BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032M05

Length=677
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798786.1|  PREDICTED: probable glucuronoxylan glucurono...    137   5e-34   Nicotiana sylvestris
ref|XP_009587313.1|  PREDICTED: probable glucuronoxylan glucurono...    135   2e-33   Nicotiana tomentosiformis
ref|XP_002275679.1|  PREDICTED: probable glucuronoxylan glucurono...    133   1e-32   Vitis vinifera
ref|XP_010651775.1|  PREDICTED: probable glucuronoxylan glucurono...    122   6e-29   Vitis vinifera
emb|CDP07040.1|  unnamed protein product                                119   1e-27   Coffea canephora [robusta coffee]
ref|XP_004250976.2|  PREDICTED: probable glucuronoxylan glucurono...    118   1e-27   Solanum lycopersicum
ref|XP_002523710.1|  transferase, putative                              117   5e-27   Ricinus communis
ref|XP_011089956.1|  PREDICTED: probable glucuronoxylan glucurono...    113   9e-26   Sesamum indicum [beniseed]
ref|XP_006349026.1|  PREDICTED: probable glucuronoxylan glucurono...    111   5e-25   Solanum tuberosum [potatoes]
ref|XP_002314302.1|  exostosin family protein                           109   2e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011032302.1|  PREDICTED: probable glucuronoxylan glucurono...    109   3e-24   Populus euphratica
ref|XP_006424463.1|  hypothetical protein CICLE_v10028404mg             100   1e-21   
gb|KDP43977.1|  hypothetical protein JCGZ_05444                         102   1e-21   Jatropha curcas
ref|XP_008465401.1|  PREDICTED: probable glucuronoxylan glucurono...    101   2e-21   Cucumis melo [Oriental melon]
ref|XP_004160070.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    101   2e-21   
ref|XP_006424464.1|  hypothetical protein CICLE_v10028404mg             100   2e-21   
ref|XP_010243240.1|  PREDICTED: probable glucuronoxylan glucurono...    101   3e-21   Nelumbo nucifera [Indian lotus]
gb|KJB56224.1|  hypothetical protein B456_009G111000                    100   3e-21   Gossypium raimondii
ref|XP_004145764.1|  PREDICTED: probable glucuronoxylan glucurono...    100   4e-21   Cucumis sativus [cucumbers]
ref|XP_006424465.1|  hypothetical protein CICLE_v10028404mg             100   5e-21   Citrus clementina [clementine]
ref|XP_007016868.1|  Exostosin family protein                           100   6e-21   
gb|KHG19243.1|  putative glucuronoxylan glucuronosyltransferase I...  98.6    2e-20   Gossypium arboreum [tree cotton]
ref|XP_006488015.1|  PREDICTED: probable glucuronoxylan glucurono...  98.2    3e-20   Citrus sinensis [apfelsine]
ref|XP_006488016.1|  PREDICTED: probable glucuronoxylan glucurono...  96.7    9e-20   Citrus sinensis [apfelsine]
ref|XP_007207451.1|  hypothetical protein PRUPE_ppa005437mg           96.3    1e-19   Prunus persica
gb|EYU36147.1|  hypothetical protein MIMGU_mgv1a006282mg              95.9    2e-19   Erythranthe guttata [common monkey flower]
gb|ABI64067.1|  glycosyltransferase GT47C                             95.9    2e-19   Populus tremula x Populus alba [gray poplar]
ref|XP_008226491.1|  PREDICTED: probable glucuronoxylan glucurono...  95.9    2e-19   Prunus mume [ume]
gb|AAX33322.1|  secondary cell wall-related glycosyltransferase f...  95.5    2e-19   Populus tremula x Populus tremuloides
ref|XP_008349792.1|  PREDICTED: probable glucuronoxylan glucurono...  92.0    1e-18   
ref|XP_010111837.1|  putative glucuronoxylan glucuronosyltransfer...  93.6    2e-18   Morus notabilis
ref|XP_009356930.1|  PREDICTED: probable glucuronoxylan glucurono...  92.8    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_011088792.1|  PREDICTED: probable glucuronoxylan glucurono...  92.0    5e-18   Sesamum indicum [beniseed]
ref|XP_008385513.1|  PREDICTED: probable glucuronoxylan glucurono...  92.0    5e-18   Malus domestica [apple tree]
gb|EYU37036.1|  hypothetical protein MIMGU_mgv1a0063812mg             90.1    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_010031409.1|  PREDICTED: probable glucuronoxylan glucurono...  90.9    1e-17   Eucalyptus grandis [rose gum]
gb|KCW50700.1|  hypothetical protein EUGRSUZ_J00384                   90.5    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010267220.1|  PREDICTED: probable glucuronoxylan glucurono...  89.0    5e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009335974.1|  PREDICTED: probable glucuronoxylan glucurono...  87.8    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_009345746.1|  PREDICTED: probable glucuronoxylan glucurono...  87.4    2e-16   Pyrus x bretschneideri [bai li]
gb|KHF98105.1|  putative glucuronoxylan glucuronosyltransferase I...  85.5    7e-16   Gossypium arboreum [tree cotton]
