BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032M07

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349669.1|  PREDICTED: uncharacterized protein LOC102584...    186   9e-51   
ref|XP_006349668.1|  PREDICTED: uncharacterized protein LOC102584...    186   2e-50   Solanum tuberosum [potatoes]
ref|XP_009597515.1|  PREDICTED: uncharacterized protein LOC104093468    177   6e-48   Nicotiana tomentosiformis
ref|XP_004247163.1|  PREDICTED: uncharacterized protein LOC101255...    179   7e-48   Solanum lycopersicum
ref|XP_009796269.1|  PREDICTED: uncharacterized protein LOC104242...    176   4e-47   Nicotiana sylvestris
ref|XP_009796267.1|  PREDICTED: uncharacterized protein LOC104242...    175   1e-46   Nicotiana sylvestris
ref|XP_009796266.1|  PREDICTED: uncharacterized protein LOC104242...    175   1e-46   Nicotiana sylvestris
gb|KDP21464.1|  hypothetical protein JCGZ_21935                         166   4e-43   Jatropha curcas
ref|XP_011079848.1|  PREDICTED: uncharacterized protein LOC105163...    164   7e-43   Sesamum indicum [beniseed]
ref|XP_011079847.1|  PREDICTED: uncharacterized protein LOC105163...    163   8e-43   Sesamum indicum [beniseed]
ref|XP_011079846.1|  PREDICTED: uncharacterized protein LOC105163...    164   2e-42   Sesamum indicum [beniseed]
ref|XP_002275196.1|  PREDICTED: uncharacterized protein LOC100256371    162   9e-42   Vitis vinifera
gb|EYU46587.1|  hypothetical protein MIMGU_mgv1a0012281mg               161   2e-41   Erythranthe guttata [common monkey flower]
emb|CDP03626.1|  unnamed protein product                                157   4e-40   Coffea canephora [robusta coffee]
ref|XP_010090399.1|  Uncharacterized protein in xynA 3'region           154   6e-39   Morus notabilis
ref|XP_007201215.1|  hypothetical protein PRUPE_ppa001060mg             153   1e-38   Prunus persica
ref|XP_006444079.1|  hypothetical protein CICLE_v10023868mg             152   3e-38   Citrus clementina [clementine]
gb|KDO68745.1|  hypothetical protein CISIN_1g002437mg                   151   7e-38   Citrus sinensis [apfelsine]
ref|XP_008235280.1|  PREDICTED: uncharacterized protein LOC103334119    150   8e-38   Prunus mume [ume]
ref|XP_010255949.1|  PREDICTED: uncharacterized protein LOC104596...    149   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010255948.1|  PREDICTED: uncharacterized protein LOC104596...    149   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010255947.1|  PREDICTED: uncharacterized protein LOC104596...    149   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008350069.1|  PREDICTED: uncharacterized protein LOC103413382    147   4e-37   
ref|XP_010684259.1|  PREDICTED: uncharacterized protein LOC104898847    148   6e-37   
ref|XP_008386504.1|  PREDICTED: uncharacterized protein LOC103449010    147   1e-36   
ref|XP_002520749.1|  conserved hypothetical protein                     147   2e-36   Ricinus communis
gb|KHG12136.1|  hypothetical protein F383_07635                         146   4e-36   Gossypium arboreum [tree cotton]
ref|XP_006575072.1|  PREDICTED: uncharacterized protein LOC100785...    145   4e-36   Glycine max [soybeans]
ref|XP_003520208.1|  PREDICTED: uncharacterized protein LOC100785...    145   5e-36   Glycine max [soybeans]
ref|XP_010070220.1|  PREDICTED: uncharacterized protein LOC104457...    144   9e-36   Eucalyptus grandis [rose gum]
ref|XP_008368936.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   1e-35   
ref|XP_007144634.1|  hypothetical protein PHAVU_007G172000g             145   1e-35   Phaseolus vulgaris [French bean]
ref|XP_010070219.1|  PREDICTED: uncharacterized protein LOC104457...    144   1e-35   Eucalyptus grandis [rose gum]
ref|XP_002307580.2|  hypothetical protein POPTR_0005s23080g             144   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_008449445.1|  PREDICTED: uncharacterized protein LOC103491330    142   8e-35   Cucumis melo [Oriental melon]
ref|XP_004290657.1|  PREDICTED: uncharacterized protein LOC101291108    141   1e-34   Fragaria vesca subsp. vesca
ref|XP_007050625.1|  FZO-like                                           141   2e-34   
ref|XP_011032720.1|  PREDICTED: uncharacterized protein LOC105131442    140   3e-34   Populus euphratica
ref|XP_009355473.1|  PREDICTED: uncharacterized protein LOC103946491    140   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_003590651.1|  GTP-binding protein engA                           140   4e-34   Medicago truncatula
ref|XP_009367692.1|  PREDICTED: uncharacterized protein LOC103957273    140   4e-34   Pyrus x bretschneideri [bai li]
ref|XP_004495204.1|  PREDICTED: uncharacterized protein LOC101505...    139   9e-34   
ref|XP_004495203.1|  PREDICTED: uncharacterized protein LOC101505...    139   9e-34   Cicer arietinum [garbanzo]
gb|KJB23087.1|  hypothetical protein B456_004G080200                    139   1e-33   Gossypium raimondii
gb|KJB23088.1|  hypothetical protein B456_004G080200                    139   1e-33   Gossypium raimondii
ref|XP_004140223.1|  PREDICTED: uncharacterized protein LOC101213431    138   2e-33   Cucumis sativus [cucumbers]
ref|XP_004167583.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    138   2e-33   
ref|XP_008783174.1|  PREDICTED: uncharacterized protein LOC103702...    136   8e-33   Phoenix dactylifera
ref|XP_003536908.1|  PREDICTED: uncharacterized protein LOC100808213    134   6e-32   Glycine max [soybeans]
gb|AAD25810.1|AC006550_18  F10O3.1                                      132   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927024.1|  PREDICTED: uncharacterized protein LOC105049...    130   1e-30   Elaeis guineensis
ref|XP_010927023.1|  PREDICTED: uncharacterized protein LOC105049...    130   1e-30   Elaeis guineensis
ref|XP_010927025.1|  PREDICTED: uncharacterized protein LOC105049...    129   2e-30   
gb|AAQ65198.1|  At1g03160                                               125   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077452.1|  FZO-like protein                                   125   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171815.3|  FZO-like protein                                      126   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418260.1|  hypothetical protein EUTSA_v10006729mg             125   5e-29   Eutrema salsugineum [saltwater cress]
ref|XP_006851107.1|  hypothetical protein AMTR_s00025p00248100          125   8e-29   
ref|XP_010474923.1|  PREDICTED: uncharacterized protein LOC104754...    124   8e-29   
ref|XP_010474922.1|  PREDICTED: uncharacterized protein LOC104754...    125   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010522727.1|  PREDICTED: uncharacterized protein LOC104801...    124   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_002889440.1|  hypothetical protein ARALYDRAFT_470295             123   4e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_010522715.1|  PREDICTED: uncharacterized protein LOC104801...    122   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_009401044.1|  PREDICTED: uncharacterized protein LOC103985...    122   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009401043.1|  PREDICTED: uncharacterized protein LOC103985...    122   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006306709.1|  hypothetical protein CARUB_v10008235mg             121   1e-27   Capsella rubella
ref|XP_010474935.1|  PREDICTED: uncharacterized protein LOC104754437    121   1e-27   Camelina sativa [gold-of-pleasure]
gb|EPS64568.1|  hypothetical protein M569_10214                         113   1e-27   Genlisea aurea
emb|CDX86689.1|  BnaC08g00140D                                          121   2e-27   
ref|XP_010481655.1|  PREDICTED: uncharacterized protein LOC104760424    120   3e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009111165.1|  PREDICTED: uncharacterized protein LOC103836629    119   5e-27   Brassica rapa
emb|CDY15452.1|  BnaA08g27360D                                          119   6e-27   Brassica napus [oilseed rape]
ref|XP_011026335.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    117   4e-26   Populus euphratica
ref|XP_010233244.1|  PREDICTED: uncharacterized protein LOC100838168    114   6e-25   
ref|XP_004963794.1|  PREDICTED: uncharacterized protein LOC101755934    112   1e-24   
ref|XP_008649599.1|  PREDICTED: uncharacterized protein LOC103630315    112   2e-24   Zea mays [maize]
gb|AFW77879.1|  hypothetical protein ZEAMMB73_997279                    112   2e-24   
ref|XP_002439739.1|  hypothetical protein SORBIDRAFT_09g019290          110   9e-24   Sorghum bicolor [broomcorn]
ref|XP_002300848.2|  hypothetical protein POPTR_0002s05420g             107   5e-23   
dbj|BAK07723.1|  predicted protein                                      108   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAY97909.1|  hypothetical protein OsI_19825                          106   2e-22   Oryza sativa Indica Group [Indian rice]
gb|EEE63597.1|  hypothetical protein OsJ_18414                          106   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97907.1|  hypothetical protein OsI_19823                        88.6    5e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002984373.1|  hypothetical protein SELMODRAFT_445893           81.6    4e-14   
ref|XP_002972797.1|  hypothetical protein SELMODRAFT_413416           81.6    4e-14   
ref|XP_005646142.1|  hypothetical protein COCSUDRAFT_30102            73.9    1e-11   Coccomyxa subellipsoidea C-169
ref|XP_001780842.1|  predicted protein                                70.5    2e-10   
ref|XP_001774726.1|  predicted protein                                69.3    3e-10   
ref|NP_001055439.1|  Os05g0390100                                     68.9    4e-10   
ref|XP_003081806.1|  Mitofusin 1 GTPase, involved in mitochondril...  65.1    7e-09   
emb|CEF99507.1|  P-loop containing nucleoside triphosphate hydrolase  65.1    9e-09   Ostreococcus tauri
ref|XP_001420392.1|  predicted protein                                60.5    3e-07   Ostreococcus lucimarinus CCE9901
ref|XP_001689811.1|  predicted protein                                59.3    7e-07   Chlamydomonas reinhardtii
ref|XP_005845307.1|  hypothetical protein CHLNCDRAFT_137054           57.4    3e-06   Chlorella variabilis
gb|KHN18882.1|  Hypothetical protein glysoja_028251                   55.1    1e-05   Glycine soja [wild soybean]
ref|XP_002509117.1|  hypothetical protein MICPUN_62927                52.0    2e-04   Micromonas commoda



>ref|XP_006349669.1| PREDICTED: uncharacterized protein LOC102584745 isoform X2 [Solanum 
tuberosum]
Length=802

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ  313
            MVSL +   SV SP    F  P        HF+ R  C N SV +    NV LV NN  +
Sbjct  1    MVSLQTLYSSVRSPPCSLFTHPRSRQCF--HFRSRRHCANSSVYSPV-DNVKLVINNLNR  57

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            P+Q PRTLFPGGFKRPEIKVPSLVL+LS ++V  +  V++EIDQA+SGRV +V+LSGGG 
Sbjct  58   PEQTPRTLFPGGFKRPEIKVPSLVLKLSCEDVLRDETVVNEIDQAISGRVDVVVLSGGGA  117

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGGKLYEAACLLKSVI+ RAYLL+D RVDIAAAVNASGVLLSDQ LP IVARNTM+D+KS
Sbjct  118  SGGKLYEAACLLKSVIKGRAYLLIDGRVDIAAAVNASGVLLSDQDLPAIVARNTMMDSKS  177

Query  674  ESVV  685
            E +V
Sbjct  178  EELV  181



>ref|XP_006349668.1| PREDICTED: uncharacterized protein LOC102584745 isoform X1 [Solanum 
tuberosum]
Length=919

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 138/184 (75%), Gaps = 3/184 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ  313
            MVSL +   SV SP    F  P        HF+ R  C N SV +    NV LV NN  +
Sbjct  1    MVSLQTLYSSVRSPPCSLFTHPRSRQCF--HFRSRRHCANSSVYSPV-DNVKLVINNLNR  57

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            P+Q PRTLFPGGFKRPEIKVPSLVL+LS ++V  +  V++EIDQA+SGRV +V+LSGGG 
Sbjct  58   PEQTPRTLFPGGFKRPEIKVPSLVLKLSCEDVLRDETVVNEIDQAISGRVDVVVLSGGGA  117

