BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032P15

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004233034.1|  PREDICTED: U-box domain-containing protein 17      103   1e-21   Solanum lycopersicum
ref|XP_009620922.1|  PREDICTED: U-box domain-containing protein 17    99.0    5e-20   Nicotiana tomentosiformis
gb|AAP03882.1|  Avr9/Cf-9 rapidly elicited protein 276                97.8    1e-19   Nicotiana tabacum [American tobacco]
ref|XP_009778431.1|  PREDICTED: U-box domain-containing protein 17    97.8    1e-19   Nicotiana sylvestris
ref|NP_001275105.1|  ACRE 276-like protein                            89.0    1e-16   Solanum tuberosum [potatoes]
gb|KJB66866.1|  hypothetical protein B456_010G161700                  78.2    4e-13   Gossypium raimondii
gb|KJB66867.1|  hypothetical protein B456_010G161700                  78.2    4e-13   Gossypium raimondii
gb|KJB66865.1|  hypothetical protein B456_010G161700                  78.2    4e-13   Gossypium raimondii
ref|XP_002522266.1|  ubiquitin-protein ligase, putative               77.8    6e-13   Ricinus communis
gb|KDP21142.1|  hypothetical protein JCGZ_21613                       77.0    1e-12   Jatropha curcas
ref|XP_007025299.1|  Plant U-box 17                                   77.0    1e-12   
ref|XP_010242129.1|  PREDICTED: U-box domain-containing protein 17    76.6    1e-12   Nelumbo nucifera [Indian lotus]
ref|XP_002305723.2|  armadillo/beta-catenin repeat family protein     76.3    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011010906.1|  PREDICTED: U-box domain-containing protein 1...  75.9    2e-12   Populus euphratica
ref|XP_002317390.2|  armadillo/beta-catenin repeat family protein     75.5    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011039380.1|  PREDICTED: U-box domain-containing protein 17    75.5    4e-12   Populus euphratica
ref|XP_004293976.1|  PREDICTED: U-box domain-containing protein 17    75.1    4e-12   Fragaria vesca subsp. vesca
ref|XP_009351680.1|  PREDICTED: U-box domain-containing protein 1...  74.7    5e-12   Pyrus x bretschneideri [bai li]
emb|CDO96867.1|  unnamed protein product                              74.7    5e-12   Coffea canephora [robusta coffee]
ref|XP_008371510.1|  PREDICTED: U-box domain-containing protein 1...  74.7    5e-12   
ref|XP_010655547.1|  PREDICTED: U-box domain-containing protein 17    73.2    2e-11   
ref|XP_011101440.1|  PREDICTED: U-box domain-containing protein 1...  73.2    2e-11   Sesamum indicum [beniseed]
ref|XP_003524977.1|  PREDICTED: U-box domain-containing protein 1...  72.0    4e-11   Glycine max [soybeans]
ref|XP_010665507.1|  PREDICTED: U-box domain-containing protein 17    71.6    6e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB34910.1|  hypothetical protein B456_006G089900                  68.2    8e-10   Gossypium raimondii
gb|EYU43305.1|  hypothetical protein MIMGU_mgv1a002121mg              67.8    8e-10   Erythranthe guttata [common monkey flower]
ref|XP_006449554.1|  hypothetical protein CICLE_v10014430mg           67.4    1e-09   Citrus clementina [clementine]
emb|CDY48332.1|  BnaA09g26890D                                        67.4    1e-09   Brassica napus [oilseed rape]
emb|CBI30726.3|  unnamed protein product                              67.0    2e-09   Vitis vinifera
ref|XP_011085318.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  66.6    2e-09   Sesamum indicum [beniseed]
ref|XP_009352721.1|  PREDICTED: U-box domain-containing protein 1...  65.9    4e-09   Pyrus x bretschneideri [bai li]
ref|XP_006467604.1|  PREDICTED: U-box domain-containing protein 1...  65.5    5e-09   Citrus sinensis [apfelsine]
ref|XP_009115249.1|  PREDICTED: U-box domain-containing protein 1...  65.5    5e-09   Brassica rapa
ref|XP_008383598.1|  PREDICTED: U-box domain-containing protein 1...  64.3    1e-08   
gb|KJB69676.1|  hypothetical protein B456_011G036500                  64.3    1e-08   Gossypium raimondii
ref|XP_008225235.1|  PREDICTED: U-box domain-containing protein 17    63.9    2e-08   Prunus mume [ume]
ref|XP_007213625.1|  hypothetical protein PRUPE_ppa002108mg           63.9    2e-08   Prunus persica
ref|XP_010248377.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_003531268.1|  PREDICTED: U-box domain-containing protein 1...  62.8    3e-08   Glycine max [soybeans]
gb|KHN47392.1|  U-box domain-containing protein 17                    62.8    5e-08   Glycine soja [wild soybean]
ref|XP_003542975.1|  PREDICTED: U-box domain-containing protein 1...  62.4    5e-08   Glycine max [soybeans]
ref|XP_010106623.1|  U-box domain-containing protein 17               62.4    5e-08   Morus notabilis
emb|CDY43332.1|  BnaC03g59040D                                        62.0    7e-08   Brassica napus [oilseed rape]
ref|XP_009109670.1|  PREDICTED: U-box domain-containing protein 17    61.2    1e-07   Brassica rapa
ref|XP_010052161.1|  PREDICTED: U-box domain-containing protein 17    60.1    3e-07   Eucalyptus grandis [rose gum]
emb|CDX90186.1|  BnaA08g17980D                                        59.7    5e-07   
emb|CDX99816.1|  BnaC05g22380D                                        58.2    1e-06   
gb|KHN28641.1|  U-box domain-containing protein 17                    57.8    2e-06   Glycine soja [wild soybean]
gb|EYU28122.1|  hypothetical protein MIMGU_mgv1a027038mg              57.8    2e-06   Erythranthe guttata [common monkey flower]
gb|ACJ85851.1|  unknown                                               57.4    2e-06   Medicago truncatula
ref|XP_003593822.1|  U-box domain-containing protein                  57.4    2e-06   
gb|AES64073.2|  plant U-box protein                                   57.4    2e-06   Medicago truncatula
ref|XP_004161195.1|  PREDICTED: U-box domain-containing protein 1...  57.4    2e-06   
ref|XP_003546044.1|  PREDICTED: U-box domain-containing protein 1...  57.4    3e-06   Glycine max [soybeans]
ref|XP_004147388.1|  PREDICTED: U-box domain-containing protein 1...  57.4    3e-06   Cucumis sativus [cucumbers]
ref|XP_008443533.1|  PREDICTED: U-box domain-containing protein 17    57.0    4e-06   Cucumis melo [Oriental melon]
ref|XP_004485933.1|  PREDICTED: U-box domain-containing protein 1...  56.2    6e-06   Cicer arietinum [garbanzo]
ref|XP_006306891.1|  hypothetical protein CARUB_v10008444mg           56.2    6e-06   Capsella rubella
gb|KFK36322.1|  hypothetical protein AALP_AA4G107600                  55.1    1e-05   Arabis alpina [alpine rockcress]
ref|XP_007159489.1|  hypothetical protein PHAVU_002G241800g           55.1    1e-05   Phaseolus vulgaris [French bean]
ref|XP_010499451.1|  PREDICTED: U-box domain-containing protein 17    53.9    4e-05   Camelina sativa [gold-of-pleasure]
gb|AAB97738.1|  arm repeat containing protein                         53.5    5e-05   Brassica napus [oilseed rape]
ref|XP_010460713.1|  PREDICTED: U-box domain-containing protein 17    52.8    8e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010549429.1|  PREDICTED: U-box domain-containing protein 17    52.8    8e-05   Tarenaya hassleriana [spider flower]
dbj|BAJ34586.1|  unnamed protein product                              52.8    9e-05   Eutrema halophilum
ref|XP_006415583.1|  hypothetical protein EUTSA_v10006853mg           52.8    9e-05   
ref|XP_010509777.1|  PREDICTED: U-box domain-containing protein 1...  52.4    1e-04   Camelina sativa [gold-of-pleasure]
gb|KFK44763.1|  hypothetical protein AALP_AA1G299800                  52.4    1e-04   Arabis alpina [alpine rockcress]
gb|ABY58019.1|  arm repeat containing protein 1                       51.6    2e-04   Brassica oleracea var. viridis [collards]
ref|XP_010413765.1|  PREDICTED: U-box domain-containing protein 1...  50.8    4e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010478295.1|  PREDICTED: U-box domain-containing protein 1...  50.4    5e-04   Camelina sativa [gold-of-pleasure]
emb|CDX94661.1|  BnaC07g09970D                                        50.4    5e-04   
ref|XP_007147997.1|  hypothetical protein PHAVU_006G171900g           50.1    8e-04   Phaseolus vulgaris [French bean]
emb|CDY37666.1|  BnaA04g20020D                                        49.7    0.001   Brassica napus [oilseed rape]