gb|KJB83884.1|  hypothetical protein B456_013G269400                  85.1    1e-15   Gossypium raimondii
ref|XP_003539434.1|  PREDICTED: probable glucuronoxylan glucurono...  82.8    8e-15   Glycine max [soybeans]
ref|XP_006409832.1|  hypothetical protein EUTSA_v10016649mg           82.4    1e-14   Eutrema salsugineum [saltwater cress]
ref|XP_007132325.1|  hypothetical protein PHAVU_011G085300g           82.0    2e-14   Phaseolus vulgaris [French bean]
gb|AAL91236.1|  unknown protein                                       79.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287555.1|  PREDICTED: probable glucuronoxylan glucurono...  81.3    2e-14   Fragaria vesca subsp. vesca
ref|XP_009140845.1|  PREDICTED: probable glucuronoxylan glucurono...  80.9    4e-14   Brassica rapa
gb|KHN38711.1|  Putative glucuronoxylan glucuronosyltransferase IRX7  80.9    4e-14   Glycine soja [wild soybean]
emb|CDX77156.1|  BnaC04g39510D                                        80.9    4e-14   
ref|XP_003538175.1|  PREDICTED: probable glucuronoxylan glucurono...  80.9    4e-14   Glycine max [soybeans]
ref|XP_010473197.1|  PREDICTED: probable glucuronoxylan glucurono...  80.5    4e-14   Camelina sativa [gold-of-pleasure]
emb|CDY30507.1|  BnaA04g16260D                                        80.5    4e-14   Brassica napus [oilseed rape]
ref|XP_006294207.1|  hypothetical protein CARUB_v10023203mg           80.1    5e-14   Capsella rubella
gb|KHN21487.1|  Putative glucuronoxylan glucuronosyltransferase IRX7  79.7    7e-14   Glycine soja [wild soybean]
ref|XP_010417952.1|  PREDICTED: probable glucuronoxylan glucurono...  79.7    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003541982.1|  PREDICTED: probable glucuronoxylan glucurono...  79.7    8e-14   Glycine max [soybeans]
gb|KFK33941.1|  hypothetical protein AALP_AA5G081400                  79.0    9e-14   Arabis alpina [alpine rockcress]
ref|NP_850113.2|  probable glucuronoxylan glucuronosyltransferase...  79.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103648.1|  PREDICTED: probable glucuronoxylan glucurono...  79.3    1e-13   Brassica rapa
ref|XP_002879114.1|  hypothetical protein ARALYDRAFT_481698           79.0    2e-13   
ref|XP_004506065.1|  PREDICTED: probable glucuronoxylan glucurono...  78.6    2e-13   Cicer arietinum [garbanzo]
ref|XP_010510691.1|  PREDICTED: probable glucuronoxylan glucurono...  78.6    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010689136.1|  PREDICTED: probable glucuronoxylan glucurono...  78.2    3e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN21068.1|  Putative glucuronoxylan glucuronosyltransferase IRX7  77.8    4e-13   Glycine soja [wild soybean]
ref|XP_003539788.1|  PREDICTED: probable glucuronoxylan glucurono...  77.8    4e-13   
gb|KJB83885.1|  hypothetical protein B456_013G269400                  77.4    5e-13   Gossypium raimondii
emb|CDY04537.1|  BnaA07g13630D                                        76.6    1e-12   
ref|XP_007150147.1|  hypothetical protein PHAVU_005G130800g           75.9    2e-12   Phaseolus vulgaris [French bean]
ref|XP_010521727.1|  PREDICTED: probable glucuronoxylan glucurono...  75.9    2e-12   Tarenaya hassleriana [spider flower]
emb|CDX71023.1|  BnaC03g11070D                                        75.9    2e-12   
gb|AFK36383.1|  unknown                                               73.6    3e-12   Medicago truncatula
ref|XP_010493404.1|  PREDICTED: probable glucuronoxylan glucurono...  74.7    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010421093.1|  PREDICTED: probable glucuronoxylan glucurono...  74.3    5e-12   Camelina sativa [gold-of-pleasure]
gb|AES88544.2|  glycosyltransferase family 47 protein                 73.9    8e-12   Medicago truncatula
ref|XP_008359956.1|  PREDICTED: probable glucuronoxylan glucurono...  73.6    8e-12   
emb|CDY26971.1|  BnaC09g36120D                                        73.6    1e-11   Brassica napus [oilseed rape]
ref|XP_009131900.1|  PREDICTED: probable glucuronoxylan glucurono...  72.4    2e-11   Brassica rapa
ref|XP_006400803.1|  hypothetical protein EUTSA_v10013464mg           72.4    2e-11   Eutrema salsugineum [saltwater cress]
emb|CDX88775.1|  BnaA03g08740D                                        72.4    2e-11   
ref|XP_009120620.1|  PREDICTED: probable glucuronoxylan glucurono...  72.4    3e-11   Brassica rapa
emb|CDY50331.1|  BnaA10g13640D                                        72.4    3e-11   Brassica napus [oilseed rape]
ref|XP_004487567.1|  PREDICTED: probable glucuronoxylan glucurono...  71.6    4e-11   Cicer arietinum [garbanzo]