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGGKLYEAACLLKSVI+ RAYLL+D RVDIAAAVNASGVLLSDQ LP IVARNTM+D+KS
Sbjct  118  SGGKLYEAACLLKSVIKGRAYLLIDGRVDIAAAVNASGVLLSDQDLPAIVARNTMMDSKS  177

Query  674  ESVV  685
            E +V
Sbjct  178  EELV  181



>ref|XP_009597515.1| PREDICTED: uncharacterized protein LOC104093468 [Nicotiana tomentosiformis]
Length=722

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ  313
            MVSL +   +V S     F  P P+     HF  R    N SV ++AR NV LV NN  +
Sbjct  1    MVSLQTPNSTVRSTPCPLF--PHPTRRQCLHFWRRR--NNYSVYSSARVNVKLVINNLNR  56

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            P+Q PRTLFPGG+KRPEIKVPSLVL+LS ++  ++  V++EID+AVSGRV IV+LSGGG 
Sbjct  57   PEQTPRTLFPGGYKRPEIKVPSLVLKLSCEDALEDETVINEIDRAVSGRVDIVVLSGGGA  116

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGGKLYEAACLLKSVI+ RAYLL+D RVDIAAA++ASGVLLSDQ LP IVARNTM+D+KS
Sbjct  117  SGGKLYEAACLLKSVIKGRAYLLIDGRVDIAAAISASGVLLSDQDLPAIVARNTMMDSKS  176

Query  674  ESVV  685
            E +V
Sbjct  177  EELV  180



>ref|XP_004247163.1| PREDICTED: uncharacterized protein LOC101255731 isoform X1 [Solanum 
lycopersicum]
Length=919

 Score =   179 bits (454),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 137/189 (72%), Gaps = 13/189 (7%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPP-----HFKPRLRCTNISVRAAARSNVSLVF  298
            MVSL +   SV SP       P P    P      HF+ R  C N SV +    NV LV 
Sbjct  1    MVSLQTIYSSVRSP-------PCPLFIHPRRRQCFHFRSRRNCANSSVYSPV-DNVKLVI  52

Query  299  NNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivll  478
            NN  +P+Q PRTLFPGGFKRPEIKVP LVL++S ++V  +  V++EIDQA+SGRV +V+L
Sbjct  53   NNVNRPEQTPRTLFPGGFKRPEIKVPGLVLKVSCEDVLRDETVVNEIDQAISGRVDVVVL  112

Query  479  sgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
            SGGG SGGKLYEAACLLKS+I+  AYLL+D RVDIAAAVNASGVLLSDQ LP IVARNTM
Sbjct  113  SGGGASGGKLYEAACLLKSIIKGMAYLLIDGRVDIAAAVNASGVLLSDQDLPAIVARNTM  172

Query  659  LDTKSESVV  685
            +D+KSE +V
Sbjct  173  MDSKSEDLV  181



>ref|XP_009796269.1| PREDICTED: uncharacterized protein LOC104242852 isoform X4 [Nicotiana 
sylvestris]
Length=716

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ  313
            MV L +   +V SP    F+ P        HF  R R  N SV ++   NV LV NN  +
Sbjct  1    MVYLQTPYSTVRSPPCPLFSHPMRRQ--CLHF--RRRRNNYSVYSSPGDNVKLVINNLNR  56

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            P+Q PRTLFPGG+KRPEIKVPSLVL+LS ++V ++  V++EID+AVSGRV IV+LSGGG 
Sbjct  57   PEQTPRTLFPGGYKRPEIKVPSLVLKLSCEDVLEDETVINEIDRAVSGRVDIVVLSGGGA  116

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGGKLYEAACLLKSVI+ RAYLL+D RVDIAAA++ASGVLLSDQ LP IVARNTM+D+KS
Sbjct  117  SGGKLYEAACLLKSVIKGRAYLLIDGRVDIAAAISASGVLLSDQDLPAIVARNTMMDSKS  176

Query  674  ESVV  685
            E +V
Sbjct  177  EELV  180



>ref|XP_009796267.1| PREDICTED: uncharacterized protein LOC104242852 isoform X2 [Nicotiana 
sylvestris]
Length=825

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ  313
            MV L +   +V SP    F+ P        HF  R R  N SV ++   NV LV NN  +
Sbjct  1    MVYLQTPYSTVRSPPCPLFSHPMRRQ--CLHF--RRRRNNYSVYSSPGDNVKLVINNLNR  56

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            P+Q PRTLFPGG+KRPEIKVPSLVL+LS ++V ++  V++EID+AVSGRV IV+LSGGG 
Sbjct  57   PEQTPRTLFPGGYKRPEIKVPSLVLKLSCEDVLEDETVINEIDRAVSGRVDIVVLSGGGA  116

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGGKLYEAACLLKSVI+ RAYLL+D RVDIAAA++ASGVLLSDQ LP IVARNTM+D+KS
Sbjct  117  SGGKLYEAACLLKSVIKGRAYLLIDGRVDIAAAISASGVLLSDQDLPAIVARNTMMDSKS  176

Query  674  ESVV  685
            E +V
Sbjct  177  EELV  180



>ref|XP_009796266.1| PREDICTED: uncharacterized protein LOC104242852 isoform X1 [Nicotiana 
sylvestris]
Length=921

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 4/184 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ  313
            MV L +   +V SP    F+ P        HF  R R  N SV ++   NV LV NN  +
Sbjct  1    MVYLQTPYSTVRSPPCPLFSHPMRRQ--CLHF--RRRRNNYSVYSSPGDNVKLVINNLNR  56

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            P+Q PRTLFPGG+KRPEIKVPSLVL+LS ++V ++  V++EID+AVSGRV IV+LSGGG 
Sbjct  57   PEQTPRTLFPGGYKRPEIKVPSLVLKLSCEDVLEDETVINEIDRAVSGRVDIVVLSGGGA  116

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGGKLYEAACLLKSVI+ RAYLL+D RVDIAAA++ASGVLLSDQ LP IVARNTM+D+KS
Sbjct  117  SGGKLYEAACLLKSVIKGRAYLLIDGRVDIAAAISASGVLLSDQDLPAIVARNTMMDSKS  176

Query  674  ESVV  685
            E +V
Sbjct  177  EELV  180



>gb|KDP21464.1| hypothetical protein JCGZ_21935 [Jatropha curcas]
Length=920

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 121/166 (73%), Gaps = 7/166 (4%)
 Frame = +2

Query  188  FASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEI  367
            F +P P   SPPH   R    ++S     RS       N++ P Q PRTLFPGG+KRPEI
Sbjct  22   FFTPLPRFKSPPHRTHRFPILSLSNDPFQRSI------NQDSPTQ-PRTLFPGGYKRPEI  74

Query  368  KVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRE  547
            KVP++VLQL + +V    +VLD ID+AV   VGIV+L+ G  SG  LYEAACLLKSVIR+
Sbjct  75   KVPNIVLQLESDDVLPRGDVLDFIDKAVVKWVGIVVLNCGDGSGKALYEAACLLKSVIRD  134

Query  548  RAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            RAYLL+ ERVD+AAAVNASGV+LSDQGLP IVARN M+D+KSESVV
Sbjct  135  RAYLLIGERVDVAAAVNASGVVLSDQGLPAIVARNMMMDSKSESVV  180



>ref|XP_011079848.1| PREDICTED: uncharacterized protein LOC105163260 isoform X3 [Sesamum 
indicum]
Length=738

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 112/121 (93%), Gaps = 1/121 (1%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivllsgggvsgg  502
            PR+LFPGG+KRPEIKVP+LVL+LS+ +VF D++ VLD ID+AVS RVGIV+L+GG  SG 
Sbjct  66   PRSLFPGGYKRPEIKVPNLVLRLSSDDVFRDDKAVLDVIDEAVSDRVGIVVLTGGEGSGK  125

Query  503  klYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  126  KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  185

Query  683  V  685
            +
Sbjct  186  I  186



>ref|XP_011079847.1| PREDICTED: uncharacterized protein LOC105163260 isoform X2 [Sesamum 
indicum]
Length=738

 Score =   163 bits (413),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 112/121 (93%), Gaps = 1/121 (1%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivllsgggvsgg  502
            PR+LFPGG+KRPEIKVP+LVL+LS+ +VF D++ VLD ID+AVS RVGIV+L+GG  SG 
Sbjct  66   PRSLFPGGYKRPEIKVPNLVLRLSSDDVFRDDKAVLDVIDEAVSDRVGIVVLTGGEGSGK  125

Query  503  klYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  126  KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  185

Query  683  V  685
            +
Sbjct  186  I  186



>ref|XP_011079846.1| PREDICTED: uncharacterized protein LOC105163260 isoform X1 [Sesamum 
indicum]
Length=921

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 112/121 (93%), Gaps = 1/121 (1%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivllsgggvsgg  502
            PR+LFPGG+KRPEIKVP+LVL+LS+ +VF D++ VLD ID+AVS RVGIV+L+GG  SG 
Sbjct  66   PRSLFPGGYKRPEIKVPNLVLRLSSDDVFRDDKAVLDVIDEAVSDRVGIVVLTGGEGSGK  125

Query  503  klYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  126  KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  185

Query  683  V  685
            +
Sbjct  186  I  186



>ref|XP_002275196.1| PREDICTED: uncharacterized protein LOC100256371 [Vitis vinifera]
 emb|CBI32337.3| unnamed protein product [Vitis vinifera]
Length=926

 Score =   162 bits (410),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 133/199 (67%), Gaps = 27/199 (14%)
 Frame = +2

Query  134  MVSLLSQCCSVH----------SPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSN  283
            MVSLLSQ  S+H             H H        Y  P F  R            RS 
Sbjct  1    MVSLLSQPPSIHPLFFIPTHHRYHHHSHRNHTHNHRYPLPLFSRR------------RSR  48

Query  284  VSLV--FNNEEQP---KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQA  448
            +S+V   NN   P    +QPRT++PGG+KRPEI+VPSLVLQLS  EV D   VLD +D+A
Sbjct  49   LSIVSIANNSIPPTSQNKQPRTVYPGGYKRPEIRVPSLVLQLSVDEVLDRAGVLDVVDEA  108

Query  449  vsgrvgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQG  628
            VS  VG+V+L GG  SGG+LYEAACLLKSV+RERAYL+V ERVDIAAAVNA+GV+LSD+G
Sbjct  109  VSKWVGVVVLDGGDGSGGRLYEAACLLKSVVRERAYLMVAERVDIAAAVNANGVVLSDKG  168

Query  629  LPTIVARNTMLDTKSESVV  685
            LP IVARNTM+D++SESV+
Sbjct  169  LPAIVARNTMMDSRSESVI  187



>gb|EYU46587.1| hypothetical protein MIMGU_mgv1a0012281mg, partial [Erythranthe 
guttata]
Length=860

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 111/121 (92%), Gaps = 1/121 (1%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivllsgggvsgg  502
            PR+LFPGG+KRPEIKVP+++L+LS+ +V  D+R +LD +D AVSGRVGIVLL+GG  SG 
Sbjct  3    PRSLFPGGYKRPEIKVPNIILRLSSDDVLRDDRAILDAVDDAVSGRVGIVLLTGGEGSGK  62

Query  503  klYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            KLYEAACLLKSVIR+RAYLL+DERVDIAAAVNASGVLLSDQGLPTIVARNTM+D K++SV
Sbjct  63   KLYEAACLLKSVIRDRAYLLIDERVDIAAAVNASGVLLSDQGLPTIVARNTMMDAKTDSV  122

Query  683  V  685
            +
Sbjct  123  I  123



>emb|CDP03626.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 130/205 (63%), Gaps = 32/205 (16%)
 Frame = +2

Query  86   PPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVR  265
            PPPS+ +F                C+   PSH      +    S P   P  R  NI+  
Sbjct  16   PPPSHPLFL---------------CNPKLPSHLWLTRGS----SLPLTSPLKR--NITTS  54

Query  266  AAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD---NRNVLDE  436
             A        F +    +QQPRTLFPGG+KRPEI+VP++VL LS+ EVF+    R VLD 
Sbjct  55   TA------FPFISSSLSQQQPRTLFPGGYKRPEIRVPNVVLLLSSHEVFEEDKTRGVLDV  108