>ref|XP_004233034.1| PREDICTED: U-box domain-containing protein 17 [Solanum lycopersicum]
Length=724

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 1/115 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRR+RSP+LEAFLAP+DLTD  L++TL AL++ELIS++SGK  P YQRKN 
Sbjct  1    MASAAIFSSLRRQRSPTLEAFLAPVDLTDVGLLQTLTALSSELISAYSGKRLPFYQRKNC  60

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            KSLLRKIQ+FSV +ECL EN+  + SS SS  P TAFLCFKELYLLLYRSKILLD
Sbjct  61   KSLLRKIQVFSVLLECLLENK-KNRSSGSSDLPFTAFLCFKELYLLLYRSKILLD  114



>ref|XP_009620922.1| PREDICTED: U-box domain-containing protein 17 [Nicotiana tomentosiformis]
Length=726

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRR+RSPSLEAFLAP+DLT+  L++TL AL++ELISSFSGK  P YQ+KN 
Sbjct  1    MASAAIFSSLRRQRSPSLEAFLAPVDLTEVGLLQTLTALSSELISSFSGKRVPFYQQKNC  60

Query  501  KSLLRKIQIFSVAMECLREN--RGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            KSLLRKIQ FSV +ECL EN     S    SS  P TAFLCFKELYLLLYRSKILLD
Sbjct  61   KSLLRKIQAFSVLLECLVENSDNNRSGRRGSSDLPFTAFLCFKELYLLLYRSKILLD  117



>gb|AAP03882.1| Avr9/Cf-9 rapidly elicited protein 276 [Nicotiana tabacum]
Length=726

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRR+RSPSLEAFLAP+DLT+  L++TL AL++ELISSFSGK  P YQ+KN 
Sbjct  1    MASAAIFSSLRRQRSPSLEAFLAPVDLTEVGLLQTLTALSSELISSFSGKRVPFYQQKNC  60

Query  501  KSLLRKIQIFSVAMECLREN--RGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            KSLLRKIQ FSV ++CL EN     S    SS  P TAFLCFKELYLLLYRSKILLD
Sbjct  61   KSLLRKIQAFSVLLDCLVENSDNNRSGRGGSSDLPFTAFLCFKELYLLLYRSKILLD  117



>ref|XP_009778431.1| PREDICTED: U-box domain-containing protein 17 [Nicotiana sylvestris]
Length=726

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRR+RSPSLEAFLAP+DLT+  L++TL AL++ELISSFSGK  P YQ+KN 
Sbjct  1    MASAAIFSSLRRQRSPSLEAFLAPVDLTEVGLLQTLTALSSELISSFSGKRVPFYQQKNC  60

Query  501  KSLLRKIQIFSVAMECLREN--RGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            KSLLRKIQ FSV ++CL EN     S    SS  P TAFLCFKELYLLLYRSKILLD
Sbjct  61   KSLLRKIQAFSVLLDCLVENSDNNRSGRGGSSDLPFTAFLCFKELYLLLYRSKILLD  117



>ref|NP_001275105.1| ACRE 276-like protein [Solanum tuberosum]
 gb|ABK96801.1| ACRE 276-like protein [Solanum tuberosum]
Length=724

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 94/120 (78%), Gaps = 11/120 (9%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRR+RSP+LEAFLAP+DLTD  L++TL AL++ELIS++SGK+ P YQRKN 
Sbjct  1    MASAAIFSSLRRQRSPTLEAFLAPVDLTDVGLLQTLTALSSELISAYSGKKLPFYQRKNC  60

Query  501  KSLLRKIQIFSV-----AMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            KSLLRKIQ+FSV         L  +RGSS        P TAFLCFKELYLLLYRSKILLD
Sbjct  61   KSLLRKIQVFSVLLECLLENNLNRSRGSSD------LPFTAFLCFKELYLLLYRSKILLD  114



>gb|KJB66866.1| hypothetical protein B456_010G161700 [Gossypium raimondii]
Length=665