ref|XP_010535629.1|  PREDICTED: probable glucuronoxylan glucurono...  71.2    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_010454575.1|  PREDICTED: probable glucuronoxylan glucurono...  71.2    5e-11   Camelina sativa [gold-of-pleasure]
gb|EPS70309.1|  hypothetical protein M569_04450                       70.1    1e-10   Genlisea aurea
ref|NP_197685.2|  probable glucuronoxylan glucuronosyltransferase...  69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KEH38871.1|  glucuronoxylan glucuronosyltransferase, putative      68.9    3e-10   Medicago truncatula
gb|KFK27620.1|  hypothetical protein AALP_AA8G407200                  68.2    5e-10   Arabis alpina [alpine rockcress]
ref|XP_006851286.1|  hypothetical protein AMTR_s00050p00076540        67.8    6e-10   
ref|XP_010541310.1|  PREDICTED: probable glucuronoxylan glucurono...  68.2    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_010541309.1|  PREDICTED: probable glucuronoxylan glucurono...  68.2    6e-10   Tarenaya hassleriana [spider flower]
ref|XP_003606347.1|  Secondary cell wall-related glycosyltransfer...  67.8    6e-10   
ref|XP_006288015.1|  hypothetical protein CARUB_v10001248mg           65.9    3e-09   
ref|XP_002872025.1|  exostosin family protein                         65.5    5e-09   
dbj|BAB10615.1|  unnamed protein product                              65.5    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803446.1|  PREDICTED: probable glucuronosyltransferase ...  64.3    1e-08   
ref|XP_008463382.1|  PREDICTED: probable glucuronoxylan glucurono...  62.8    4e-08   Cucumis melo [Oriental melon]
ref|XP_004147302.1|  PREDICTED: probable glucuronoxylan glucurono...  62.8    4e-08   Cucumis sativus [cucumbers]
ref|XP_002877828.1|  hypothetical protein ARALYDRAFT_906539           58.5    6e-08   
ref|XP_009382125.1|  PREDICTED: probable glucuronosyltransferase ...  62.0    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001754437.1|  predicted protein                                61.6    7e-08   
ref|XP_001781950.1|  predicted protein                                61.2    9e-08   
ref|XP_002975186.1|  glycosyltransferase-like protein                 61.2    1e-07   
ref|XP_009413136.1|  PREDICTED: probable glucuronosyltransferase ...  61.2    1e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002994684.1|  glycosyltransferase-like protein                 60.8    1e-07   
ref|XP_002977591.1|  glycosyltransferase-like protein                 60.8    1e-07   
ref|XP_001777222.1|  predicted protein                                60.8    1e-07   
ref|XP_010918601.1|  PREDICTED: probable glucuronosyltransferase ...  60.5    2e-07   Elaeis guineensis
ref|XP_008809907.1|  PREDICTED: probable glucuronosyltransferase ...  60.1    3e-07   Phoenix dactylifera
ref|XP_010908507.1|  PREDICTED: probable glucuronosyltransferase ...  59.3    5e-07   Elaeis guineensis
ref|XP_009400247.1|  PREDICTED: probable glucuronosyltransferase ...  57.4    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004986049.1|  PREDICTED: probable glucuronosyltransferase ...  54.7    2e-05   Setaria italica
tpg|DAA42850.1|  TPA: hypothetical protein ZEAMMB73_024068            54.3    2e-05   
ref|XP_003562215.1|  PREDICTED: probable glucuronosyltransferase ...  53.5    5e-05   Brachypodium distachyon [annual false brome]
ref|NP_001169191.1|  uncharacterized protein LOC100383044             53.1    6e-05   Zea mays [maize]
ref|XP_002468679.1|  hypothetical protein SORBIDRAFT_01g050110        53.1    6e-05   Sorghum bicolor [broomcorn]
ref|XP_004961861.1|  PREDICTED: probable glucuronosyltransferase ...  52.8    7e-05   Setaria italica
ref|NP_001048697.1|  Os03g0107900                                     52.8    8e-05   
gb|AAN62780.1|  Unknown protein                                       52.8    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441217.1|  hypothetical protein SORBIDRAFT_09g022500        52.8    9e-05   Sorghum bicolor [broomcorn]
ref|XP_009126553.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  49.7    2e-04   Brassica rapa
ref|XP_009420168.1|  PREDICTED: probable beta-1,4-xylosyltransfer...  50.8    4e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662226.1|  PREDICTED: probable glucuronosyltransferase ...  50.1    6e-04   Oryza brachyantha
ref|NP_001241842.1|  hypothetical protein precursor                   49.7    9e-04   
ref|NP_001130059.1|  uncharacterized protein LOC100191151 precursor   49.7    9e-04   
ref|XP_002512676.1|  conserved hypothetical protein                   47.8    0.001   
ref|XP_001753186.1|  predicted protein                                49.7    0.001   