Query  437  IDQAvsgrvgivll--sgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGV  610
            +D+A++  V  +++   GG   G  LYEAAC+LKSVI++RAYLL++ERVDIAAAVNASGV
Sbjct  109  LDKAIASSVVGIVVLRGGGARGGKLLYEAACVLKSVIKDRAYLLIEERVDIAAAVNASGV  168

Query  611  LLSDQGLPTIVARNTMLDTKSESVV  685
            LLSDQGLP IVARNTM+D+KSESVV
Sbjct  169  LLSDQGLPAIVARNTMIDSKSESVV  193



>ref|XP_010090399.1| Uncharacterized protein in xynA 3'region [Morus notabilis]
 gb|EXB39369.1| Uncharacterized protein in xynA 3'region [Morus notabilis]
Length=926

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 126/187 (67%), Gaps = 10/187 (5%)
 Frame = +2

Query  143  LLSQCCSVHSPSHCHFASPTPSHYSPPHFKPRL--RCTNISVRAAARSNVSLVFNNEEQP  316
            L SQ  + H P       P   H S    KP L  R   + VR+ +++     F N+  P
Sbjct  5    LFSQASTTHHPLFFTLTPPLQLHTS--RLKPCLLRRPPRLPVRSISQNGSQ--FANQSSP  60

Query  317  KQQ----PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsg  484
            + Q    PRT+FPGG+KRPEI+VP LVLQL   EV      LD +D+AVS   GIV+L+G
Sbjct  61   ELQGQGPPRTVFPGGYKRPEIRVPCLVLQLDADEVLAGDGALDLVDRAVSKWTGIVVLNG  120

Query  485  ggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  664
            G  +GG++YEAAC LKSV+R+RAYLLV ERVDIAAA NASGV+LSDQGLP IVAR+TM+D
Sbjct  121  GEATGGRIYEAACKLKSVVRDRAYLLVAERVDIAAAANASGVVLSDQGLPAIVARSTMMD  180

Query  665  TKSESVV  685
            +KS+SVV
Sbjct  181  SKSDSVV  187



>ref|XP_007201215.1| hypothetical protein PRUPE_ppa001060mg [Prunus persica]
 gb|EMJ02414.1| hypothetical protein PRUPE_ppa001060mg [Prunus persica]
Length=921

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASPTP---SHYSPPHFKPRLRCTNISVRAAARSNVSLVFNN  304
            MVSLLS   S   P      S TP   +H S    +P  R   +    +  SN     N 
Sbjct  1    MVSLLSFHTSATQPLLLT-PSSTPFLHTHLSRIKSQPSRRTRFLISSISQNSNQFTNQNP  59

Query  305  EEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsg  484
            +  PK+ PRT FPGGFKRPEIKVP++VLQL   +V    + LD ID+AVS  VGI++L+G
Sbjct  60   QTPPKKPPRTQFPGGFKRPEIKVPNIVLQLDPDDVLVGDDALDLIDKAVSKWVGILVLNG  119

Query  485  ggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  664
               SGG+LYEAAC LKSV+R+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR TM+ 
Sbjct  120  REASGGRLYEAACKLKSVVRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARGTMMA  179

Query  665  TKSESVV  685
            +KSESV+
Sbjct  180  SKSESVI  186



>ref|XP_006444079.1| hypothetical protein CICLE_v10023868mg [Citrus clementina]
 ref|XP_006479727.1| PREDICTED: uncharacterized protein LOC102616592 [Citrus sinensis]
 gb|ESR57319.1| hypothetical protein CICLE_v10023868mg [Citrus clementina]
Length=921

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 20/186 (11%)
 Frame = +2

Query  167  HSPSHCHFASPTPSHYSPPHF-----KPRLRCTNISVRAAARSNVSLVFNNEE-------  310
            H+P+      P P   S P+F     KP    T+  +++ +  N    F +E+       
Sbjct  9    HAPTRV----PAPRFLSDPYFPIPRFKPPRHRTHFPIKSISNDNS---FRSEDSAAAPVI  61

Query  311  -QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgg  487
             + +Q+PRTL+PGG+KRPEIKVP++VLQL   +V    + LD ID+AV+  VGIV+L+GG
Sbjct  62   SEKQQRPRTLYPGGYKRPEIKVPNVVLQLEPHQVLAGGDALDLIDEAVAKFVGIVVLNGG  121

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
              SG  +YEAACLLKSV+++RA  L+ ERVDIAAAVNASGVLLSDQGLP IVARNTM D+
Sbjct  122  EASGKSVYEAACLLKSVVKDRALFLIAERVDIAAAVNASGVLLSDQGLPAIVARNTMKDS  181

Query  668  KSESVV  685
             SESVV
Sbjct  182  MSESVV  187



>gb|KDO68745.1| hypothetical protein CISIN_1g002437mg [Citrus sinensis]
Length=921

 Score =   151 bits (381),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 20/186 (11%)
 Frame = +2

Query  167  HSPSHCHFASPTPSHYSPPHF-----KPRLRCTNISVRAAARSNVSLVFNNEE-------  310
            H+P+      P P   S P+F     KP    T+  +++ +  N    F +E+       
Sbjct  9    HAPTRV----PAPRFLSDPYFPIPRFKPPPHRTHFPIKSISNDNS---FRSEDSAAAPVI  61

Query  311  -QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgg  487
             + +Q+PRTL+PGG+KRPEIKVP++VLQL   +V    + LD ID+AV+  VGIV+L+GG
Sbjct  62   SEKQQRPRTLYPGGYKRPEIKVPNVVLQLEPHQVLAGGDALDLIDEAVAKFVGIVVLNGG  121

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
              SG  +YEAACLLKSV+++RA  L+ ERVDIAAAVNASGVLLSDQGLP IVARNTM D+
Sbjct  122  EASGKSVYEAACLLKSVVKDRALFLIAERVDIAAAVNASGVLLSDQGLPAIVARNTMKDS  181

Query  668  KSESVV  685
             SESVV
Sbjct  182  MSESVV  187



>ref|XP_008235280.1| PREDICTED: uncharacterized protein LOC103334119 [Prunus mume]
Length=921

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  314  PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggv  493
            PKQ PRT FPGGFKRPEIKVP++VLQL   +V    + LD ID+AVS  VGI++L+G   
Sbjct  63   PKQPPRTQFPGGFKRPEIKVPNIVLQLDPDDVLVGDDALDLIDKAVSKWVGILVLNGREA  122

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
            SGG+LYEAAC LKSV+R+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS
Sbjct  123  SGGRLYEAACKLKSVVRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKS  182

Query  674  ESVV  685
            +SV+
Sbjct  183  DSVI  186



>ref|XP_010255949.1| PREDICTED: uncharacterized protein LOC104596469 isoform X3 [Nelumbo 
nucifera]
Length=915

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggk  505
            PRTLFPGGFKRPEIKVP++VLQL + EV     VLD ID AVS  VGIV+L+    SGG+
Sbjct  131  PRTLFPGGFKRPEIKVPTVVLQLKSDEVLRREGVLDSIDAAVSKWVGIVVLNDADGSGGR  190

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            LYEAA LLKSVIR+RAYLL+ ERVDIAAAV+ASGVLLSDQGLP IVARN M+ +KS+SVV
Sbjct  191  LYEAARLLKSVIRDRAYLLIAERVDIAAAVSASGVLLSDQGLPAIVARNMMMQSKSDSVV  250



>ref|XP_010255948.1| PREDICTED: uncharacterized protein LOC104596469 isoform X2 [Nelumbo 
nucifera]
Length=991

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggk  505
            PRTLFPGGFKRPEIKVP++VLQL + EV     VLD ID AVS  VGIV+L+    SGG+
Sbjct  131  PRTLFPGGFKRPEIKVPTVVLQLKSDEVLRREGVLDSIDAAVSKWVGIVVLNDADGSGGR  190

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            LYEAA LLKSVIR+RAYLL+ ERVDIAAAV+ASGVLLSDQGLP IVARN M+ +KS+SVV
Sbjct  191  LYEAARLLKSVIRDRAYLLIAERVDIAAAVSASGVLLSDQGLPAIVARNMMMQSKSDSVV  250



>ref|XP_010255947.1| PREDICTED: uncharacterized protein LOC104596469 isoform X1 [Nelumbo 
nucifera]
Length=992

 Score =   149 bits (377),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +2

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggk  505
            PRTLFPGGFKRPEIKVP++VLQL + EV     VLD ID AVS  VGIV+L+    SGG+
Sbjct  131  PRTLFPGGFKRPEIKVPTVVLQLKSDEVLRREGVLDSIDAAVSKWVGIVVLNDADGSGGR  190

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            LYEAA LLKSVIR+RAYLL+ ERVDIAAAV+ASGVLLSDQGLP IVARN M+ +KS+SVV
Sbjct  191  LYEAARLLKSVIRDRAYLLIAERVDIAAAVSASGVLLSDQGLPAIVARNMMMQSKSDSVV  250



>ref|XP_008350069.1| PREDICTED: uncharacterized protein LOC103413382 [Malus domestica]
Length=668

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 123/180 (68%), Gaps = 12/180 (7%)
 Frame = +2

Query  182  CHFASPTPSHYSP---PHFKPRL--------RCTNISVRAAARSNVSLVFNNEEQPKQQP  328
             H ++  P  Y+P   P  +P L        R T   + + ++++      N + P+ QP
Sbjct  7    LHTSTTQPLLYTPTAXPSLQPHLSRTKAHPPRRTQFFISSISQNSHRFTSQNPQPPEAQP  66

Query  329  -RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggk  505
             RT FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  VG++ L+G   SGG+
Sbjct  67   PRTQFPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLXLNGRDSSGGR  126

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            LYEAAC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+ VV
Sbjct  127  LYEAACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDLVV  186



>ref|XP_010684259.1| PREDICTED: uncharacterized protein LOC104898847 [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 120/184 (65%), Gaps = 14/184 (8%)
 Frame = +2

Query  170  SPSHCHFASPTPSHYSPPHFKPR------LRCTNISVRAAARSNVSLVFNNEEQPKQQPR  331
            +  +     PT  HY PP F+P+      L  ++   +  +  N ++ F+       QPR
Sbjct  15   TTGNLFLKQPTFPHY-PPKFRPQHPQQHPLPHSHHFTKTKSAQNDAM-FDAYIPQNSQPR  72

Query  332  TLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsg-----rvgivllsgggv  493
            TLFPGG+KRPEIK+P++VLQLS  ++  D   VLD +D AV+       V     S    
Sbjct  73   TLFPGGYKRPEIKIPNIVLQLSAAQILSDTSFVLDFVDSAVAKRVGVVVVNGGEGSSSNS  132

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKS  673
             GG+LYEAACLLKSVIR+RAYLLV ERVDIAAAVNASGVLLSDQGLP IVARNT++ +KS
Sbjct  133  GGGQLYEAACLLKSVIRDRAYLLVAERVDIAAAVNASGVLLSDQGLPPIVARNTLMSSKS  192

Query  674  ESVV  685
            ESVV
Sbjct  193  ESVV  196



>ref|XP_008386504.1| PREDICTED: uncharacterized protein LOC103449010 [Malus domestica]
Length=918

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 124/180 (69%), Gaps = 12/180 (7%)
 Frame = +2

Query  182  CHFASPTPSHYSP---PHFKPRL--------RCTNISVRAAARSNVSLVFNNEEQPKQQP  328
             H ++  P  Y+P   P  +P L        R T   + + ++++      N + P+ QP
Sbjct  7    LHTSTTQPLLYTPTATPSLQPHLSRTKAHPPRRTQFFISSISQNSHRFTSQNPQPPEAQP  66

Query  329  -RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggk  505
             RT FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  VG+++L+G   SGG+
Sbjct  67   PRTQFPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLVLNGRDSSGGR  126

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            LYEAAC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+ VV
Sbjct  127  LYEAACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDLVV  186



>ref|XP_002520749.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41711.1| conserved hypothetical protein [Ricinus communis]
Length=921

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +2

Query  308  EQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgg  487
            +Q +Q PRTLFPGG+KRPEIKVPS+VLQL   +V  +   LD +D+A+S  VGIV+L+G 
Sbjct  57   QQSQQSPRTLFPGGYKRPEIKVPSIVLQLYPDDVLRD-GALDFLDKALSKWVGIVVLNGA  115