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAY-QRKN  497
            MA+AAIFSSLRRRRSPSLEAFLAP+DLT  AL++TLAA+++ELIS FS K  P + QR+N
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLTQVALLQTLAAVSSELISCFSDK--PFFFQRRN  58

Query  498  SKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            S+SL+RKI+IF V +E LR++     S S    PSTA LCFKELYLLLYRSKILLD
Sbjct  59   SRSLIRKIEIFLVMLEYLRDS----GSRSMPNLPSTAILCFKELYLLLYRSKILLD  110



>gb|KJB66867.1| hypothetical protein B456_010G161700 [Gossypium raimondii]
Length=716

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAY-QRKN  497
            MA+AAIFSSLRRRRSPSLEAFLAP+DLT  AL++TLAA+++ELIS FS K  P + QR+N
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLTQVALLQTLAAVSSELISCFSDK--PFFFQRRN  58

Query  498  SKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            S+SL+RKI+IF V +E LR++     S S    PSTA LCFKELYLLLYRSKILLD
Sbjct  59   SRSLIRKIEIFLVMLEYLRDS----GSRSMPNLPSTAILCFKELYLLLYRSKILLD  110



>gb|KJB66865.1| hypothetical protein B456_010G161700 [Gossypium raimondii]
Length=720

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 7/116 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAY-QRKN  497
            MA+AAIFSSLRRRRSPSLEAFLAP+DLT  AL++TLAA+++ELIS FS K  P + QR+N
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLTQVALLQTLAAVSSELISCFSDK--PFFFQRRN  58

Query  498  SKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            S+SL+RKI+IF V +E LR++     S S    PSTA LCFKELYLLLYRSKILLD
Sbjct  59   SRSLIRKIEIFLVMLEYLRDS----GSRSMPNLPSTAILCFKELYLLLYRSKILLD  110



>ref|XP_002522266.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF40124.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=719

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 92/115 (80%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DLTD ALV+TL +++TEL++ FSGK    +QRKNS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLTDVALVQTLVSVSTELVACFSGKS-MFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+ F V +E L E+       SS++  ST  +CFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIEFFVVLLEYLTES----GIGSSTKLSSTGIVCFKELYLLLYRSKILLD  110



>gb|KDP21142.1| hypothetical protein JCGZ_21613 [Jatropha curcas]
Length=717

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 95/115 (83%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DLTD ALV+TLA+++TEL+S +SGK  P +QRKNS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLTDVALVQTLASVSTELVSCYSGKSFP-FQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI++F V +E L      + S S S+  STA +CFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIELFVVLLEYL------TGSGSGSKLSSTAVVCFKELYLLLYRSKILLD  108



>ref|XP_007025299.1| Plant U-box 17 [Theobroma cacao]
 gb|EOY27921.1| Plant U-box 17 [Theobroma cacao]
Length=719

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DLT+  LV+TLAA+++EL+SSFS      +QR+NS
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLTEVTLVQTLAAISSELVSSFSNNVF-FFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V +E LR++     S S S  PSTA LCFKELYLLLYRSKI+LD
Sbjct  60   RSLVRKIEIFVVFLEYLRDS----GSGSMSSLPSTAILCFKELYLLLYRSKIVLD  110



>ref|XP_010242129.1| PREDICTED: U-box domain-containing protein 17 [Nelumbo nucifera]
Length=717

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 89/115 (77%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRR+PS EAFLAP+ L+D ALV+TL+ +A ELISSFS +  P +QRKNS
Sbjct  1    MASAAIFSSLRRRRTPSSEAFLAPVQLSDVALVQTLSVVANELISSFSHRALP-FQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL++KI++F V  + LR++         S  PSTA LC KELYLL+YRSKILLD
Sbjct  60   RSLIQKIEVFVVLFDFLRDS--------GSTLPSTAVLCLKELYLLIYRSKILLD  106



>ref|XP_002305723.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE86234.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=717

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLE FLAP+D TD  LV+TL +L+TEL+SSFSGK    +QRKNS
Sbjct  1    MATAAIFSSLRRRRSPSLEVFLAPVDFTDVGLVQTLVSLSTELVSSFSGKS-LFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V +E LR++   S+        S  F CFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIEIFVVLLEYLRDSGAGSA------LSSPTFACFKELYLLLYRSKILLD  108



>ref|XP_011010906.1| PREDICTED: U-box domain-containing protein 17-like [Populus euphratica]
Length=717

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLE FLAP+D TD  LV+TL +L+TEL+SSFSGK    +QRKNS
Sbjct  1    MATAAIFSSLRRRRSPSLEVFLAPVDFTDVGLVQTLVSLSTELVSSFSGKS-LFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V +E LR++         S   S  F CFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIEIFVVLLEYLRDS------GVGSALSSPTFACFKELYLLLYRSKILLD  108



>ref|XP_002317390.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE98002.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=717

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DLTD ALV+TL +++TEL+S FSGK    +QRKNS
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLTDVALVQTLVSVSTELVSCFSGKS-LFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI++F V +E LR++   S+ S     P T  +CFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIEVFVVLLEYLRDSGAGSALS-----PPT-IVCFKELYLLLYRSKILLD  108



>ref|XP_011039380.1| PREDICTED: U-box domain-containing protein 17 [Populus euphratica]
 ref|XP_011039381.1| PREDICTED: U-box domain-containing protein 17 [Populus euphratica]
 ref|XP_011039382.1| PREDICTED: U-box domain-containing protein 17 [Populus euphratica]
Length=717

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 93/115 (81%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DLTD ALV+TL +++TEL+S FSGK    +QRKNS
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLTDVALVQTLVSVSTELVSCFSGKS-LFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI++F V +E LR++   S+ S     P T  +CFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIEVFVVLLEYLRDSGAGSALS-----PPT-IVCFKELYLLLYRSKILLD  108



>ref|XP_004293976.1| PREDICTED: U-box domain-containing protein 17 [Fragaria vesca 
subsp. vesca]
Length=722

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 91/115 (79%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+D ALV+TL ++  E++SSFS K    +QR+NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSDVALVQTLVSVTAEIVSSFSDKL-FYFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F V ++CL ++   SS+      P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEVFLVLLDCLNDSSAGSSA-----LPWTAVICLKELYLLLYRSKILLD  109



>ref|XP_009351680.1| PREDICTED: U-box domain-containing protein 17-like [Pyrus x bretschneideri]
Length=717