>ref|XP_009798786.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Nicotiana sylvestris]
Length=459

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 111/143 (78%), Gaps = 7/143 (5%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQ---ASEKSFCHRYfkwllwfslsfyffasfifTH  431
            M E +R  +RN+GFYVRM+LL    +    SEKSFC+RYFKW+LWFSLSFYFFASF+F H
Sbjct  1    MLEPKRTNNRNRGFYVRMRLLHNNSRNVRTSEKSFCYRYFKWVLWFSLSFYFFASFLFNH  60

Query  432  KPA-TSAIISRTTVVRQSKASRALIESHNSS-LLHQPNTHQDVFKDLKVYIYDLPAKYNV  605
            KP  T + IS+TTV  QSKASRALIES NSS LL  P  HQD    LK+Y+Y+LP KYN 
Sbjct  61   KPNNTISFISKTTV-SQSKASRALIESINSSALLQYPKHHQDSLNGLKIYVYELPTKYNS  119

Query  606  DWL-NERCSSHLFASEVAIHRAL  671
            DWL NERCS+HLFASEVAIHRAL
Sbjct  120  DWLTNERCSNHLFASEVAIHRAL  142



>ref|XP_009587313.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Nicotiana tomentosiformis]
Length=458

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 110/142 (77%), Gaps = 6/142 (4%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQ---ASEKSFCHRYfkwllwfslsfyffasfifTH  431
            M E +R  +RN+GFYVRM+LL    +    SEKSFC+RYFKW+LWFSLSFYFFASF+F H
Sbjct  1    MLEPKRTNNRNRGFYVRMRLLHNNSRNVRTSEKSFCYRYFKWVLWFSLSFYFFASFLFNH  60

Query  432  KPATSAIISRTTVVRQSKASRALIESHNSS-LLHQPNTHQDVFKDLKVYIYDLPAKYNVD  608
            KP T++ IS+TTV  QSKASRALIES NSS +L  P   QD    LK+Y+Y+LP KYN D
Sbjct  61   KPNTTSFISKTTV-SQSKASRALIESINSSAVLQYPKHPQDSLNGLKIYVYELPTKYNSD  119

Query  609  WL-NERCSSHLFASEVAIHRAL  671
            WL NERC +HLFASEVAIHRAL
Sbjct  120  WLSNERCRNHLFASEVAIHRAL  141



>ref|XP_002275679.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
isoform X1 [Vitis vinifera]
 emb|CBI17149.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 6/139 (4%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKP  437
            M +  R  SRN+GFYVRM+LL + GRQ  EKS+C RYF+W+LW SLS YFF+S++ T+ P
Sbjct  1    MVDFSR-PSRNRGFYVRMRLLHKQGRQ--EKSYCFRYFRWVLWLSLSLYFFSSYLITNHP  57

Query  438  ATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-  614
                 I + TV   SKASRAL E+ N+++  QP  HQD+ KDLKVYIYDLP+KYNVDWL 
Sbjct  58   RKLTSIPKVTV-SNSKASRALFETVNTTIQQQPRDHQDLLKDLKVYIYDLPSKYNVDWLS  116

Query  615  NERCSSHLFASEVAIHRAL  671
            NERCS+HLFASEVA+H+AL
Sbjct  117  NERCSNHLFASEVALHKAL  135



>ref|XP_010651775.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
isoform X2 [Vitis vinifera]
Length=456

 Score =   122 bits (307),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 104/139 (75%), Gaps = 10/139 (7%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKP  437
            M +  R  SRN+GFYVRM+LL + GRQ  EKS+C RYF+W+LW SLS YFF+S++ T+ P
Sbjct  1    MVDFSR-PSRNRGFYVRMRLLHKQGRQ--EKSYCFRYFRWVLWLSLSLYFFSSYLITNHP  57

Query  438  ATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-  614
                 I + TV   SKASRAL E+ N+++  QP  HQD    LKVYIYDLP+KYNVDWL 
Sbjct  58   RKLTSIPKVTV-SNSKASRALFETVNTTIQQQPRDHQD----LKVYIYDLPSKYNVDWLS  112

Query  615  NERCSSHLFASEVAIHRAL  671
            NERCS+HLFASEVA+H+AL
Sbjct  113  NERCSNHLFASEVALHKAL  131



>emb|CDP07040.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 22/151 (15%)
 Frame = +3

