norvegicus]
 gb|EDL83554.1| HLA-B-associated transcript 1A, isoform CRA_a [Rattus norvegicus]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>emb|CDQ66513.1| unnamed protein product [Oncorhynchus mykiss]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP++       E  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct  22   APETTTPAGKKE-VKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG++I   +D+LK  CPHIVVGTPGRILAL R K L+L NV+HF+LDE
Sbjct  141  TVKAAVFFGGLSIKKDEDVLKKNCPHIVVGTPGRILALIRNKTLNLKNVKHFVLDE  196



>ref|XP_006875676.1| PREDICTED: spliceosome RNA helicase DDX39B [Chrysochloris asiatica]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_003985959.1| PREDICTED: spliceosome RNA helicase DDX39B [Felis catus]
 ref|XP_004415273.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004598780.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Ochotona 
princeps]
 ref|XP_004598781.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Ochotona 
princeps]
 ref|XP_011215034.1| PREDICTED: spliceosome RNA helicase DDX39B [Ailuropoda melanoleuca]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>gb|EFB18180.1| hypothetical protein PANDA_020423 [Ailuropoda melanoleuca]
Length=425

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|NP_004631.1| spliceosome RNA helicase DDX39B [Homo sapiens]
 ref|NP_542165.1| spliceosome RNA helicase DDX39B [Homo sapiens]
 ref|NP_001005157.1| spliceosome RNA helicase DDX39B [Sus scrofa]
 ref|NP_001040608.1| spliceosome RNA helicase DDX39B [Macaca mulatta]
 ref|NP_001107635.1| spliceosome RNA helicase DDX39B [Pan troglodytes]
 ref|XP_003768951.1| PREDICTED: spliceosome RNA helicase DDX39B [Sarcophilus harrisii]
 ref|XP_003831638.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Pan paniscus]
 ref|XP_003831639.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Pan paniscus]
 ref|XP_003897379.1| PREDICTED: spliceosome RNA helicase DDX39B [Papio anubis]
 ref|XP_004043682.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004043683.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004286665.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Orcinus 
orca]
 ref|XP_004311275.1| PREDICTED: spliceosome RNA helicase DDX39B [Tursiops truncatus]
 ref|XP_004390786.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 1 [Trichechus 
manatus latirostris]
 ref|XP_004424435.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004424436.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004695169.1| PREDICTED: spliceosome RNA helicase DDX39B [Condylura cristata]
 ref|XP_005603751.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Equus 
caballus]
 ref|XP_005603752.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Equus 
caballus]
 ref|XP_005665850.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Sus scrofa]
 ref|XP_005665851.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Sus scrofa]
 ref|XP_005859958.1| PREDICTED: spliceosome RNA helicase DDX39B [Myotis brandtii]
 ref|XP_006215372.1| PREDICTED: spliceosome RNA helicase DDX39B [Vicugna pacos]
 ref|XP_006772872.1| PREDICTED: spliceosome RNA helicase DDX39B [Myotis davidii]
 ref|XP_007110223.1| PREDICTED: spliceosome RNA helicase DDX39B [Physeter catodon]
 ref|XP_007194044.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007194045.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007459649.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Lipotes 
vexillifer]
 ref|XP_007483596.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Monodelphis 
domestica]
 ref|XP_007483597.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Monodelphis 
domestica]
 ref|XP_007949568.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Orycteropus 
afer afer]
 ref|XP_007949569.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Orycteropus 
afer afer]
 ref|XP_007971329.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_008155589.1| PREDICTED: spliceosome RNA helicase DDX39B [Eptesicus fuscus]
 ref|XP_008155590.1| PREDICTED: spliceosome RNA helicase DDX39B [Eptesicus fuscus]
 ref|XP_008588878.1| PREDICTED: spliceosome RNA helicase DDX39B [Galeopterus variegatus]
 ref|XP_008819773.1| PREDICTED: spliceosome RNA helicase DDX39B [Nannospalax galili]
 ref|XP_008955197.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Pan paniscus]
 ref|XP_009239917.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239918.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239919.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239921.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_009239922.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Pongo 
abelii]
 ref|XP_010361040.1| PREDICTED: spliceosome RNA helicase DDX39B [Rhinopithecus roxellana]
 ref|XP_010361041.1| PREDICTED: spliceosome RNA helicase DDX39B [Rhinopithecus roxellana]
 ref|XP_010959841.1| PREDICTED: spliceosome RNA helicase DDX39B [Camelus bactrianus]
 sp|Q13838.1|DX39B_HUMAN RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=ATP-dependent 
RNA helicase p47; AltName: Full=DEAD box protein UAP56; AltName: 
Full=HLA-B-associated transcript 1 protein [Homo sapiens]
 sp|P60024.1|DX39B_PANTR RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Pan troglodytes]
 sp|Q29024.2|DX39B_PIG RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Sus scrofa]
 sp|Q5RE47.1|DX39B_PONAB RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Pongo abelii]
 sp|Q5TM17.1|DX39B_MACMU RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Macaca mulatta]
 emb|CAA85523.1| nuclear RNA helicase (DEAD family) [Homo sapiens]
 emb|CAB63856.1| putative RNA helicase [Sus scrofa]
 gb|AAH00361.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAB63306.1| putative ATP-dependent RNA helicase [Homo sapiens]
 gb|AAH13006.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAB83886.1| BAT1 [Pan troglodytes]
 dbj|BAC54953.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAC78161.1| ATP-dependent RNA helicase [Pan troglodytes]
 gb|AAP88911.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAD69728.1| HLA-B associated transcript-1 [Macaca mulatta]
 emb|CAH89960.1| hypothetical protein [Pongo abelii]
 gb|AAX42257.1| HLA-B associated transcript 1 [synthetic construct]
 gb|AAX42258.1| HLA-B associated transcript 1 [synthetic construct]
 dbj|BAE78637.1| HLA-B associated transcript 1 [Homo sapiens]
 dbj|BAE91387.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE92779.1| nuclear RNA helicase [Pan troglodytes]
 dbj|BAE92782.1| nuclear RNA helicase [Pan troglodytes]
 gb|EAX03404.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03407.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03408.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03409.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03410.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03411.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|EAX03413.1| hCG2005638, isoform CRA_a [Homo sapiens]
 gb|ABM82807.1| HLA-B associated transcript 1 [synthetic construct]
 gb|ABM85993.1| HLA-B associated transcript 1 [synthetic construct]
 gb|ABX82809.1| HLA-B-associated protein 1 [Sus scrofa]
 dbj|BAI46469.1| HLA-B associated transcript 1 [synthetic construct]
 dbj|BAI49420.1| HLA-B associated transcript 1 [Microcebus murinus]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_006154309.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Tupaia 
chinensis]
 ref|XP_006154310.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Tupaia 
chinensis]
 ref|XP_006154311.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X3 [Tupaia 
chinensis]
 gb|ELW61840.1| Spliceosome RNA helicase DDX39B [Tupaia chinensis]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>dbj|BAD96632.1| HLA-B associated transcript 1 variant [Homo sapiens]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_008328948.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Cynoglossus semilaevis]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = +1