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSS+RRRRSPSLEAFLAP+DL+D ALV+TL ++A +++SSFS K   + QR+NS
Sbjct  1    MASAAIFSSMRRRRSPSLEAFLAPVDLSDVALVQTLVSVAADIVSSFSDK-FLSIQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +E LR++  +         P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVLLEYLRDSDAA--------LPCTAVICLKELYLLLYRSKILLD  106



>emb|CDO96867.1| unnamed protein product [Coffea canephora]
Length=721

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 91/116 (78%), Gaps = 5/116 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFS-GKEGPAYQRKN  497
            MASAA+FSSLRRRR+PSLEA LAP++L++  L+  L  +++ELIS+FS   +  ++QRKN
Sbjct  1    MASAAVFSSLRRRRTPSLEALLAPVELSEEKLLVILTGISSELISTFSLNNKTMSFQRKN  60

Query  498  SKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            S++L+RKI++F+V +ECL ++    SS      PSTA LCFKELYL+LYRSKILL+
Sbjct  61   SRNLVRKIEVFAVLLECLMDSTSGISSI----LPSTAVLCFKELYLVLYRSKILLE  112



>ref|XP_008371510.1| PREDICTED: U-box domain-containing protein 17-like [Malus domestica]
Length=719

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSS+RRRRSPSLEAFLAP+DL+D ALV+TL ++A +++SSFS K   + QR+NS
Sbjct  1    MASAAIFSSMRRRRSPSLEAFLAPVDLSDVALVQTLVSVAADIVSSFSDK-FLSIQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +E LR++  +         P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVLLEYLRDSDAA--------LPCTAVICLKELYLLLYRSKILLD  106



>ref|XP_010655547.1| PREDICTED: U-box domain-containing protein 17 [Vitis vinifera]
Length=714

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 87/115 (76%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAI SSLRRRRSPSLEAFLAP+DL + ALV TLA ++ ELI +FS +  P +QRKNS
Sbjct  1    MASAAIVSSLRRRRSPSLEAFLAPVDLNEVALVRTLATISMELIFAFSDRPWP-FQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI++F V +E LR+         +   PS A LCFKELYLLLYRSKILLD
Sbjct  60   RSLIRKIEVFLVLLEFLRD--------CNLSLPSAAVLCFKELYLLLYRSKILLD  106



>ref|XP_011101440.1| PREDICTED: U-box domain-containing protein 17 isoform X1 [Sesamum 
indicum]
Length=719

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%), Gaps = 9/117 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEG--PAYQRK  494
            MASAAIFSSL RRRSP+LEAFLAP+DL + AL++TL A++ +L+ SFSGK+   P +Q K
Sbjct  1    MASAAIFSSLMRRRSPTLEAFLAPVDLPNAALLDTLRAISMDLLLSFSGKDKTPPYFQVK  60

Query  495  NSKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            NS+SL+RKIQ+ S+ ++  R+          S+  +T FLCFKELYLLLYRSKIL+D
Sbjct  61   NSRSLIRKIQVISLLLDAFRD-------LGFSKISTTVFLCFKELYLLLYRSKILID  110



>ref|XP_003524977.1| PREDICTED: U-box domain-containing protein 17-like [Glycine max]
Length=715

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 87/115 (76%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFL P+DL+D AL+ETL ++A+++ S FSG   P +QR+NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLVPVDLSDVALLETLISVASDVASCFSGHRFP-FQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            ++L+ K++IF   +ECLR++  + +         TA LC KE YLLLYRSKILLD
Sbjct  60   RALIGKVEIFRSMLECLRDSAAAGA------LTPTAVLCLKEFYLLLYRSKILLD  108



>ref|XP_010665507.1| PREDICTED: U-box domain-containing protein 17 [Beta vulgaris 
subsp. vulgaris]
Length=718

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 85/115 (74%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AA FSSLRRRRSP LEAFLAP+DLTD  +V TL ++A EL+   SGK+ P +QRKN 
Sbjct  1    MATAAAFSSLRRRRSPPLEAFLAPVDLTDGGIVRTLLSVANELVELHSGKKLP-FQRKNF  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
             SL+RKI++F V ++ L+E R      S SRF  TA +CFKEL+LL YR KILLD
Sbjct  60   TSLVRKIEVFVVLLDFLKEFR------SCSRFSYTAIMCFKELHLLFYRCKILLD  108



>gb|KJB34910.1| hypothetical protein B456_006G089900 [Gossypium raimondii]
Length=711

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 91/115 (79%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSS+RRRRSPS+EAFLAP+DL++ ALV+TL A+++EL+S  S K    +QR+NS
Sbjct  1    MATAAIFSSMRRRRSPSVEAFLAPVDLSEVALVQTLVAISSELVSCVSDKVF-FFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            + L+RKI++  V +E ++++   S S+     PSTA LCFKELYLLLYRSKILLD
Sbjct  60   RCLIRKIEVLVVLLEYVKDSESGSMST----LPSTAILCFKELYLLLYRSKILLD  110



>gb|EYU43305.1| hypothetical protein MIMGU_mgv1a002121mg [Erythranthe guttata]
Length=711

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 88/117 (75%), Gaps = 9/117 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSG--KEGPAYQRK  494
            MASAA+FSSLR+RRSP LEAFLAP+ +++  ++ET++A+++EL+SS+SG  K  P +Q K
Sbjct  1    MASAAVFSSLRKRRSPPLEAFLAPVHVSNAVVLETISAVSSELVSSYSGSSKTMPFFQVK  60

Query  495  NSKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            NS+SL+RKIQ+ SV ++  R+          S   ST  LCFKELYLLL+RSKIL+D
Sbjct  61   NSRSLIRKIQVISVLLDAFRD-------VGFSETASTVPLCFKELYLLLHRSKILID  110



>ref|XP_006449554.1| hypothetical protein CICLE_v10014430mg [Citrus clementina]
 gb|ESR62794.1| hypothetical protein CICLE_v10014430mg [Citrus clementina]
Length=715

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 90/115 (78%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSL+AFLAP+DLTD ALV+TL ++++EL+S FS +    +QR+NS
Sbjct  1    MAAAAIFSSLRRRRSPSLQAFLAPVDLTDVALVQTLLSISSELVSCFSDR-CFFFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F V +E LR++         +   STA LCFKELYLLLYR KILLD
Sbjct  60   RSLIRKMEVFLVLLEYLRDS--------GTCIESTAVLCFKELYLLLYRCKILLD  106