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
             V+G  LYEAACLLKSV+++R Y L+ ERVDIAAAVNASGV+LSDQGLP+IVARN M D+
Sbjct  116  DVTGKTLYEAACLLKSVVKDRVYFLIGERVDIAAAVNASGVVLSDQGLPSIVARNMMRDS  175

Query  668  KSESVV  685
            KSES++
Sbjct  176  KSESIL  181



>gb|KHG12136.1| hypothetical protein F383_07635 [Gossypium arboreum]
Length=927

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 133/189 (70%), Gaps = 8/189 (4%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHC--HFASPTP---SHYSPPHFKPRLRCTNISVRAAARSNVSLVF  298
            M+ LLS   S  SPS    HF SP+P   S ++   F+  L  T  S+   + S+ S   
Sbjct  1    MIPLLS-LRSPASPSSALFHF-SPSPPFSSRFTKSPFRRFLPPTKPSLSTNSFSSTSQQL  58

Query  299  NNEE-QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivl  475
              +  Q +Q PRTLFPGG+KRPEIKVP+ VLQL   +V  + N LD ID+AVS  VG+V+
Sbjct  59   GPQGPQNQQAPRTLFPGGYKRPEIKVPNFVLQLDPDDVLADDNALDFIDKAVSKWVGLVV  118

Query  476  lsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  655
            L+GG  SGG++YEAA  LK+V+++RAYLL+ ERVDIAAAV ASGV+LSDQGLP IVARNT
Sbjct  119  LNGGEGSGGRVYEAARSLKAVVKDRAYLLIAERVDIAAAVGASGVVLSDQGLPAIVARNT  178

Query  656  MLDTKSESV  682
            M+D+KS+SV
Sbjct  179  MMDSKSDSV  187



>ref|XP_006575072.1| PREDICTED: uncharacterized protein LOC100785233 isoform X2 [Glycine 
max]
Length=869

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 123/181 (68%), Gaps = 6/181 (3%)
 Frame = +2

Query  158  CSVHSPSHCHFASPTPSH--YSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQ--Q  325
            CSV SPS   F +  P H  +S     P  R     + + +  + S       +P+   Q
Sbjct  4    CSVTSPS-SPFTAIIPRHTFFSRSSSLPLRRARAFPINSLSNGSSSQFNQQLFRPRDPPQ  62

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAvsgrvgivllsgggvsgg  502
            PRTLFPGG+KRPE+KVP+LVLQL   EV   + + L  ID+AVS  VGIV+L+    SGG
Sbjct  63   PRTLFPGGYKRPELKVPTLVLQLDPAEVLSADTDALALIDRAVSKWVGIVVLASNEASGG  122

Query  503  klYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            KLYEAAC LKS+I++RAYLLV ERVDIAAA  ASGVLLSDQGLPT+VARNTMLD+KSE V
Sbjct  123  KLYEAACSLKSLIQDRAYLLVAERVDIAAATAASGVLLSDQGLPTVVARNTMLDSKSELV  182

Query  683  V  685
            V
Sbjct  183  V  183



>ref|XP_003520208.1| PREDICTED: uncharacterized protein LOC100785233 isoform X1 [Glycine 
max]
Length=914

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 123/181 (68%), Gaps = 6/181 (3%)
 Frame = +2

Query  158  CSVHSPSHCHFASPTPSH--YSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQ--Q  325
            CSV SPS   F +  P H  +S     P  R     + + +  + S       +P+   Q
Sbjct  4    CSVTSPS-SPFTAIIPRHTFFSRSSSLPLRRARAFPINSLSNGSSSQFNQQLFRPRDPPQ  62

Query  326  PRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAvsgrvgivllsgggvsgg  502
            PRTLFPGG+KRPE+KVP+LVLQL   EV   + + L  ID+AVS  VGIV+L+    SGG
Sbjct  63   PRTLFPGGYKRPELKVPTLVLQLDPAEVLSADTDALALIDRAVSKWVGIVVLASNEASGG  122

Query  503  klYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            KLYEAAC LKS+I++RAYLLV ERVDIAAA  ASGVLLSDQGLPT+VARNTMLD+KSE V
Sbjct  123  KLYEAACSLKSLIQDRAYLLVAERVDIAAATAASGVLLSDQGLPTVVARNTMLDSKSELV  182

Query  683  V  685
            V
Sbjct  183  V  183



>ref|XP_010070220.1| PREDICTED: uncharacterized protein LOC104457004 isoform X2 [Eucalyptus 
grandis]
Length=861

 Score =   144 bits (364),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 9/130 (7%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNV---------LDEIDQAvsgrvgivl  475
            QPRTLFPGG+KRPEIKVP+LVLQL   +V D  +          LD ID+AVSGRVGIV+
Sbjct  69   QPRTLFPGGYKRPEIKVPTLVLQLDPDDVLDGSSASAAAAAAAALDSIDEAVSGRVGIVV  128

Query  476  lsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  655
            L GG  +G +LYEAACLLKSV+R+RAYLL+ ERVDI +A+NASGVLLSDQGLP IVAR+ 
Sbjct  129  LGGGEGTGKRLYEAACLLKSVVRDRAYLLIAERVDIVSAINASGVLLSDQGLPAIVARSM  188

Query  656  MLDTKSESVV  685
            M D++SESVV
Sbjct  189  MADSRSESVV  198



>ref|XP_008368936.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432519 
[Malus domestica]
Length=737

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 114/180 (63%), Gaps = 15/180 (8%)
 Frame = +2

Query  182  CHFASPTPSHYSP---PHFKPRL--------RCTNISVRAAARSNVSLVFNNEEQPKQQP  328
             H ++  P  Y+P   P  +P L        R T   + + ++++      N + P+  P
Sbjct  7    LHTSTTQPLLYTPTASPSLQPHLSRTKAHPPRRTQFIISSISQNSHRFTSQNPQPPQAHP  66

Query  329  -RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggk  505
             RT FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  + +      G     
Sbjct  67   PRTQFPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSXVLMLNGRDSSGGRL--  124

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
             YEAAC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SVV
Sbjct  125  -YEAACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVV  183



>ref|XP_007144634.1| hypothetical protein PHAVU_007G172000g [Phaseolus vulgaris]
 gb|ESW16628.1| hypothetical protein PHAVU_007G172000g [Phaseolus vulgaris]
Length=914

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 125/182 (69%), Gaps = 7/182 (4%)
 Frame = +2

Query  158  CSVHSPSHCHFASPTPSH--YSPPHFKPRLRCTNISVRAAARSNVSLVFNNEE-QPKQ--  322
            CSV +PS    A+  P H  +S P   P LR +  S   +  +  S  FN++   P    
Sbjct  4    CSVTAPSSSLVAAIIPRHTSFSRPSSLP-LRFSRASPVNSLSNGSSAAFNSQLFSPNDPP  62

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRN-VLDEIDQAvsgrvgivllsgggvsg  499
            QPRTLFPGG+KRPE+KVP+LVLQL + EV    N     ID+AVS  VGIVLLS    SG
Sbjct  63   QPRTLFPGGYKRPELKVPTLVLQLDSDEVLAADNHAFALIDKAVSKWVGIVLLSSKEPSG  122

Query  500  gklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSES  679
            GKLYEAAC LKS++++RAYLLV ERVDIAAA   SGVLLSDQGLPT+VAR+TMLD+KSE 
Sbjct  123  GKLYEAACSLKSLLQDRAYLLVAERVDIAAAAACSGVLLSDQGLPTVVARSTMLDSKSEL  182

Query  680  VV  685
            VV
Sbjct  183  VV  184



>ref|XP_010070219.1| PREDICTED: uncharacterized protein LOC104457004 isoform X1 [Eucalyptus 
grandis]
Length=938

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 104/130 (80%), Gaps = 9/130 (7%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNV---------LDEIDQAvsgrvgivl  475
            QPRTLFPGG+KRPEIKVP+LVLQL   +V D  +          LD ID+AVSGRVGIV+
Sbjct  69   QPRTLFPGGYKRPEIKVPTLVLQLDPDDVLDGSSASAAAAAAAALDSIDEAVSGRVGIVV  128

Query  476  lsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  655
            L GG  +G +LYEAACLLKSV+R+RAYLL+ ERVDI +A+NASGVLLSDQGLP IVAR+ 
Sbjct  129  LGGGEGTGKRLYEAACLLKSVVRDRAYLLIAERVDIVSAINASGVLLSDQGLPAIVARSM  188

Query  656  MLDTKSESVV  685
            M D++SESVV
Sbjct  189  MADSRSESVV  198



>ref|XP_002307580.2| hypothetical protein POPTR_0005s23080g [Populus trichocarpa]
 gb|EEE94576.2| hypothetical protein POPTR_0005s23080g [Populus trichocarpa]
Length=926

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 124/189 (66%), Gaps = 17/189 (9%)
 Frame = +2

Query  155  CCSVHSP------SHC--HFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEE  310
              S+HSP      +H   H ++P P   SPPH     R  +  + +   +       N+ 
Sbjct  4    LLSLHSPKPSLFLTHFLPHLSTPLPRFKSPPH-----RTHHFPIHSFPNNQQQQQPANQN  58

Query  311  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivll---  478
               QQPRTLFPGG+KRPEIKVP++VLQL  ++V       LD ID+AVS  VGIV+L   
Sbjct  59   LSNQQPRTLFPGGYKRPEIKVPNIVLQLDPEDVIRGGSEALDLIDKAVSKSVGIVILNGS  118

Query  479  sgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
             GGG SG  LYEAACL+ SV+R+RAYLL+ ERVDIA AVNASGV+LSDQGLP +VARN M
Sbjct  119  IGGGGSGKSLYEAACLVNSVVRDRAYLLIGERVDIATAVNASGVVLSDQGLPALVARNMM  178

Query  659  LDTKSESVV  685
            + +++ESVV
Sbjct  179  MGSRTESVV  187



>ref|XP_008449445.1| PREDICTED: uncharacterized protein LOC103491330 [Cucumis melo]
Length=924

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K QPRTLFP GFKRPEIKVP +VLQL   EV    N LD ID+AVS  VGIV+L+ G   
Sbjct  66   KLQPRTLFPSGFKRPEIKVPCVVLQLDAAEVLAGDNALDLIDRAVSKWVGIVVLNSGEGG  125

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GGKLYEAAC LKS++ +RAYLL+ ERVDIA AV ASGV+LSDQGLP IVARNTMLD+ S+
Sbjct  126  GGKLYEAACKLKSIVGDRAYLLIAERVDIATAVGASGVVLSDQGLPPIVARNTMLDSTSD  185

Query  677  SV  682
            S+
Sbjct  186  SL  187



>ref|XP_004290657.1| PREDICTED: uncharacterized protein LOC101291108 [Fragaria vesca 
subsp. vesca]
Length=914

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  311  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsggg  490
            Q  Q PRT FPGGFKRPEIK+P++VLQL  +EV  + +VL  +D+AVS  VGI++L G  
Sbjct  57   QNPQPPRTQFPGGFKRPEIKLPNIVLQLDPEEVLASDDVLPLVDKAVSKWVGILVLDGRQ  116

Query  491  vsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTK  670
             +GG+LY+AAC LKS++R+RAYLL+ ERVDIAAA NASG+LLSDQGLPTIVAR TM+ +K
Sbjct  117  ANGGRLYDAACKLKSLVRDRAYLLISERVDIAAAANASGILLSDQGLPTIVARTTMMASK  176

Query  671  SESVV  685
            S+SV+
Sbjct  177  SDSVI  181



>ref|XP_007050625.1| FZO-like [Theobroma cacao]
 gb|EOX94782.1| FZO-like [Theobroma cacao]
Length=926

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 14/186 (8%)
 Frame = +2

Query  158  CSVHSPSHCH--FASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSL--VFNNEEQ----  313
             S+HSP+     F   TPS   PPHF    R  +       +S++S    ++  +Q    
Sbjct  4    LSLHSPASTSAPFFLFTPS---PPHFPRFARSPHRRFLLPTKSSLSNNPFYSTSQQLSPQ  60