Query  178  APDSVAAKVNGESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL  357
            AP+S AA    +  K  Y+ IHSSGFRDFLLKPELLRAI+D GFEHPSEVQHECIPQAIL
Sbjct  22   APES-AAPAGKKEVKGSYVSIHSSGFRDFLLKPELLRAIIDCGFEHPSEVQHECIPQAIL  80

Query  358  GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLP  537
            GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P
Sbjct  81   GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVLVMCHTRELAFQISKEYERFSKYMP  140

Query  538  DIKVAVFYGGVNITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
             +K AVF+GG+ I   +++L+  CPHIVVGTPGRILAL R K LSL NV+HF+LDE
Sbjct  141  TVKAAVFFGGLAIKNDEEVLRKNCPHIVVGTPGRILALIRSKTLSLKNVKHFVLDE  196



>ref|XP_006738543.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Leptonychotes 
weddellii]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_004621320.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X1 [Sorex 
araneus]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>gb|AAA41787.1| liver nuclear protein p47 [Rattus norvegicus]
Length=399

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_004442630.1| PREDICTED: ATP-dependent RNA helicase DDX39A [Ceratotherium simum 
simum]
Length=427

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  32   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  91

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQIEPV GQV  LV+CHTRELA+QI  E+ERFS Y+P +KV+VF+GG+
Sbjct  92   MGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGL  151

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +D+LK  CPH+VVGTPGRILAL R + L+L NV+HF+LDE
Sbjct  152  SIKKDEDVLKKSCPHVVVGTPGRILALVRNRSLNLRNVKHFVLDE  196



>gb|AAP36788.1| Homo sapiens HLA-B associated transcript 1 [synthetic construct]
 gb|AAX29702.1| HLA-B associated transcript 1, partial [synthetic construct]
 gb|AAX29703.1| HLA-B associated transcript 1, partial [synthetic construct]
Length=429

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|NP_001014399.1| spliceosome RNA helicase DDX39B [Canis lupus familiaris]
 sp|Q5WR10.1|DX39B_CANFA RecName: Full=Spliceosome RNA helicase DDX39B; AltName: Full=56 
kDa U2AF65-associated protein; AltName: Full=DEAD box protein 
UAP56 [Canis lupus familiaris]
 gb|AAR27886.1| BAT1 [Canis lupus familiaris]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



>ref|XP_006896266.1| PREDICTED: spliceosome RNA helicase DDX39B [Elephantulus edwardii]
Length=428

 Score =   271 bits (692),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 146/165 (88%), Gaps = 0/165 (0%)
 Frame = +1

Query  211  ESAKKGYIGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG  390
            +  K  Y+ IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct  33   KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG  92

Query  391  MGKTAVFVLSTLQQIEPVAGQVAALVLCHTRELAYQICHEFERFSTYLPDIKVAVFYGGV  570
            MGKTAVFVL+TLQQ+EPV GQV+ LV+CHTRELA+QI  E+ERFS Y+P++KVAVF+GG+
Sbjct  93   MGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGL  152

Query  571  NITIHKDLLKNECPHIVVGTPGRILALSREKHLSLMNVRHFILDE  705
            +I   +++LK  CPHIVVGTPGRILAL+R K L+L +++HFILDE
Sbjct  153  SIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDE  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350