>emb|CDY48332.1| BnaA09g26890D [Brassica napus]
Length=704

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 8/115 (7%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA++++E++SSF+     ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLSGIALVKTLASISSEVVSSFAATRF-SFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SLLRKI+IF V  E L E R  SSS       +TA LC KE YLL+YRSKILL+
Sbjct  60   RSLLRKIEIFVVLFEFLAETRSPSSS-------TTALLCLKEFYLLIYRSKILLE  107



>emb|CBI30726.3| unnamed protein product [Vitis vinifera]
Length=649

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +3

Query  375  EAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNSKSLLRKIQIFSVAMECLR  554
            EAFLAP+DL + ALV TLA ++ ELI +FS +  P +QRKNS+SL+RKI++F V +E LR
Sbjct  19   EAFLAPVDLNEVALVRTLATISMELIFAFSDRPWP-FQRKNSRSLIRKIEVFLVLLEFLR  77

Query  555  ENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +         +   PS A LCFKELYLLLYRSKILLD
Sbjct  78   D--------CNLSLPSAAVLCFKELYLLLYRSKILLD  106



>ref|XP_011085318.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
17-like [Sesamum indicum]
Length=719

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSG--KEGPAYQRK  494
            MASAAIFSSLRRRRS SLE FLAP+DL+  A++ETL A++TEL+SSFS   K  P +QRK
Sbjct  1    MASAAIFSSLRRRRSTSLEGFLAPVDLSRAAILETLRAVSTELLSSFSSNDKSTPFFQRK  60

Query  495  NSKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            NS+SL+RKIQ+ SV ++   +          S+  ST  LC KELYLL+YRSKIL+D
Sbjct  61   NSRSLIRKIQVISVFLDAYAD-------VGFSKMTSTVPLCLKELYLLIYRSKILID  110



>ref|XP_009352721.1| PREDICTED: U-box domain-containing protein 17-like [Pyrus x bretschneideri]
Length=717

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSS+RRRRSPSLEAFLAP+DL+D   +       T  I S    +  ++QR+NS
Sbjct  1    MASAAIFSSMRRRRSPSLEAFLAPVDLSD-VALVQTLVSVTAEIVSSFSDKSFSFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +E LR++  +         P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVLLEYLRDSEAA--------MPWTAVICLKELYLLLYRSKILLD  106



>ref|XP_006467604.1| PREDICTED: U-box domain-containing protein 17-like [Citrus sinensis]
 gb|KDO77933.1| hypothetical protein CISIN_1g038217mg [Citrus sinensis]
Length=715

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSL+AFLAP+DLTD ALV+TL ++++EL+S FS +    +QR+NS
Sbjct  1    MAAAAIFSSLRRRRSPSLQAFLAPVDLTDVALVQTLLSISSELVSCFSDR-CFFFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++ F V +E LR++         +   STA LCFKELYLLLYR KILLD
Sbjct  60   RSLIRKMEAFLVLLEYLRDS--------GTCIESTAVLCFKELYLLLYRCKILLD  106



>ref|XP_009115249.1| PREDICTED: U-box domain-containing protein 17-like [Brassica 
rapa]
Length=704

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 89/115 (77%), Gaps = 8/115 (7%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP DL+  ALV+TLA++++E++SSF+     ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPFDLSGIALVKTLASISSEVVSSFAATRF-SFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            ++LLRKI+IF V  E L E R  SSS       +TA LC KE YLL+YRSKILL+
Sbjct  60   RALLRKIEIFVVLFEFLAETRSPSSS-------TTALLCLKEFYLLIYRSKILLE  107



>ref|XP_008383598.1| PREDICTED: U-box domain-containing protein 17-like [Malus domestica]
Length=717

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSS+RRRRSPSLEAFLAP+DL+D   +       T  I S    +  ++QR+NS
Sbjct  1    MASAAIFSSMRRRRSPSLEAFLAPVDLSD-VALVQTLVSVTAEIVSSFSXKSFSFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +E LR+   +         P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVLLEYLRDXGAA--------MPWTAVICLKELYLLLYRSKILLD  106



>gb|KJB69676.1| hypothetical protein B456_011G036500 [Gossypium raimondii]
Length=711

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 90/115 (78%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSS+RRRRSPSLEAFL P+DLT  ALV+TLAAL+++L+S FS      +QR+NS
Sbjct  1    MASAAIFSSVRRRRSPSLEAFLVPVDLTQVALVQTLAALSSDLVSCFS-DHVFFFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +  LR+    S S SSS    TA LCFKELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVVLAYLRD----SRSGSSSNLSPTAVLCFKELYLLLYRSKILLD  110



>ref|XP_008225235.1| PREDICTED: U-box domain-containing protein 17 [Prunus mume]
Length=716

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 81/115 (70%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+D   +  +    T  I+S    +  ++Q++NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSD-VALVQILVSVTAEIASSFSDKFFSFQKRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +E LR++  +         P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVLLEYLRDSGSA--------LPWTAVICLKELYLLLYRSKILLD  106



>ref|XP_007213625.1| hypothetical protein PRUPE_ppa002108mg [Prunus persica]
 gb|EMJ14824.1| hypothetical protein PRUPE_ppa002108mg [Prunus persica]
Length=716

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 81/115 (70%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+D   +  +    T  I+S    +  ++Q++NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSD-VALVQILVSVTAEIASSFSDKFFSFQKRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK++IF V +E LR++  +         P TA +C KELYLLLYRSKILLD
Sbjct  60   RSLVRKVEIFLVLLEYLRDSGSA--------LPWTAVICLKELYLLLYRSKILLD  106



>ref|XP_010248377.1| PREDICTED: U-box domain-containing protein 17-like [Nelumbo nucifera]
Length=712

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (67%), Gaps = 10/115 (9%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+ L++   +     +    + SFS    P +Q++NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVHLSE-VALVQALGIVANELMSFSHHPHP-FQKRNS  58

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI +F +  + LR++            PS+A LC KELYLL+YRSKILLD
Sbjct  59   RSLIRKIDVFVILFDYLRDS--------GRSLPSSAILCLKELYLLIYRSKILLD  105



>ref|XP_003531268.1| PREDICTED: U-box domain-containing protein 17-like [Glycine max]
Length=715

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 88/115 (77%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+D AL+ TL ++A ++ S FSG   P +QR+NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSDVALLGTLISVAGDIASCFSGHRFP-FQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            ++L+ K++IF   + CLR++      +++   P TA LC KELYLLLYRSKILLD
Sbjct  60   RALIGKVEIFRSMLGCLRDS------ATAGALPPTAVLCLKELYLLLYRSKILLD  108