Query  264  TEMRRQTSRNKGFYVRMKLL-------------RPGRQASEKSFCHRYfkwllwfslsfy  404
            + + ++ +RN+GFYVRM+ L             R  +Q+ EKSFC+RYFKWLLW SL+ Y
Sbjct  4    SSLHKKPTRNRGFYVRMRFLNHHNNVNYPKHGGRASQQSIEKSFCYRYFKWLLWISLALY  63

Query  405  ffasfifTHKPATSAI-ISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIY  581
            F +SF+ THKP  SA+ +S TT++ + KASRAL ES NS+ + +       F+ LKVYIY
Sbjct  64   FLSSFLITHKPTPSALSLSTTTILPRLKASRALFESTNSTSIGK-------FRGLKVYIY  116

Query  582  DLPAKYNVDWLNE-RCSSHLFASEVAIHRAL  671
            +LP+KYN DWL + RCS+HLFASEVAIHRAL
Sbjct  117  ELPSKYNTDWLQDGRCSNHLFASEVAIHRAL  147



>ref|XP_004250976.2| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Solanum lycopersicum]
Length=447

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 105/142 (74%), Gaps = 17/142 (12%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLR--PGRQASEKSFCHRYfkwllwfslsfyffasfifTHK  434
            M E ++Q S+N+GFYVRMKLL    G   +   FC+RYFKW+LWFSLSFYFFASF+F HK
Sbjct  1    MIEPKKQ-SKNRGFYVRMKLLNHNNGGSRNRGLFCYRYFKWVLWFSLSFYFFASFLFNHK  59

Query  435  PATSAIISRTTVVRQSKASRALIESHNSSLLHQPNT--HQDVFKDLKVYIYDLPAKYNVD  608
            P T   IS+TTV + SKASRALIE         P T  H+D    LK+Y+YDLP+KYN+D
Sbjct  60   PNT---ISKTTVPQYSKASRALIE--------YPETQHHRDSLNGLKIYVYDLPSKYNID  108

Query  609  WL-NERCSSHLFASEVAIHRAL  671
            WL NERCS+HLFASEVAIH+AL
Sbjct  109  WLSNERCSNHLFASEVAIHKAL  130



>ref|XP_002523710.1| transferase, putative [Ricinus communis]
 gb|EEF38650.1| transferase, putative [Ricinus communis]
Length=461

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 107/150 (71%), Gaps = 16/150 (11%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGR---QASEKS-FCHRYfkwllwfslsfyffasfif  425
            M E+ + T +N+GFYV+MKL+ R GR   Q  EKS  C +Y+KW+LW SLS YF  S+  
Sbjct  1    MAELIKPTRKNRGFYVKMKLVHRNGRLQQQQLEKSNLCFKYYKWVLWISLSLYFITSYFI  60

Query  426  THKP---ATSAIISRTTVVRQSKASRALIESHNSSLLHQP--NTHQDVFKDLKVYIYDLP  590
            +HKP   + +   S++ VV     SRAL ES NS+  HQP  NT+Q + KDLK+YIY+LP
Sbjct  61   SHKPIPLSKAQYFSKSAVV-----SRALFESTNSTFFHQPKNNTNQALLKDLKIYIYELP  115

Query  591  AKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            +KYN DWL N+RCS+HLFASEVAIH+A+++
Sbjct  116  SKYNRDWLSNKRCSNHLFASEVAIHKAISN  145



>ref|XP_011089956.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Sesamum indicum]
Length=458

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 104/144 (72%), Gaps = 10/144 (7%)
 Frame = +3

Query  261  MTEMRRQTS-RNKGFYVRMKLLRPGRQA--SEKSFCHRYfkwllwfslsfyffasfifTH  431
            M E +R    R++GFYVRM+LL   R +   EK FC+RYFKW+LW S+SFYFF+SF+ T 
Sbjct  1    MLETKRVVQLRSRGFYVRMRLLHGTRSSRNPEKGFCYRYFKWILWLSISFYFFSSFLITR  60

Query  432  -KPATSAIISRTTVVRQSKASRALIESH--NSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
             KP++S  ISRTTV R SK SRALIE    NSS L        +FK +KVY+Y+LP+KYN
Sbjct  61   SKPSSS--ISRTTVSR-SKPSRALIEESLLNSSSLQHLQIPDGLFKGMKVYVYELPSKYN  117

Query  603  VDWL-NERCSSHLFASEVAIHRAL  671
             DWL NERCSSHLFASEVAIHR L
Sbjct  118  SDWLSNERCSSHLFASEVAIHRGL  141



>ref|XP_006349026.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
[Solanum tuberosum]
Length=449

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 102/140 (73%), Gaps = 11/140 (8%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQASEKS--FCHRYfkwllwfslsfyffasfifTHK  434
            M E ++Q S+N+GFYVRMKLL      +     FC+RYFKW+LWFSLSFYFFASF+F HK
Sbjct  1    MIEPKKQ-SKNRGFYVRMKLLNHNNGGNRNRGLFCYRYFKWVLWFSLSFYFFASFLFNHK  59