Query  314  ---PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsg  484
                +Q PRTLFPGG+KRPEIKVP++VLQL  +EV  + N LD ID+AVS  VG+V+L+G
Sbjct  61   DPQNQQPPRTLFPGGYKRPEIKVPNVVLQLDPEEVLADGNALDFIDKAVSKWVGLVVLNG  120

Query  485  ggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  664
            G  SGG++YEAA  LK+V+++RAY L+ ERVDIAAAV ASGV+LSDQGLP IVARNTM+D
Sbjct  121  GEGSGGRVYEAARSLKAVVKDRAYFLITERVDIAAAVRASGVVLSDQGLPAIVARNTMMD  180

Query  665  TKSESV  682
            +KSESV
Sbjct  181  SKSESV  186



>ref|XP_011032720.1| PREDICTED: uncharacterized protein LOC105131442 [Populus euphratica]
Length=926

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/189 (51%), Positives = 121/189 (64%), Gaps = 17/189 (9%)
 Frame = +2

Query  155  CCSVHSPS--------HCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEE  310
              S+HSP         H H ++P P    PPH     R  +  + +   +       N+ 
Sbjct  4    LLSLHSPKPSLFLTHFHPHLSTPLPRFKPPPH-----RTHHFPIHSFPNNQQQQQPANQN  58

Query  311  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivll---  478
               QQPRTLFPGG+KRP IKVP++VLQL  ++V       LD ID+AVS  VGIV+L   
Sbjct  59   LSNQQPRTLFPGGYKRPVIKVPNVVLQLDPEDVIRGGSEALDLIDKAVSKSVGIVILNGS  118

Query  479  sgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
             GGG SG  LYEAACL+ SV+R+RAYLL+ ERVDIA AVNASGV+LSD+GLP IVARN M
Sbjct  119  IGGGGSGKSLYEAACLVNSVVRDRAYLLIGERVDIATAVNASGVVLSDEGLPAIVARNMM  178

Query  659  LDTKSESVV  685
            + +++ESVV
Sbjct  179  MGSRTESVV  187



>ref|XP_009355473.1| PREDICTED: uncharacterized protein LOC103946491 [Pyrus x bretschneideri]
Length=921

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  338  FPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggklYEA  517
            FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  VG+++L+G   SGG+LYEA
Sbjct  71   FPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLVLNGRDSSGGRLYEA  130

Query  518  ACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            AC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SVV
Sbjct  131  ACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVV  186



>ref|XP_003590651.1| GTP-binding protein engA [Medicago truncatula]
 gb|AES60902.1| FZO-like protein [Medicago truncatula]
Length=914

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 108/138 (78%), Gaps = 2/138 (1%)
 Frame = +2

Query  278  SNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAvs  454
            +N S  F  + Q + QPRTLFPGG+KRPE++VP+L+LQL++ ++     + LD ID+AVS
Sbjct  49   NNASRHFFPKTQAQAQPRTLFPGGYKRPELRVPTLILQLNSDQILTRGESALDLIDKAVS  108

Query  455  grvgivllsgg-gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGL  631
              VGIV+L+     SGGKLYEAACLLKS+IR+RAYLLV ERVDIAAA   SGVLLSDQGL
Sbjct  109  KSVGIVILTSDDEQSGGKLYEAACLLKSLIRDRAYLLVAERVDIAAAAVTSGVLLSDQGL  168

Query  632  PTIVARNTMLDTKSESVV  685
            PT+VARNTML + SE VV
Sbjct  169  PTVVARNTMLGSNSELVV  186



>ref|XP_009367692.1| PREDICTED: uncharacterized protein LOC103957273 [Pyrus x bretschneideri]
Length=921

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = +2

Query  338  FPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggklYEA  517
            FPGGFKRPE++VP++VLQL   EV    + LD +D+AVS  VG+++L+G   SGG+LYEA
Sbjct  71   FPGGFKRPEVRVPNVVLQLDPDEVLAGEDALDLVDKAVSKWVGVLVLNGRDSSGGRLYEA  130

Query  518  ACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            AC LKSVIR+RAYLL+ ERVDIAAA NASGVLLSDQGLPTIVAR+TM+ +KS+SVV
Sbjct  131  ACKLKSVIRDRAYLLISERVDIAAAANASGVLLSDQGLPTIVARSTMMASKSDSVV  186



>ref|XP_004495204.1| PREDICTED: uncharacterized protein LOC101505859 isoform X2 [Cicer 
arietinum]
Length=892

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +2

Query  311  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAvsgrvgivllsgg  487
            Q + QPRTLFPGG+KRP+++VP+L+LQL+  ++   +++ LD ID+AVS  VGIV+LS  
Sbjct  63   QAQAQPRTLFPGGYKRPKLQVPTLILQLNPDDILTRDQSALDMIDKAVSKSVGIVVLSSN  122

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
              SGGKLYEAAC+LKS++R+RAYLLV ERVDIAAA   SGVLLSDQGLPT+VARNTML +
Sbjct  123  EQSGGKLYEAACMLKSLVRDRAYLLVAERVDIAAAAVTSGVLLSDQGLPTVVARNTMLGS  182

Query  668  KSESVV  685
             +E VV
Sbjct  183  NAELVV  188



>ref|XP_004495203.1| PREDICTED: uncharacterized protein LOC101505859 isoform X1 [Cicer 
arietinum]
Length=926

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 104/126 (83%), Gaps = 1/126 (1%)
 Frame = +2

Query  311  QPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAvsgrvgivllsgg  487
            Q + QPRTLFPGG+KRP+++VP+L+LQL+  ++   +++ LD ID+AVS  VGIV+LS  
Sbjct  63   QAQAQPRTLFPGGYKRPKLQVPTLILQLNPDDILTRDQSALDMIDKAVSKSVGIVVLSSN  122

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
              SGGKLYEAAC+LKS++R+RAYLLV ERVDIAAA   SGVLLSDQGLPT+VARNTML +
Sbjct  123  EQSGGKLYEAACMLKSLVRDRAYLLVAERVDIAAAAVTSGVLLSDQGLPTVVARNTMLGS  182

Query  668  KSESVV  685
             +E VV
Sbjct  183  NAELVV  188



>gb|KJB23087.1| hypothetical protein B456_004G080200 [Gossypium raimondii]
Length=850

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGG+KRPEIKVP+ VLQL   +V  + N LD ID+AVS  VG+V+L+GG  SGG++
Sbjct  70   RTLFPGGYKRPEIKVPNFVLQLDPNDVLADDNALDFIDKAVSKWVGLVVLNGGEGSGGRV  129

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAA  LK+V+++RAYLL+ ERVDIAAAV ASGV+LSDQGLP IVARNTM+D+KS+SV
Sbjct  130  YEAARSLKAVVKDRAYLLIAERVDIAAAVGASGVVLSDQGLPAIVARNTMMDSKSDSV  187



>gb|KJB23088.1| hypothetical protein B456_004G080200 [Gossypium raimondii]
Length=927

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGG+KRPEIKVP+ VLQL   +V  + N LD ID+AVS  VG+V+L+GG  SGG++
Sbjct  70   RTLFPGGYKRPEIKVPNFVLQLDPNDVLADDNALDFIDKAVSKWVGLVVLNGGEGSGGRV  129

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAA  LK+V+++RAYLL+ ERVDIAAAV ASGV+LSDQGLP IVARNTM+D+KS+SV
Sbjct  130  YEAARSLKAVVKDRAYLLIAERVDIAAAVGASGVVLSDQGLPAIVARNTMMDSKSDSV  187



>ref|XP_004140223.1| PREDICTED: uncharacterized protein LOC101213431 [Cucumis sativus]
 gb|KGN47899.1| hypothetical protein Csa_6G410050 [Cucumis sativus]
Length=924

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K QPRTLFP GFKRPEIKVP +VLQL   EV    + LD +D+AVS  VGIV+L+ G   
Sbjct  66   KPQPRTLFPSGFKRPEIKVPCVVLQLDAAEVLAGDDALDLVDRAVSKWVGIVVLNSGEGG  125

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GGKLYEAAC LKS++ +RAYLL+ ERVDIA AV ASGV+LSDQGLP IVARNTMLD+ S+
Sbjct  126  GGKLYEAACKLKSLVGDRAYLLIAERVDIATAVGASGVVLSDQGLPPIVARNTMLDSTSD  185

Query  677  SV  682
            S+
Sbjct  186  SL  187



>ref|XP_004167583.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213431 
[Cucumis sativus]
Length=924

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K QPRTLFP GFKRPEIKVP +VLQL   EV    + LD +D+AVS  VGIV+L+ G   
Sbjct  66   KPQPRTLFPSGFKRPEIKVPCVVLQLDAAEVLAGDDALDLVDRAVSKWVGIVVLNSGEGG  125

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GGKLYEAAC LKS++ +RAYLL+ ERVDIA AV ASGV+LSDQGLP IVARNTMLD+ S+
Sbjct  126  GGKLYEAACKLKSLVGDRAYLLIAERVDIATAVGASGVVLSDQGLPPIVARNTMLDSTSD  185

Query  677  SV  682
            S+
Sbjct  186  SL  187



>ref|XP_008783174.1| PREDICTED: uncharacterized protein LOC103702498 isoform X1 [Phoenix 
dactylifera]
Length=922

 Score =   136 bits (343),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  308  EQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgg  487
            EQ ++Q RTLFPGGFKRPEIKVP+LVL+L  +EV      + EID AV+  VG+V+L  G
Sbjct  58   EQQQRQLRTLFPGGFKRPEIKVPTLVLRLRAEEVLRREGSIAEIDVAVAKGVGMVVLDCG  117

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
              SGG LYEAAC LKSVI +RAY L+ ERVDIAAAV ASGV+LSD+G+P IVARN M+ +
Sbjct  118  DESGGGLYEAACSLKSVIGDRAYFLIAERVDIAAAVGASGVVLSDKGIPAIVARNMMMQS  177

Query  668  KSESV  682
            K +SV
Sbjct  178  KPDSV  182



>ref|XP_003536908.1| PREDICTED: uncharacterized protein LOC100808213 [Glycine max]
Length=915

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 122/190 (64%), Gaps = 22/190 (12%)
 Frame = +2

Query  158  CSVHSPSHCHFASPTPSHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQ--------  313
            CSV SPS   F +  P H          R  ++ +R A    ++ + NN E         
Sbjct  4    CSVTSPS-SPFTAIIPRHTHS-------RSPSLPLRVARAFPINSLSNNAESSAQFNQQL  55

Query  314  -----PKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFD-NRNVLDEIDQAvsgrvgivl  475
                 P QQPRTLFPGG+KRPE+ VP+LVLQL   E    + + L  ID+AVS  VGIV+
Sbjct  56   FRPSYPPQQPRTLFPGGYKRPELNVPTLVLQLDPDEFLSADTDALALIDKAVSKWVGIVV  115

Query  476  lsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNT  655
            L+    SGGKLYEAAC LKS++++RAYLLV ERVDIAAA  ASGVLLSDQGLPT+VARN 
Sbjct  116  LASNQASGGKLYEAACSLKSLLQDRAYLLVAERVDIAAAAAASGVLLSDQGLPTVVARNM  175

Query  656  MLDTKSESVV  685
            MLD+KSE VV
Sbjct  176  MLDSKSELVV  185



>gb|AAD25810.1|AC006550_18 F10O3.1, partial [Arabidopsis thaliana]
Length=823

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 131/217 (60%), Gaps = 29/217 (13%)
 Frame = +2

Query  62   HHRRRSQLPPPSNSVFFHTSSNLSMVSLLSQCCSVHSPSHCHFASP-------TPSHYSP  220
             HRRR          +   S +LSM +L+S    V SP     ASP         S ++P
Sbjct  25   KHRRR----------YLTLSLSLSMRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTP  74

Query  221  PHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLST  400
            P  +   R +++S+R  +  +       ++    +PRTL+PGG+KRPE+ VP L+L+L  
Sbjct  75   PRHR---RFSSLSIRNISHESA------DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDA  125

Query  401  QEVF-DNRN-VLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYLLVDER  574
             EV   NR   LD +D+A++  V IV++ GG  +G   YEAACLLKS+++ RAYLL+ ER
Sbjct  126  DEVMSGNREETLDLVDRALAKSVQIVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAER  184