>gb|KHN47392.1| U-box domain-containing protein 17 [Glycine soja]
Length=716

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+D ALV+TL ++A E++S FS K    +QRKNS
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSDVALVQTLISVANEIVSCFS-KRSFFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F + +E LR+++  SS       P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQLLLEYLRDSQSGSSC-----LPPTAVLCLKELYLLLYRSKILLD  109



>ref|XP_003542975.1| PREDICTED: U-box domain-containing protein 17-like isoform 1 
[Glycine max]
Length=716

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+D ALV+TL ++A E++S FS K    +QRKNS
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSDVALVQTLISVANEIVSCFS-KRSFFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F + +E LR+++  SS       P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQLLLEYLRDSQSGSSC-----LPPTAVLCLKELYLLLYRSKILLD  109



>ref|XP_010106623.1| U-box domain-containing protein 17 [Morus notabilis]
 gb|EXC10953.1| U-box domain-containing protein 17 [Morus notabilis]
Length=715

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DLTD ALV+TLA+L  EL+SSFS      +QRKNS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLTDVALVQTLASLTAELVSSFSDVSF-YFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F V +E LR++            P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLVRKMEVFLVLLEYLRDS--------GVSLPWTALLCLKELYLLLYRSKILLD  106



>emb|CDY43332.1| BnaC03g59040D [Brassica napus]
Length=719

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFL+P+DL+ + LV+TLAA++TE+ISSFSG    ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLSPVDLSGFPLVQTLAAISTEIISSFSGTR-FSFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V  E L E+R  S+ SSSS   STA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKIEIFLVLFESLAESRWGSTPSSSSSSSSTALLCLKELYLLLYRSKILLD  114



>ref|XP_009109670.1| PREDICTED: U-box domain-containing protein 17 [Brassica rapa]
Length=719

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFL+P+DL+   LV+TLAA++TE+ISSFSG    ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLSPVDLSGLPLVQTLAAISTEIISSFSGTR-FSFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V  E L E+R  S+ SSSS   STA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKIEIFLVLFESLAESRWGSTPSSSSSSSSTALLCLKELYLLLYRSKILLD  114



>ref|XP_010052161.1| PREDICTED: U-box domain-containing protein 17 [Eucalyptus grandis]
 gb|KCW76066.1| hypothetical protein EUGRSUZ_D00434 [Eucalyptus grandis]
Length=718

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSP LEAFL P+DL+D AL++TLA+L++EL+S  + K    +QRKNS
Sbjct  1    MATAAIFSSLRRRRSPCLEAFLVPVDLSDVALIQTLASLSSELVSCHTSKS-LFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI++F V +E LR+ R        S  PS A LC KELYLLLYRSKILLD
Sbjct  60   RSLVRKIEVFVVLLEFLRDGR-----YGRSDLPSAAVLCLKELYLLLYRSKILLD  109



>emb|CDX90186.1| BnaA08g17980D [Brassica napus]
Length=713

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 94/115 (82%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFL+P+DL+   LV+TLAA++TE+ISSFSG    ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLSPVDLSGLPLVQTLAAISTEIISSFSGTR-FSFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V  E L E+R  S+ SSS    STA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKIEIFLVLFESLAESRWGSTPSSS----STALLCLKELYLLLYRSKILLD  110



>emb|CDX99816.1| BnaC05g22380D [Brassica napus]
Length=724

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 89/115 (77%), Gaps = 8/115 (7%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+  A+V+TLA++++E++SS +     ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLSGVAVVQTLASISSEVVSSSAATR-LSFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SLLRKI+IF V  E L E R  SSS       +TA LC KE YLL+YRSKILL+
Sbjct  60   RSLLRKIEIFVVLFEFLVETRSPSSS-------TTALLCLKEFYLLIYRSKILLE  107



>gb|KHN28641.1| U-box domain-containing protein 17 [Glycine soja]
Length=713

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+  ALV+TL ++A E++S FS K    +QRKNS
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSAVALVQTLISVANEIVSCFS-KRCFFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F + +E LR++   SS       P TA    KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQLLLEYLRDSDSRSSC-----LPPTA---VKELYLLLYRSKILLD  106



>gb|EYU28122.1| hypothetical protein MIMGU_mgv1a027038mg [Erythranthe guttata]
Length=700

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 86/117 (74%), Gaps = 9/117 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSG--KEGPAYQRK  494
            MASAAIFSSLRRRRSPSLEAF+AP+DL+  A++E   A++ EL SSFSG  K  P +Q K
Sbjct  1    MASAAIFSSLRRRRSPSLEAFVAPVDLSYAAVLEASRAISNELASSFSGTNKTAPFFQGK  60

Query  495  NSKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            NS+SL+RKIQ+ SV ++  R+          S+F  + FLC KELYLLLYR+KIL+D
Sbjct  61   NSRSLIRKIQVVSVLLDGFRD-------VGFSQFAPSLFLCLKELYLLLYRTKILID  110



>gb|ACJ85851.1| unknown [Medicago truncatula]
Length=692

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+D ALV+TL  +  EL+  FS K    +QRKN+
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSDVALVQTLVTVVNELVCCFS-KRSFFFQRKNT  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F V +E L ++   S S      P+T  LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQVLLEYLNDSGSGSGSV----LPATGLLCLKELYLLLYRSKILLD  110



>ref|XP_003593822.1| U-box domain-containing protein [Medicago truncatula]
Length=737

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+D ALV+TL  +  EL+  FS K    +QRKN+
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSDVALVQTLVTVVNELVCCFS-KRSFFFQRKNT  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F V +E L ++   S S      P+T  LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQVLLEYLNDSGSGSGSV----LPATGLLCLKELYLLLYRSKILLD  110



>gb|AES64073.2| plant U-box protein [Medicago truncatula]
Length=720

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+D ALV+TL  +  EL+  FS K    +QRKN+
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSDVALVQTLVTVVNELVCCFS-KRSFFFQRKNT  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F V +E L ++   S S      P+T  LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQVLLEYLNDSGSGSGSV----LPATGLLCLKELYLLLYRSKILLD  110



>ref|XP_004161195.1| PREDICTED: U-box domain-containing protein 17-like [Cucumis sativus]
Length=715

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+D ALV+TL  +ATEL+S FS K    +QR+NS
Sbjct  1    MAAAAIFSSLRRRRSPSLEAFLAPVDLSDVALVQTLTIVATELVSRFSDKSF-FFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++  V +E L+E             P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKLEVCLVFLEFLKETDA--------NLPHTALLCLKELYLLLYRSKILLD  106