Query  435  PATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL  614
            P T   IS+TTV + SKASRALIE   +    Q +   D    LK+Y+YDLP+KYN DWL
Sbjct  60   PNT---ISKTTVPQYSKASRALIEYPET----QNHRVSDSLNGLKIYVYDLPSKYNSDWL  112

Query  615  -NERCSSHLFASEVAIHRAL  671
             NERCS+HLFASEVAIH+AL
Sbjct  113  SNERCSNHLFASEVAIHKAL  132



>ref|XP_002314302.1| exostosin family protein [Populus trichocarpa]
 gb|EEE88257.1| exostosin family protein [Populus trichocarpa]
Length=462

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 12/148 (8%)
 Frame = +3

Query  261  MTEMRRQTSRN--KGFYVRMKLLR--PGRQASEK--SFCHRYfkwllwfslsfyffasfi  422
            + E++R T  N  +GFYVRMKLL    G Q  EK  + C +Y+KWLLWFSL  YF +S  
Sbjct  2    VLEVKRPTMSNNRRGFYVRMKLLHRHAGLQQQEKKKNLCFKYYKWLLWFSLLLYFLSSCF  61

Query  423  fTHKPATSAIISRTTVVR-QSKASRALIESHNSSLLHQP-NTHQDVFKDLKVYIYDLPAK  596
            FTHKP     +S+T V   ++  SRAL ES NS+ + Q  N ++ + KDLKVYIY+LP+K
Sbjct  62   FTHKPIP---LSKTHVSESKTVVSRALFESSNSTFIQQSKNINRGLLKDLKVYIYELPSK  118

Query  597  YNVDWL-NERCSSHLFASEVAIHRALAS  677
            YN DWL NERCS+HLFASEVAIH+AL++
Sbjct  119  YNTDWLANERCSNHLFASEVAIHKALSN  146



>ref|XP_011032302.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Populus euphratica]
Length=460

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 104/147 (71%), Gaps = 11/147 (7%)
 Frame = +3

Query  261  MTEMRRQTSRN--KGFYVRMKLLR---PGRQASEKSFCHRYfkwllwfslsfyffasfif  425
            + E +R T  N  +GFYVRM+LL      +Q  +K+ C +Y+KWLLWFSL  YF +S  F
Sbjct  2    VLEGKRPTMSNNRRGFYVRMRLLHRHAGLQQEKKKNLCFKYYKWLLWFSLLLYFLSSCFF  61

Query  426  THKPATSAIISRTTVVR-QSKASRALIESHNSSLLHQPNT-HQDVFKDLKVYIYDLPAKY  599
            THKP     +S+T V + ++  SRAL ES NS+ + Q N  ++ + KDLKVYIY+LP+KY
Sbjct  62   THKPIP---LSKTHVSKSKTVVSRALFESSNSTFIQQGNNINRGLLKDLKVYIYELPSKY  118

Query  600  NVDWL-NERCSSHLFASEVAIHRALAS  677
            N DWL NERCSSHLFASEVAIH+AL++
Sbjct  119  NTDWLTNERCSSHLFASEVAIHKALSN  145



>ref|XP_006424463.1| hypothetical protein CICLE_v10028404mg [Citrus clementina]
 gb|ESR37703.1| hypothetical protein CICLE_v10028404mg [Citrus clementina]
Length=273

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQAS--EKSFCHRYfkwllwfslsfyffasfifTH  431
            M E+ ++ ++ +GFYV M+LL + GRQ    EK+ C +Y+KW+LWFSL+ YFF+S+  +H
Sbjct  1    MEELLKRPTKRRGFYVEMRLLHKNGRQQQQLEKNSCFKYYKWVLWFSLTLYFFSSYFISH  60

Query  432  -KPATSAIISRT--TVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
             KP     +SRT  +  + +  SRALIES N++ L  P   +   +DLK+Y+Y+LP+KYN
Sbjct  61   NKPIP---LSRTHFSNSKSNLPSRALIESVNTTSLQHPT--RGALEDLKIYVYELPSKYN  115

Query  603  VDWL-NERCSSHLFASEVAIHRAL  671
             DWL NERCS+HLFASEVAIHRAL
Sbjct  116  TDWLSNERCSNHLFASEVAIHRAL  139



>gb|KDP43977.1| hypothetical protein JCGZ_05444 [Jatropha curcas]
Length=462

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 103/151 (68%), Gaps = 17/151 (11%)
 Frame = +3

Query  261  MTEMRRQTSRN--KGFYVRMKLL-RPGR-----QASEKSFCHRYfkwllwfslsfyffas  416
            M E + + ++N  +GFYV+MKL+ R GR     + +  + C  Y+KW+LW SLS YFF S
Sbjct  1    MAEFKNRPTKNNNRGFYVKMKLVNRNGRFLLQQEKNHNNLCFHYYKWILWISLSLYFFTS  60