Query  575  VDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            VDIA+AV ASGV LSD+GLP IVARNT++ +  +SV+
Sbjct  185  VDIASAVGASGVALSDEGLPAIVARNTLMGSNPDSVL  221



>ref|XP_010927024.1| PREDICTED: uncharacterized protein LOC105049151 isoform X2 [Elaeis 
guineensis]
Length=881

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGGFKRPEIKVP+LVL+LS +EV      + +ID AV+  VG+V+L  GG SGG+L
Sbjct  71   RTLFPGGFKRPEIKVPTLVLRLSAEEVLRGEESIAQIDVAVAKGVGMVVLDCGGESGGRL  130

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAAC LKSVI +RAY L+ ERVDIA+AV ASGV+LSD+G+P IVARN M+ +K +SV
Sbjct  131  YEAACRLKSVIGDRAYFLIAERVDIASAVGASGVVLSDKGIPAIVARNMMMKSKPDSV  188



>ref|XP_010927023.1| PREDICTED: uncharacterized protein LOC105049151 isoform X1 [Elaeis 
guineensis]
Length=928

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGGFKRPEIKVP+LVL+LS +EV      + +ID AV+  VG+V+L  GG SGG+L
Sbjct  71   RTLFPGGFKRPEIKVPTLVLRLSAEEVLRGEESIAQIDVAVAKGVGMVVLDCGGESGGRL  130

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAAC LKSVI +RAY L+ ERVDIA+AV ASGV+LSD+G+P IVARN M+ +K +SV
Sbjct  131  YEAACRLKSVIGDRAYFLIAERVDIASAVGASGVVLSDKGIPAIVARNMMMKSKPDSV  188



>ref|XP_010927025.1| PREDICTED: uncharacterized protein LOC105049151 isoform X3 [Elaeis 
guineensis]
Length=872

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGGFKRPEIKVP+LVL+LS +EV      + +ID AV+  VG+V+L  GG SGG+L
Sbjct  71   RTLFPGGFKRPEIKVPTLVLRLSAEEVLRGEESIAQIDVAVAKGVGMVVLDCGGESGGRL  130

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAAC LKSVI +RAY L+ ERVDIA+AV ASGV+LSD+G+P IVARN M+ +K +SV
Sbjct  131  YEAACRLKSVIGDRAYFLIAERVDIASAVGASGVVLSDKGIPAIVARNMMMKSKPDSV  188



>gb|AAQ65198.1| At1g03160 [Arabidopsis thaliana]
Length=642

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 122/193 (63%), Gaps = 19/193 (10%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASP-------TPSHYSPPHFKPRLRCTNISVRAAARSNVSL  292
            M +L+S    V SP     ASP         S ++PP  +   R +++S+R  +  +   
Sbjct  1    MRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTPPRHR---RFSSLSIRNISHESA--  55

Query  293  VFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvg  466
                ++    +PRTL+PGG+KRPE+ VP L+L+L   EV   NR   LD +D+A++  V 
Sbjct  56   ----DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQ  111

Query  467  ivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVA  646
            IV++ GG  +G   YEAACLLKS+++ RAYLL+ ERVDIA+AV ASGV LSD+GLP IVA
Sbjct  112  IVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGASGVALSDEGLPAIVA  170

Query  647  RNTMLDTKSESVV  685
            RNT++ +  +SV+
Sbjct  171  RNTLMGSNPDSVL  183



>ref|NP_001077452.1| FZO-like protein [Arabidopsis thaliana]
 dbj|BAD44060.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAE99647.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27538.1| FZO-like protein [Arabidopsis thaliana]
Length=740

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 122/193 (63%), Gaps = 19/193 (10%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASP-------TPSHYSPPHFKPRLRCTNISVRAAARSNVSL  292
            M +L+S    V SP     ASP         S ++PP  +   R +++S+R  +  +   
Sbjct  1    MRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTPPRHR---RFSSLSIRNISHESA--  55

Query  293  VFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvg  466
                ++    +PRTL+PGG+KRPE+ VP L+L+L   EV   NR   LD +D+A++  V 
Sbjct  56   ----DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQ  111

Query  467  ivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVA  646
            IV++ GG  +G   YEAACLLKS+++ RAYLL+ ERVDIA+AV ASGV LSD+GLP IVA
Sbjct  112  IVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGASGVALSDEGLPAIVA  170

Query  647  RNTMLDTKSESVV  685
            RNT++ +  +SV+
Sbjct  171  RNTLMGSNPDSVL  183



>ref|NP_171815.3| FZO-like protein [Arabidopsis thaliana]
 gb|ABE96616.1| FZL [Arabidopsis thaliana]
 gb|AEE27537.1| FZO-like protein [Arabidopsis thaliana]
Length=912

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 122/193 (63%), Gaps = 19/193 (10%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASP-------TPSHYSPPHFKPRLRCTNISVRAAARSNVSL  292
            M +L+S    V SP     ASP         S ++PP  +   R +++S+R  +  +   
Sbjct  1    MRTLISHRQCVTSPFLISAASPPFPGRCFKLSSFTPPRHR---RFSSLSIRNISHESA--  55

Query  293  VFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvg  466
                ++    +PRTL+PGG+KRPE+ VP L+L+L   EV   NR   LD +D+A++  V 
Sbjct  56   ----DQTSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQ  111

Query  467  ivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVA  646
            IV++ GG  +G   YEAACLLKS+++ RAYLL+ ERVDIA+AV ASGV LSD+GLP IVA
Sbjct  112  IVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGASGVALSDEGLPAIVA  170

Query  647  RNTMLDTKSESVV  685
            RNT++ +  +SV+
Sbjct  171  RNTLMGSNPDSVL  183



>ref|XP_006418260.1| hypothetical protein EUTSA_v10006729mg [Eutrema salsugineum]
 gb|ESQ36613.1| hypothetical protein EUTSA_v10006729mg [Eutrema salsugineum]
Length=926

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 113/162 (70%), Gaps = 12/162 (7%)
 Frame = +2

Query  206  SHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLV  385
            S +SPP  +   R +++S++     NVS    ++  P  +PRTL+PGG+KRPE+ VP L+
Sbjct  34   SSFSPPRHR---RISSLSIK-----NVSHESADQSSP-SRPRTLYPGGYKRPELAVPGLL  84

Query  386  LQLSTQEVF-DNRN-VLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYL  559
            L++   E+   NR+  LD +D+A++  V IV+L GG  +G   YEAACLLKS+++ RAYL
Sbjct  85   LRIDADEIMSGNRDETLDLVDRALAKSVQIVVLDGGATAGRL-YEAACLLKSLVKGRAYL  143

Query  560  LVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            L+ ERVDIA AV ASGV LSD+GLP IVARNT++ +  +SVV
Sbjct  144  LIAERVDIATAVGASGVALSDEGLPAIVARNTLMGSNPDSVV  185



>ref|XP_006851107.1| hypothetical protein AMTR_s00025p00248100 [Amborella trichopoda]
 gb|ERN12688.1| hypothetical protein AMTR_s00025p00248100 [Amborella trichopoda]
Length=947

 Score =   125 bits (314),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 0/119 (0%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            +TLFPGGFKR EIKVP+L+LQL   EV +  + L   D AVS  V +V+L+GG  S G++
Sbjct  90   KTLFPGGFKRAEIKVPTLILQLEVAEVLEGGDALRFTDAAVSEMVSMVVLNGGDESAGRI  149

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            YEAA  LK V+R  +YLL+ ERVDIA+AV A+GV+LSDQGLP I+ARN M+++KSES+V
Sbjct  150  YEAALALKRVLRGSSYLLISERVDIASAVGANGVVLSDQGLPAIIARNMMMESKSESIV  208



>ref|XP_010474923.1| PREDICTED: uncharacterized protein LOC104754425 isoform X2 [Camelina 
sativa]
Length=761

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 8/150 (5%)
 Frame = +2

Query  242  RCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DN  418
            R +++S+R     NVS    ++     +PRTL+PGG+KRPE+ VP L+L+L   EV   N
Sbjct  44   RLSSLSIR-----NVSHESADQTSSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGN  98

Query  419  RN-VLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAV  595
            R   LD +D+A++  V IV++ GG  +G   YEAACLLKS+++ RAYLL+ ERVDIA+AV
Sbjct  99   REETLDLVDRALAKSVQIVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAV  157

Query  596  NASGVLLSDQGLPTIVARNTMLDTKSESVV  685
             A+GV LSD+GLP IVARNT++ T  +SVV
Sbjct  158  GATGVALSDEGLPAIVARNTLMGTNPDSVV  187



>ref|XP_010474922.1| PREDICTED: uncharacterized protein LOC104754425 isoform X1 [Camelina 
sativa]
Length=932

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 8/150 (5%)
 Frame = +2

Query  242  RCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DN  418
            R +++S+R     NVS    ++     +PRTL+PGG+KRPE+ VP L+L+L   EV   N
Sbjct  44   RLSSLSIR-----NVSHESADQTSSSSRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGN  98

Query  419  RN-VLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAV  595
            R   LD +D+A++  V IV++ GG  +G   YEAACLLKS+++ RAYLL+ ERVDIA+AV
Sbjct  99   REETLDLVDRALAKSVQIVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAV  157

Query  596  NASGVLLSDQGLPTIVARNTMLDTKSESVV  685
             A+GV LSD+GLP IVARNT++ T  +SVV
Sbjct  158  GATGVALSDEGLPAIVARNTLMGTNPDSVV  187



>ref|XP_010522727.1| PREDICTED: uncharacterized protein LOC104801235 isoform X2 [Tarenaya 
hassleriana]
Length=724

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  281  NVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDN-RNVLDEIDQAvsg  457
            N+S    +++ P  +PRT++PGG+KRPEI VP L+L+L   E+    R+    +      
Sbjct  55   NISYDSADQDLP-SRPRTVYPGGYKRPEIPVPGLLLKLDADELLSGSRDEALALVGRALA  113

Query  458  rvgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPT  637
            +   +++  GG +GG+LYEAACLLKSV++ RAYLL+ ERVDIA AV ASGV+LSDQGLP 
Sbjct  114  KSIEIVVLDGGATGGRLYEAACLLKSVVKGRAYLLISERVDIATAVGASGVVLSDQGLPA  173

Query  638  IVARNTMLDTKSESVV  685
            IVARNTM+ + SESVV
Sbjct  174  IVARNTMMGSNSESVV  189



>ref|XP_002889440.1| hypothetical protein ARALYDRAFT_470295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65699.1| hypothetical protein ARALYDRAFT_470295 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 121/195 (62%), Gaps = 23/195 (12%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASP--------TPSHYSPPHFK-PRLRCTNISVRAAARSNV  286
            M +L+S    V SP     ASP          S  +P H + P L   N+S  +A +++ 
Sbjct  1    MRTLISHRQCVTSPFLISAASPPFPGRCFQLSSFTAPRHRRLPSLSIRNVSHESADQTSS  60

Query  287  SLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgr  460
            S           +PRTL+PGG+KRPE+ VP ++L+L   EV   NR   +D +D+A++  
Sbjct  61   S-----------RPRTLYPGGYKRPELAVPGVLLRLDADEVMSGNREETVDLVDRALAKS  109

Query  461  vgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTI  640
            V IV++ GG  +G   YEAACLLKS+++ RAYLL+ ERVDIA+AV ASGV LSD+GLP I
Sbjct  110  VQIVVIDGGATAGKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGASGVALSDEGLPAI  168

Query  641  VARNTMLDTKSESVV  685
            VARNT++ +  +SVV
Sbjct  169  VARNTLMGSNPDSVV  183



>ref|XP_010522715.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522716.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522717.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522719.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522720.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522721.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522722.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522723.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522724.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522725.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522726.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
Length=932

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = +2

Query  281  NVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDN-RNVLDEIDQAvsg  457
            N+S    +++ P  +PRT++PGG+KRPEI VP L+L+L   E+    R+    +      
Sbjct  55   NISYDSADQDLP-SRPRTVYPGGYKRPEIPVPGLLLKLDADELLSGSRDEALALVGRALA  113

Query  458  rvgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPT  637
            +   +++  GG +GG+LYEAACLLKSV++ RAYLL+ ERVDIA AV ASGV+LSDQGLP 
Sbjct  114  KSIEIVVLDGGATGGRLYEAACLLKSVVKGRAYLLISERVDIATAVGASGVVLSDQGLPA  173