>ref|XP_003546044.1| PREDICTED: U-box domain-containing protein 17-like [Glycine max]
Length=716

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 88/115 (77%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+  ALV+TL ++A E++S FS K    +QRKNS
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSAVALVQTLISVANEIVSCFS-KRCFFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F + +E LR++   SS       P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQLLLEYLRDSDSRSSC-----LPPTAVLCLKELYLLLYRSKILLD  109



>ref|XP_004147388.1| PREDICTED: U-box domain-containing protein 17-like [Cucumis sativus]
 gb|KGN65604.1| hypothetical protein Csa_1G467720 [Cucumis sativus]
Length=715

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+D ALV+TL  +ATEL+S FS K    +QR+NS
Sbjct  1    MAAAAIFSSLRRRRSPSLEAFLAPVDLSDVALVQTLTIVATELVSRFSDKSF-FFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++  V +E L+E             P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKLEVCLVFLEFLKETDA--------NLPHTALLCLKELYLLLYRSKILLD  106



>ref|XP_008443533.1| PREDICTED: U-box domain-containing protein 17 [Cucumis melo]
Length=715

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 87/115 (76%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+D ALV+TLA +ATEL+S FS K    +QR+NS
Sbjct  1    MAAAAIFSSLRRRRSPSLEAFLAPVDLSDVALVQTLAIVATELVSRFSEKSF-FFQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++  V +E L+E             P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKLEVCLVFLEFLKETDA--------NLPHTALLCLKELYLLLYRSKILLD  106



>ref|XP_004485933.1| PREDICTED: U-box domain-containing protein 17-like [Cicer arietinum]
Length=715

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 85/115 (74%), Gaps = 9/115 (8%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+LEAFLAP+DL+D ALV+TL A+A EL+  FS K    +QRKNS
Sbjct  1    MASGAIFSSLRRRRSPTLEAFLAPVDLSDVALVQTLMAVANELVCCFS-KRSFFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RK+++F   +E L ++         S  P TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKVEVFQFLLEYLNDS--------GSSLPPTALLCLKELYLLLYRSKILLD  106



>ref|XP_006306891.1| hypothetical protein CARUB_v10008444mg [Capsella rubella]
 gb|EOA39789.1| hypothetical protein CARUB_v10008444mg [Capsella rubella]
Length=720

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA+++TE++S FSG    ++QRKN+
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISTEVVSCFSGVRF-SFQRKNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+ F V  E L ++   S   + +   STA LC KELYLLLYRSKIL+D
Sbjct  60   RSLIRKIETFVVLFEFLADSNWGSRRRNRASSESTALLCLKELYLLLYRSKILID  114



>gb|KFK36322.1| hypothetical protein AALP_AA4G107600 [Arabis alpina]
Length=700

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 79/114 (69%), Gaps = 11/114 (10%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAI +S+RRR       FLAPLDL+D  LV+TLA++++E+IS F+G    ++QR+NS
Sbjct  1    MATAAIIASVRRRIL----PFLAPLDLSDEPLVQTLASISSEIISCFTGVSF-SFQRRNS  55

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILL  662
            +SL+RKIQIF V  + L ++         S + STA  CFKELYL LY SKIL+
Sbjct  56   RSLIRKIQIFLVLFQYLADS------GFDSNYSSTALTCFKELYLTLYLSKILV  103



>ref|XP_007159489.1| hypothetical protein PHAVU_002G241800g [Phaseolus vulgaris]
 gb|ESW31483.1| hypothetical protein PHAVU_002G241800g [Phaseolus vulgaris]
Length=711

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 85/115 (74%), Gaps = 7/115 (6%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAF+ P+DL++ AL+ETL  +A +++S FS    P +QR+NS
Sbjct  1    MASAAIFSSLRRRRSPSLEAFIVPVDLSEVALLETLIYVAGDVVSCFSDNRFP-FQRRNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            ++L+ K++IF   +ECLR++            P TA LC KELYLLLYRSKILLD
Sbjct  60   RALVGKVEIFRSMLECLRDSTDGGVL-----LP-TAVLCLKELYLLLYRSKILLD  108



>ref|XP_010499451.1| PREDICTED: U-box domain-containing protein 17 [Camelina sativa]
Length=724

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 92/119 (77%), Gaps = 5/119 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA+++TE++S FSG     +QRKN+
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISTEVVSCFSGVRF-TFQRKNA  59

Query  501  KSLLRKIQIFSVAMECLRE----NRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V  E L +    +R    +SSS    STA LC KELYLLLYRSKIL+D
Sbjct  60   RSLIRKIEIFVVLFEFLADSNWGSRIKKRTSSSVFSESTALLCLKELYLLLYRSKILID  118



>gb|AAB97738.1| arm repeat containing protein [Brassica napus]
Length=661

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 80/111 (72%), Gaps = 10/111 (9%)
 Frame = +3

Query  330  AAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNSKSL  509
            +A+F+S RRR+SPSLEAFL+P+DL+D  L++TL+++++E++S FS     ++QR+N++SL
Sbjct  5    SAMFASSRRRQSPSLEAFLSPVDLSDVPLLQTLSSISSEIVSCFSNARF-SFQRRNTRSL  63

Query  510  LRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILL  662
            +RK+Q+F+V ++ L                 TA LCFKELYLLL+ SK LL
Sbjct  64   IRKVQVFAVLLQHLAPESS---------LDPTAVLCFKELYLLLHHSKFLL  105



>ref|XP_010460713.1| PREDICTED: U-box domain-containing protein 17 [Camelina sativa]
Length=725

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA+++TE++S FSG     +QRKN+
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISTEVVSCFSGVRF-TFQRKNA  59

Query  501  KSLLRKIQIFSVAMECLREN  560
            +SL+RKI+IF V  E L ++
Sbjct  60   RSLIRKIEIFVVLFEFLADS  79



>ref|XP_010549429.1| PREDICTED: U-box domain-containing protein 17 [Tarenaya hassleriana]
Length=714

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 86/115 (75%), Gaps = 5/115 (4%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP++LT  ALV+TLA++++E++S FSG     +QR+N+
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVNLTGIALVQTLASISSEVVSCFSGVHF-FFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI++F V  E L ++              TA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKIEVFVVMFEFLSDSGSGPGRV----LSHTAVLCLKELYLLLYRSKILLD  110



>dbj|BAJ34586.1| unnamed protein product [Thellungiella halophila]
Length=724

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA+++TE++S FSG    ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISTEIVSCFSGVR-FSFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLREN  560
            +SL+RKI+IF V  E L E+
Sbjct  60   RSLIRKIEIFVVLFEFLSES  79