Query  417  fifTHKP---ATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDL  587
            +  +HKP   + +   S++TVV     SRAL ES NS+ L     ++ + KDLK+YIY+L
Sbjct  61   YFISHKPIPLSKTQHFSKSTVV-----SRALFESVNSTFLQPSKNNKALLKDLKIYIYEL  115

Query  588  PAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            P+KYN DWL NERCS+HLFA+EVAIHRA+++
Sbjct  116  PSKYNKDWLANERCSNHLFAAEVAIHRAISN  146



>ref|XP_008465401.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Cucumis melo]
Length=459

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = +3

Query  288  RNKGFYVRMKLLRPGR--QASEKSFCHRYfkwllwfslsfyffasfifTHKP---ATSAI  452
            R KGFYVRMKL  P +  +A EKSF  RY+KWLLW SLS YFF S+  +H      TS  
Sbjct  9    RRKGFYVRMKLF-PHKNCRAQEKSFFIRYYKWLLWVSLSLYFFTSYYISHNHESHGTSDR  67

Query  453  ISRTTVVR-QSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERC  626
            + RT +   +S  SRALIES N++ L Q   +Q + +++KV++YDLP +YNV+WL NERC
Sbjct  68   MPRTHLSNSKSFPSRALIESSNTTFLRQVQQNQGLLEEVKVFVYDLPPQYNVEWLSNERC  127

Query  627  SSHLFASEVAIHRAL  671
            S+HLFASEVAIHRAL
Sbjct  128  SNHLFASEVAIHRAL  142



>ref|XP_004160070.1| PREDICTED: LOW QUALITY PROTEIN: probable glucuronoxylan glucuronosyltransferase 
IRX7-like [Cucumis sativus]
Length=459

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = +3

Query  288  RNKGFYVRMKLLRPGR--QASEKSFCHRYfkwllwfslsfyffasfifTHKP---ATSAI  452
            R KGFYVRM+L  P +  +A EKSF  RY+KWLLW SLS YF  S+  +H      TS  
Sbjct  9    RRKGFYVRMRLF-PHKNCRAQEKSFFIRYYKWLLWVSLSLYFXTSYYISHNHKSHGTSDR  67

Query  453  ISRTTVVR-QSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERC  626
            + RT +   +S  SRALIE+ N++ L Q   +Q++ +++KV++YDLP KYNV+WL NERC
Sbjct  68   MPRTHLSNSKSFPSRALIETSNTTFLRQVQQNQELLEEVKVFVYDLPPKYNVEWLSNERC  127

Query  627  SSHLFASEVAIHRAL  671
            S+HLFASEVAIHRAL
Sbjct  128  SNHLFASEVAIHRAL  142



>ref|XP_006424464.1| hypothetical protein CICLE_v10028404mg [Citrus clementina]
 gb|ESR37704.1| hypothetical protein CICLE_v10028404mg [Citrus clementina]
Length=330

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQAS--EKSFCHRYfkwllwfslsfyffasfifTH  431
            M E+ ++ ++ +GFYV M+LL + GRQ    EK+ C +Y+KW+LWFSL+ YFF+S+  +H
Sbjct  1    MEELLKRPTKRRGFYVEMRLLHKNGRQQQQLEKNSCFKYYKWVLWFSLTLYFFSSYFISH  60

Query  432  -KPATSAIISRT--TVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
             KP     +SRT  +  + +  SRALIES N++ L  P   +   +DLK+Y+Y+LP+KYN
Sbjct  61   NKPIP---LSRTHFSNSKSNLPSRALIESVNTTSLQHPT--RGALEDLKIYVYELPSKYN  115

Query  603  VDWL-NERCSSHLFASEVAIHRAL  671
             DWL NERCS+HLFASEVAIHRAL
Sbjct  116  TDWLSNERCSNHLFASEVAIHRAL  139



>ref|XP_010243240.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Nelumbo nucifera]
Length=461

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 27/155 (17%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL--RPGRQASEKSFCHRYfkwllwfslsf------yffas  416
            M E++R T++++GFYVRMKLL  R GRQ  EKS C+RYF+W++W SLS          +S
Sbjct  1    MVELQR-TTKSRGFYVRMKLLHNRHGRQ--EKSSCYRYFRWVVWVSLSLYFFSYYLISSS  57

Query  417  fifTHKPATSAIISRTTVVRQSKASRALIESHNSSL---------LHQPNTHQDVFKDLK  569
               T  P T+  +S+T+ V     SRAL ES N++L         +H     +  F +LK
Sbjct  58   SKPTLLPKTTVSVSKTSFV-----SRALFES-NTTLSQQLSRTKQIHLSELSRGSFDNLK  111

Query  570  VYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            VYIYDLP +YN DWL NERCS+HLFA+EVAIH+AL
Sbjct  112  VYIYDLPLRYNADWLANERCSNHLFAAEVAIHKAL  146