Query  638  IVARNTMLDTKSESVV  685
            IVARNTM+ + SESVV
Sbjct  174  IVARNTMMGSNSESVV  189



>ref|XP_009401044.1| PREDICTED: uncharacterized protein LOC103985144 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=833

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGGFKRPE+ +P+LVL+LS  EV +      ++D A+  RVG+V+L GG  SG +L
Sbjct  72   RTLFPGGFKRPELNIPTLVLRLSVDEVLEREA---DVDVALLKRVGVVVLDGGDQSGARL  128

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAAC LKS++R+RAYLL+ ERVDIAAAV ASGV+LSD  +P +VARN M+ ++S+SV
Sbjct  129  YEAACALKSLLRDRAYLLIAERVDIAAAVGASGVVLSDSAIPALVARNMMMKSRSDSV  186



>ref|XP_009401043.1| PREDICTED: uncharacterized protein LOC103985144 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=926

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 93/118 (79%), Gaps = 3/118 (3%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGGFKRPE+ +P+LVL+LS  EV +      ++D A+  RVG+V+L GG  SG +L
Sbjct  72   RTLFPGGFKRPELNIPTLVLRLSVDEVLEREA---DVDVALLKRVGVVVLDGGDQSGARL  128

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            YEAAC LKS++R+RAYLL+ ERVDIAAAV ASGV+LSD  +P +VARN M+ ++S+SV
Sbjct  129  YEAACALKSLLRDRAYLLIAERVDIAAAVGASGVVLSDSAIPALVARNMMMKSRSDSV  186



>ref|XP_006306709.1| hypothetical protein CARUB_v10008235mg [Capsella rubella]
 gb|EOA39607.1| hypothetical protein CARUB_v10008235mg [Capsella rubella]
Length=929

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvgivllsgggvs  496
            +PRTL+PGG+KRPE+ VP L+L+L   EV   NR   LD +D+A++  V IV++ GG  +
Sbjct  65   RPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQIVVIDGGATA  124

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            G   YEAACLLKS+++ RAYLL+ ERVDIA AV ASGV LSD+GLP IVARNT++ +  +
Sbjct  125  GKL-YEAACLLKSLVKGRAYLLIAERVDIATAVGASGVALSDEGLPAIVARNTLMGSNPD  183

Query  677  SVV  685
            S+V
Sbjct  184  SIV  186



>ref|XP_010474935.1| PREDICTED: uncharacterized protein LOC104754437 [Camelina sativa]
Length=930

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvgivllsgggvs  496
            +PRTL+PGG+KRPE+ VP L+L+L   EV   NR   LD +D+A++  V IV++ GG  +
Sbjct  65   RPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQIVVIDGGATA  124

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            G   YEAACLLKS+++ RAYLL+ ERVDIA+AV A+GV LSD+GLP IVARNT++ +  +
Sbjct  125  GKL-YEAACLLKSLVKGRAYLLIAERVDIASAVGATGVALSDEGLPAIVARNTLMGSNPD  183

Query  677  SVV  685
            SVV
Sbjct  184  SVV  186



>gb|EPS64568.1| hypothetical protein M569_10214, partial [Genlisea aurea]
Length=146

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  239  LRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDN  418
            LRC+  +  A A     L  ++    +  PR+LFPGG+KRPEI +P+L+L+L   EV  +
Sbjct  18   LRCSATASTAVAGVRKHLCPDSGHINQNPPRSLFPGGYKRPEISLPNLLLRLRADEVLSD  77

Query  419  RNVLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVN  598
             +VL+ +D+AVS R+GIV+L+GG  SG KLYEAA LLKSVIR+RAYLL+D+R+DIAAA+ 
Sbjct  78   GDVLNLVDEAVSDRIGIVVLTGGKNSGRKLYEAAGLLKSVIRDRAYLLIDDRIDIAAAIK  137

Query  599  ASGVLLSDQ  625
            ASGVLLSD+
Sbjct  138  ASGVLLSDK  146



>emb|CDX86689.1| BnaC08g00140D [Brassica napus]
Length=909

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 126/193 (65%), Gaps = 19/193 (10%)
 Frame = +2

Query  134  MVSLLSQCCSVHSPSHCHFASP-------TPSHYSPPHFKPRLRCTNISVRAAARSNVSL  292
            M +LLSQ   V SP     + P         S +SPP  K   R +++S+R     N SL
Sbjct  1    MRTLLSQRPCVTSPLLISASFPPFPRRCIRLSSFSPPRHK---RLSSLSIR-----NASL  52

Query  293  VFNNEEQPKQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvg  466
               ++  P  +PRTL+PGG+KRPE+ VP L+L+L   EV   NR+  LD ID+A++  V 
Sbjct  53   ESADQTSP-SRPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNRDETLDLIDRALTKSVQ  111

Query  467  ivllsgggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVA  646
            IV+L GG  +G   YEAACLLKS+++ RAYLL+ ERVDIAAAV ASGV LSD+GLP IVA
Sbjct  112  IVVLDGGDTAGKL-YEAACLLKSLVKGRAYLLIAERVDIAAAVGASGVALSDEGLPAIVA  170

Query  647  RNTMLDTKSESVV  685
            RNT++ + SESVV
Sbjct  171  RNTLMGSNSESVV  183



>ref|XP_010481655.1| PREDICTED: uncharacterized protein LOC104760424 [Camelina sativa]
Length=930

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRN-VLDEIDQAvsgrvgivllsgggvs  496
            +PRTL+PGG+KRPE+ VP L+L+L   EV   NR   LD +D+A++  V IV++ GG  +
Sbjct  65   RPRTLYPGGYKRPELAVPGLLLRLDADEVMSGNREETLDLVDRALAKSVQIVVIDGGATA  124

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            G   YEAACLLKS+++ RAYL++ ERVDIA AV A+GV LSD+GLP IVARNT++ +  +
Sbjct  125  GKL-YEAACLLKSLVKGRAYLMIAERVDIATAVGATGVALSDEGLPAIVARNTLMGSNPD  183

Query  677  SVV  685
            SVV
Sbjct  184  SVV  186



>ref|XP_009111165.1| PREDICTED: uncharacterized protein LOC103836629 [Brassica rapa]
Length=909

 Score =   119 bits (299),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 12/162 (7%)
 Frame = +2

Query  206  SHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLV  385
            S +SPP  K   R +++S+R     N SL   ++  P  +PRTL+PGG+KRPE+ VP L+
Sbjct  32   SSFSPPRHK---RLSSLSIR-----NASLESADQTSP-SRPRTLYPGGYKRPELAVPGLL  82

Query  386  LQLSTQEVF-DNRN-VLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYL  559
            L+L   EV   NR+  LD ID+A++  V IV+L GG  +G   YEAACLLKS+++ RAYL
Sbjct  83   LRLDADEVMSGNRDETLDLIDRALAKSVQIVVLDGGVNAGKL-YEAACLLKSLVKGRAYL  141

Query  560  LVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            L+ ERVDIAAAV ASGV LSD+GLP IVARNT++ + SESVV
Sbjct  142  LIAERVDIAAAVGASGVALSDEGLPAIVARNTLMGSNSESVV  183



>emb|CDY15452.1| BnaA08g27360D [Brassica napus]
Length=907

 Score =   119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 115/162 (71%), Gaps = 12/162 (7%)
 Frame = +2

Query  206  SHYSPPHFKPRLRCTNISVRAAARSNVSLVFNNEEQPKQQPRTLFPGGFKRPEIKVPSLV  385
            S +SPP  K   R +++S+R     N SL   ++  P  +PRTL+PGG+KRPE+ VP L+
Sbjct  32   SSFSPPRHK---RLSSLSIR-----NASLESADQTSP-SRPRTLYPGGYKRPELAVPGLL  82

Query  386  LQLSTQEVF-DNRN-VLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIRERAYL  559
            L+L   EV   NR+  LD ID+A++  V IV+L GG  +G   YEAACLLKS+++ RAYL
Sbjct  83   LRLDADEVMSGNRDETLDLIDRALAKSVQIVVLDGGVNAGKL-YEAACLLKSLVKGRAYL  141

Query  560  LVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            L+ ERVDIAAAV ASGV LSD+GLP IVARNT++ + SESVV
Sbjct  142  LIAERVDIAAAVGASGVALSDEGLPAIVARNTLMGSNSESVV  183



>ref|XP_011026335.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105126973 
[Populus euphratica]
Length=1020

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 92/126 (73%), Gaps = 7/126 (6%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivll------sgg  487
            RTLFPGG+KRPEIKV ++V QL +++V        D ID+AVS  VGIV+L       G 
Sbjct  140  RTLFPGGYKRPEIKVANIVPQLDSEDVIRSGSEASDLIDKAVSKSVGIVVLNGGSDGDGR  199

Query  488  gvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDT  667
            G  G  LYEAA L+KSV+R+RAYLL+ ERVDIAAAVNA GV+LSDQGLP  V RN ++ +
Sbjct  200  GGRGKSLYEAAFLVKSVVRDRAYLLIGERVDIAAAVNARGVVLSDQGLPAFVVRNMLMGS  259

Query  668  KSESVV  685
            KSESVV
Sbjct  260  KSESVV  265



>ref|XP_010233244.1| PREDICTED: uncharacterized protein LOC100838168 [Brachypodium 
distachyon]
Length=965

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            KQ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGIV+L  G   
Sbjct  103  KQPPRTLFPGGFKRPEIQVPALVLRVGVDEALGSG---DTVASAVARGVGIVVLEAGEEG  159

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG+ YEAA  LK+ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + SE
Sbjct  160  GGRAYEAARALKAAVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSE  219

Query  677  SV  682
            S+
Sbjct  220  SI  221



>ref|XP_004963794.1| PREDICTED: uncharacterized protein LOC101755934, partial [Setaria 
italica]
Length=895

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K+ PRTLFPGGFKRPEI+VP+LVL++  +E   +    DE+  AV+  VGIV+L  G   
Sbjct  33   KEPPRTLFPGGFKRPEIQVPALVLRVGAEEALRSG---DEVAAAVARGVGIVVLEAGEEG  89

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  90   GGRAYEAAVKLRAAVGDRAYLLITERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  149

Query  677  SV  682
            S+
Sbjct  150  SI  151



>ref|XP_008649599.1| PREDICTED: uncharacterized protein LOC103630315 [Zea mays]
Length=917

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K+ PRTLFPGGFKRPEI+VP+LVL++ T+E        DE+  AVS  VGIV+L  G   
Sbjct  54   KEPPRTLFPGGFKRPEIQVPALVLRVGTEEAL---RCGDEVADAVSRGVGIVVLEAGEEG  110

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  111  GGRSYEAARALRATVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  170

Query  677  SV  682
            S+
Sbjct  171  SI  172



>gb|AFW77879.1| hypothetical protein ZEAMMB73_997279, partial [Zea mays]
Length=794

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K+ PRTLFPGGFKRPEI+VP+LVL++ T+E        DE+  AVS  VGIV+L  G   
Sbjct  54   KEPPRTLFPGGFKRPEIQVPALVLRVGTEEAL---RCGDEVADAVSRGVGIVVLEAGEEG  110

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  111  GGRSYEAARALRATVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  170

Query  677  SV  682
            S+
Sbjct  171  SI  172



>ref|XP_002439739.1| hypothetical protein SORBIDRAFT_09g019290 [Sorghum bicolor]
 gb|EES18169.1| hypothetical protein SORBIDRAFT_09g019290 [Sorghum bicolor]
Length=922

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K+ PRTLFPGGFKRPEI+VP+LVL++  +E        DE+  AVS  VGIV+L  G   
Sbjct  59   KEPPRTLFPGGFKRPEIQVPALVLRVGAEEAL---RCGDEVAAAVSRGVGIVVLEAGEEG  115

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG+ YEAA  L++ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + ++
Sbjct  116  GGRAYEAARALRATVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNAD  175

Query  677  SV  682
            S+
Sbjct  176  SI  177



>ref|XP_002300848.2| hypothetical protein POPTR_0002s05420g [Populus trichocarpa]
 gb|EEE80121.2| hypothetical protein POPTR_0002s05420g [Populus trichocarpa]
Length=797