>ref|XP_006415583.1| hypothetical protein EUTSA_v10006853mg [Eutrema salsugineum]
 gb|ESQ33936.1| hypothetical protein EUTSA_v10006853mg [Eutrema salsugineum]
Length=783

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA+++TE++S FSG    ++QR+N+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISTEIVSCFSGVR-FSFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLREN  560
            +SL+RKI+IF V  E L E+
Sbjct  60   RSLIRKIEIFVVLFEFLSES  79



>ref|XP_010509777.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=705

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 81/115 (70%), Gaps = 11/115 (10%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAP-LDLTDWalvetlaalatelISSFSGKEGPAYQRKN  497
            MA+ AIF+SLR R SPSLEAFL   +DL+D +LV+TLA+++ EL+S F      ++QR+N
Sbjct  1    MATEAIFTSLRLRTSPSLEAFLVTTVDLSDVSLVQTLASVSAELVSCFRSVRF-SFQRRN  59

Query  498  SKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILL  662
            ++SL+RKI++  V  E L ++ G         + STA +CFKELY+ L+RSK+LL
Sbjct  60   ARSLIRKIEVLLVLFEYLSDDSG---------WDSTAVMCFKELYIFLHRSKLLL  105



>gb|KFK44763.1| hypothetical protein AALP_AA1G299800 [Arabis alpina]
Length=719

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AAIFSSLRRRRSPSLEAFLAP+DL+  ALV+TLA+++TE+++SF+G    ++QRKN+
Sbjct  1    MATAAIFSSLRRRRSPSLEAFLAPVDLSGVALVQTLASISTEVVTSFNGIR-FSFQRKNA  59

Query  501  KSLLRKIQIFSVAMECL  551
            +SL+RKI+IF V  E L
Sbjct  60   RSLIRKIEIFVVLFEFL  76



>gb|ABY58019.1| arm repeat containing protein 1 [Brassica oleracea var. viridis]
Length=663

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 10/111 (9%)
 Frame = +3

Query  330  AAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNSKSL  509
            +A+F+S RRR+SPSLEAFL+P+DL+D  L+ TL++ ++E++S FS     ++QR+N++SL
Sbjct  5    SAMFASSRRRQSPSLEAFLSPVDLSDVPLLRTLSSTSSEIVSCFSNARF-SFQRRNTRSL  63

Query  510  LRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILL  662
            +RK+Q+ +V ++ L                 TA LCFKELYLLL+ SK LL
Sbjct  64   IRKVQVIAVLLQHLAPESS---------LDPTAVLCFKELYLLLHHSKFLL  105



>ref|XP_010413765.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=708

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 79/115 (69%), Gaps = 10/115 (9%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAP-LDLTDWalvetlaalatelISSFSGKEGPAYQRKN  497
            MA+ AIF+SLR R SPSLEAFL   +DL+D +LV TLA+++ EL+S F      ++QR+N
Sbjct  1    MATEAIFTSLRLRSSPSLEAFLTTTVDLSDVSLVRTLASVSAELVSCFRSVRF-SFQRRN  59

Query  498  SKSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILL  662
            ++SLLRKI++  V  E L ++ GS          STA +CF E+Y+ L+RSK+LL
Sbjct  60   ARSLLRKIEVLLVLFEYLADDSGS--------VSSTAVMCFNEIYIFLHRSKLLL  106



>ref|XP_010478295.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=725

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MASAAIFSSLRRRRSPSLEAFLAP+DL+  +L++TLA+++TE++S F G     +QRKN+
Sbjct  1    MASAAIFSSLRRRRSPSLEAFLAPVDLSGVSLIQTLASISTEIVSCFRGVRF-TFQRKNA  59

Query  501  KSLLRKIQIFSVAMECLREN  560
            +SL+RKI+IF V  E L ++
Sbjct  60   RSLIRKIEIFVVLFEFLADS  79



>emb|CDX94661.1| BnaC07g09970D [Brassica napus]
Length=711

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 90/115 (78%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MA+AA+FSSLRRR+SPSLEAFLAP+DL+  AL++TLA+++TE+IS F+     ++QR+N+
Sbjct  1    MATAAVFSSLRRRKSPSLEAFLAPVDLSGTALIQTLASISTEIISCFAAIRF-SFQRRNA  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
            +SL+RKI+IF V  E L E+R       SS   STA LC KELYLLLYRSKILLD
Sbjct  60   RSLIRKIEIFLVLFEFLAESR-----WGSSSSSSTALLCLKELYLLLYRSKILLD  109



>ref|XP_007147997.1| hypothetical protein PHAVU_006G171900g [Phaseolus vulgaris]
 gb|ESW19991.1| hypothetical protein PHAVU_006G171900g [Phaseolus vulgaris]
Length=716

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 84/115 (73%), Gaps = 6/115 (5%)
 Frame = +3

Query  321  MASAAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNS  500
            MAS AIFSSLRRRRSP+L+AFLAP+DL+D ALV+TL  +A E++S FS K    +QRKNS
Sbjct  1    MASGAIFSSLRRRRSPTLDAFLAPVDLSDVALVQTLLCVAREIVSCFS-KRCFFFQRKNS  59

Query  501  KSLLRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILLD  665
             SL+R+++ F + +E L ++   SS       P T  LC KELYLLLYRSKILLD
Sbjct  60   WSLIRRVEAFQLLLEYLHDSDSGSSC-----LPPTTVLCLKELYLLLYRSKILLD  109



>emb|CDY37666.1| BnaA04g20020D [Brassica napus]
Length=661

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 79/111 (71%), Gaps = 10/111 (9%)
 Frame = +3

Query  330  AAIFsslrrrrspslEAFLAPLDLTDWalvetlaalatelISSFSGKEGPAYQRKNSKSL  509
            +A+F+S RRR+SPSLEAFL+P++L+D  L++TL++ ++E++S FS     ++QR+N++SL
Sbjct  5    SAMFASSRRRQSPSLEAFLSPVNLSDVPLLQTLSSTSSEILSCFSDV-CFSFQRRNTRSL  63

Query  510  LRKIQIFSVAMECLRENRGssssssssRFPSTAFLCFKElylllyRSKILL  662
            +RK+Q+F+V ++ L                 TA LCFKELYLLL+ SK LL
Sbjct  64   IRKVQVFAVLLQHLAPESS---------LDPTAVLCFKELYLLLHHSKFLL  105



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960