 Score =   107 bits (268),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 81/119 (68%), Gaps = 13/119 (11%)
 Frame = +2

Query  329  RTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggkl  508
            RTLFPGG+KRPEIKVP++V QL +++V                 V      GGG SG  L
Sbjct  60   RTLFPGGYKRPEIKVPNIVPQLDSEDVIRG-------------CVSDGDGGGGGGSGKSL  106

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            YEAA L+KSV+R+RAYLL+ ERV IAAAVNA GV+LSD+GLP  + RN +  +KSESVV
Sbjct  107  YEAAFLVKSVVRDRAYLLIGERVYIAAAVNARGVVLSDKGLPAFLVRNMLTGSKSESVV  165



>dbj|BAK07723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=967

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            K+ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGIV+L  G   
Sbjct  105  KEPPRTLFPGGFKRPEIQVPALVLRVGVGEALGSG---DAVAAAVARGVGIVVLEAGEEG  161

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG+ YEAA  LK+ + +RAYLL+ ERVD+A+AV ASGV+L+D G+P IVAR  M+ + S+
Sbjct  162  GGRAYEAARALKAAVGDRAYLLIAERVDVASAVGASGVVLADDGIPAIVARGMMMKSNSD  221

Query  677  SV  682
            S+
Sbjct  222  SI  223



>gb|EAY97909.1| hypothetical protein OsI_19825 [Oryza sativa Indica Group]
Length=925

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            ++ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGIV+L  G   
Sbjct  62   REPPRTLFPGGFKRPEIRVPALVLRVGADEALASG---DAVVAAVARGVGIVVLEAGAEG  118

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG++YEAA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+
Sbjct  119  GGRVYEAALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSD  178

Query  677  SV  682
            S+
Sbjct  179  SI  180



>gb|EEE63597.1| hypothetical protein OsJ_18414 [Oryza sativa Japonica Group]
Length=922

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            ++ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGIV+L  G   
Sbjct  63   REPPRTLFPGGFKRPEIRVPALVLRVGADEALASG---DAVVAAVARGVGIVVLEAGEEG  119

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSE  676
            GG++YEAA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+
Sbjct  120  GGRVYEAALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSD  179

Query  677  SV  682
            S+
Sbjct  180  SI  181



>gb|EAY97907.1| hypothetical protein OsI_19823 [Oryza sativa Indica Group]
Length=163

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 76/105 (72%), Gaps = 3/105 (3%)
 Frame = +2

Query  317  KQQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvs  496
            ++ PRTLFPGGFKRPEI+VP+LVL++   E   +    D +  AV+  VGIV+L  G   
Sbjct  62   REPPRTLFPGGFKRPEIRVPALVLRVGADEALASG---DAVVAAVARGVGIVVLEAGEEG  118

Query  497  ggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGL  631
            GG++YEAA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G 
Sbjct  119  GGRVYEAALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGW  163



>ref|XP_002984373.1| hypothetical protein SELMODRAFT_445893 [Selaginella moellendorffii]
 gb|EFJ14423.1| hypothetical protein SELMODRAFT_445893 [Selaginella moellendorffii]
Length=905

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = +2

Query  335  LFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivllsgggvsggklY  511
            +FPGG +R  +++P L L+L  +++  D       +D AV+  + +V+L  G     + Y
Sbjct  73   VFPGGTRRASVRLPGLGLRLKAEDILEDGEEKKAVLDSAVAAGLNLVILEDGKEDSLRFY  132

Query  512  EAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            +AA ++ S++R RA +L+ ERVDIAAA  ++GV+LSDQGLP++VAR  M +   E+VV
Sbjct  133  DAARIVMSIVRGRADVLIVERVDIAAAAGSNGVVLSDQGLPSVVARRMMQNAMPEAVV  190



>ref|XP_002972797.1| hypothetical protein SELMODRAFT_413416 [Selaginella moellendorffii]
 gb|EFJ26018.1| hypothetical protein SELMODRAFT_413416 [Selaginella moellendorffii]
Length=904

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 77/118 (65%), Gaps = 1/118 (1%)
 Frame = +2

Query  335  LFPGGFKRPEIKVPSLVLQLSTQEVF-DNRNVLDEIDQAvsgrvgivllsgggvsggklY  511
            +FPGG +R  +++P L L+L  +++  D       +D AV+  + +V+L  G     + Y
Sbjct  73   VFPGGTRRASVRLPGLGLRLKAEDILEDGEEKKAVLDSAVAAGLNLVILEDGKEDSLRFY  132

Query  512  EAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            +AA ++ S++R RA +L+ ERVDIAAA  ++GV+LSDQGLP++VAR  M +   E+VV
Sbjct  133  DAARIVMSIVRGRADVLIVERVDIAAAAGSNGVVLSDQGLPSVVARRMMQNAMPEAVV  190



>ref|XP_005646142.1| hypothetical protein COCSUDRAFT_30102 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21598.1| hypothetical protein COCSUDRAFT_30102 [Coccomyxa subellipsoidea 
C-169]
Length=832

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +2

Query  332  TLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDE--IDQAvsgrvgivllsgggvsggk  505
            T+FP G K+ ++ +P+ +L L+  +V + R  L +   D   +G  G++L    G  G +
Sbjct  70   TVFPAGKKQAKVALPACILVLTAADVVERRQELTQSIGDAIAAGATGVLLEDDDGTGGAQ  129

Query  506  lYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  664
            LYEAA +LK V+R RA LL+ +R DI AA  A GV+LS +G+PT+VAR ++ D
Sbjct  130  LYEAAIVLKDVLRGRAVLLIQDRTDIVAAAEADGVVLSSRGVPTVVARRSLPD  182



>ref|XP_001780842.1| predicted protein [Physcomitrella patens]
 gb|EDQ54321.1| predicted protein [Physcomitrella patens]
Length=839

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = +2

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            Y+A C+LK+++R RA LL+ ERVDIAAA  A GVLL+D+GLP +VAR  M ++  E+ V
Sbjct  18   YDAGCMLKTMLRGRAELLIAERVDIAAASGADGVLLTDEGLPAVVARRMMQNSGLETSV  76



>ref|XP_001774726.1| predicted protein [Physcomitrella patens]
 gb|EDQ60397.1| predicted protein [Physcomitrella patens]
Length=823

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSES  679
            Y+A C+LK+++R RA LL+ ERVDIAAA  A GVLL+D+GLP +VAR  M ++  E+
Sbjct  18   YDAGCMLKTMLRGRAELLISERVDIAAASGADGVLLTDEGLPAVVARRMMQNSGLET  74



>ref|NP_001055439.1| Os05g0390100 [Oryza sativa Japonica Group]
 gb|AAT47445.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17353.1| Os05g0390100 [Oryza sativa Japonica Group]
 dbj|BAG99883.1| unnamed protein product [Oryza sativa Japonica Group]
Length=803

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  515  AACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLDTKSESV  682
            AA  LK+ + +RAYLLV ERVD+A+AV ASGV+L+D G+P IVAR+ M+ + S+S+
Sbjct  3    AALSLKASVGDRAYLLVAERVDVASAVGASGVVLADDGIPAIVARSMMMKSNSDSI  58



>ref|XP_003081806.1| Mitofusin 1 GTPase, involved in mitochondrila biogenesis (ISS) 
[Ostreococcus tauri]
Length=849

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsg------  484
            + R+LF  G KR EI++P  V  +  +E    R     ID A+     +++L        
Sbjct  62   EKRSLFASGSKRSEIRIPGFVAYVDVREASTERGT-RAIDNALHAGATMIVLQERGMNGG  120

Query  485  --ggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
                 SG  LYE+A  LK ++R RA +L+ +R DIA      GV+L+D G+PT+VAR T+
Sbjct  121  VGESASGRALYESATALKDLVRGRAKVLIQDRTDIAVQAELDGVVLTDDGVPTVVARKTL  180



>emb|CEF99507.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=891

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 64/120 (53%), Gaps = 9/120 (8%)
 Frame = +2

Query  323  QPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsg------  484
            + R+LF  G KR EI++P  V  +  +E    R     ID A+     +++L        
Sbjct  62   EKRSLFASGSKRSEIRIPGFVAYVDVREASTERGT-RAIDNALHAGATMIVLQERGMNGG  120

Query  485  --ggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
                 SG  LYE+A  LK ++R RA +L+ +R DIA      GV+L+D G+PT+VAR T+
Sbjct  121  VGESASGRALYESATALKDLVRGRAKVLIQDRTDIAVQAELDGVVLTDDGVPTVVARKTL  180



>ref|XP_001420392.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98685.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=632

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 7/122 (6%)
 Frame = +2

Query  320  QQPRTLFPGGFKRPEIKVPSLVLQLSTQEVFDNRN--VLDEIDQAvsg----rvgivlls  481
            +Q R LF    KR E+++P  +  +   E    R   V+D +  A +     R   V  +
Sbjct  58   KQQRDLFAQ-TKRAEVRIPGFLAYVDVDEATSTRGAEVVDAVLHAGATCVALREYGVDGT  116

Query  482  gggvsggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTML  661
            GGG SG KLYEAA  LK+++R RA +L+ +R DIAA+    GV+L+D G+PT+VAR  + 
Sbjct  117  GGGNSGKKLYEAATTLKTLVRGRACVLIVDRTDIAASAELDGVVLTDDGVPTVVARKALP  176

Query  662  DT  667
            +T
Sbjct  177  ET  178



>ref|XP_001689811.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09549.1| predicted protein [Chlamydomonas reinhardtii]
Length=759

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 63/98 (64%), Gaps = 0/98 (0%)
 Frame = +2

Query  365  IKVPSLVLQLSTQEVFDNRNVLDEIDQAvsgrvgivllsgggvsggklYEAACLLKSVIR  544
            +++P++VLQL   +V  +   LD + QA+ G   +V+L     +   +Y+AA  ++  +R
Sbjct  6    VQLPAVVLQLEASKVLADGAALDTLSQALQGGCNMVVLWDSNANAAAMYDAALRVQEALR  65

Query  545  ERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
             RA LL+ +R DIA A+ A GVLL+DQG+PT+VA+  M
Sbjct  66   ARAPLLLVDRTDIALAIGAQGVLLTDQGVPTVVAKRMM  103



>ref|XP_005845307.1| hypothetical protein CHLNCDRAFT_137054 [Chlorella variabilis]
 gb|EFN53205.1| hypothetical protein CHLNCDRAFT_137054 [Chlorella variabilis]
Length=997

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 63/117 (54%), Gaps = 7/117 (6%)
 Frame = +2

Query  335  LFPGGFKRPEIKVPSLVLQLSTQEVFDNRNVLDEID-------QAvsgrvgivllsgggv  493
            LFP G ++  +++P+L+L ++  +V D       ++          +  V      GGG 
Sbjct  74   LFPAGKRQARVQLPALMLAVTAADVLDPAQAGGALEALSAAVAGGATAVVLAQGADGGGS  133

Query  494  sggklYEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTMLD  664
             G +LYEAA  LK ++R RA LL+ +R DI  A  A G LL+  GLPT+VA+  + D
Sbjct  134  GGAELYEAAVRLKELLRGRAVLLIADRTDIVDAAGADGALLTGAGLPTMVAKRMLQD  190



>gb|KHN18882.1| Hypothetical protein glysoja_028251, partial [Glycine soja]
Length=764

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  587  AAVNASGVLLSDQGLPTIVARNTMLDTKSESVV  685
            A   ASGVLLSDQGLPT+VARNTMLD+KSE VV
Sbjct  1    APTAASGVLLSDQGLPTVVARNTMLDSKSELVV  33



>ref|XP_002509117.1| hypothetical protein MICPUN_62927 [Micromonas sp. RCC299]
 gb|ACO70375.1| hypothetical protein MICPUN_62927 [Micromonas sp. RCC299]
Length=1014

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  509  YEAACLLKSVIRERAYLLVDERVDIAAAVNASGVLLSDQGLPTIVARNTM  658
            + AA  LK  +R RA LLV +R DIAA+    GV+LSD G+P +VAR ++
Sbjct  157  FNAALALKESLRGRASLLVADRTDIAASAECDGVVLSDDGVPVVVARKSL  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880