>gb|KJB56224.1| hypothetical protein B456_009G111000 [Gossypium raimondii]
Length=456

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 95/137 (69%), Gaps = 3/137 (2%)
 Frame = +3

Query  264  TEMRRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPAT  443
            +E+++   +N+GFYV+M++L  GRQ  EKS   RY++W+LWFS + YF  SF  T+KP T
Sbjct  4    SELQKPIKKNRGFYVKMRILHKGRQP-EKSLFFRYYQWILWFSFTLYFLTSFFITNKPIT  62

Query  444  SAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NE  620
             +   R +  + S  SR L ES N +       +  +FKDLK++IY+LP++YN +WL N+
Sbjct  63   LSK-PRASGSKLSLPSRVLFESVNKTSQQPYLKNPAMFKDLKIFIYELPSEYNENWLSNK  121

Query  621  RCSSHLFASEVAIHRAL  671
            RCS+HLFASEVAIHRAL
Sbjct  122  RCSNHLFASEVAIHRAL  138



>ref|XP_004145764.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
[Cucumis sativus]
 gb|KGN46874.1| hypothetical protein Csa_6G147670 [Cucumis sativus]
Length=459

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 8/135 (6%)
 Frame = +3

Query  288  RNKGFYVRMKLLRPGR--QASEKSFCHRYfkwllwfslsfyffasfifTHKP---ATSAI  452
            R KGFYVRM+L  P +  +A EKSF  RY+KWLLW SLS YFF S+  +H      TS  
Sbjct  9    RRKGFYVRMRLF-PHKNCRAQEKSFFIRYYKWLLWVSLSLYFFTSYYISHNHKSHGTSDR  67

Query  453  ISRTTVVR-QSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERC  626
            + RT +   +S  SRALIE+ N++ L Q   +Q + +++KV++YDLP KYNV+WL NERC
Sbjct  68   MPRTHLSNSKSFPSRALIETSNTTFLRQVQQNQGLLEEVKVFVYDLPPKYNVEWLSNERC  127

Query  627  SSHLFASEVAIHRAL  671
            S+HLFASEVAIHRAL
Sbjct  128  SNHLFASEVAIHRAL  142



>ref|XP_006424465.1| hypothetical protein CICLE_v10028404mg [Citrus clementina]
 gb|ESR37705.1| hypothetical protein CICLE_v10028404mg [Citrus clementina]
Length=457

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 12/144 (8%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQAS--EKSFCHRYfkwllwfslsfyffasfifTH  431
            M E+ ++ ++ +GFYV M+LL + GRQ    EK+ C +Y+KW+LWFSL+ YFF+S+  +H
Sbjct  1    MEELLKRPTKRRGFYVEMRLLHKNGRQQQQLEKNSCFKYYKWVLWFSLTLYFFSSYFISH  60

Query  432  -KPATSAIISRT--TVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
             KP     +SRT  +  + +  SRALIES N++ L  P   +   +DLK+Y+Y+LP+KYN
Sbjct  61   NKPIP---LSRTHFSNSKSNLPSRALIESVNTTSLQHPT--RGALEDLKIYVYELPSKYN  115

Query  603  VDWL-NERCSSHLFASEVAIHRAL  671
             DWL NERCS+HLFASEVAIHRAL
Sbjct  116  TDWLSNERCSNHLFASEVAIHRAL  139



>ref|XP_007016868.1| Exostosin family protein [Theobroma cacao]
 gb|EOY34487.1| Exostosin family protein [Theobroma cacao]
Length=457

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = +3

Query  264  TEMRRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPAT  443
            +E+++   RN+GFYV+M++L  GRQ  EKS   +Y+KW+LWFS + YF  SF  ++KP  
Sbjct  5    SELQKPKKRNRGFYVKMRILHKGRQ-HEKSLFFKYYKWVLWFSFTLYFLTSFFISNKPIP  63

Query  444  SAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDV--FKDLKVYIYDLPAKYNVDWL-  614
             +  +R +  + S ASR L ES N +     + H+D   FKDLK+YIY+LP++YN DWL 
Sbjct  64   LSK-TRVSGSKSSIASRVLFESVNKT--SHKSKHKDPASFKDLKIYIYELPSEYNEDWLS  120

Query  615  NERCSSHLFASEVAIHRAL  671
            N+RCS+HLFASEVAIHR L
Sbjct  121  NKRCSNHLFASEVAIHRTL  139



>gb|KHG19243.1| putative glucuronoxylan glucuronosyltransferase IRX7 -like protein 
[Gossypium arboreum]
Length=456

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 94/137 (69%), Gaps = 3/137 (2%)
 Frame = +3

Query  264  TEMRRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPAT  443
            +E+++   +N+GFYV+M++L  GRQ  EKS   RY++W+LWFS + YF  SF  T+KP  
Sbjct  4    SELQKLIKKNRGFYVKMRILHKGRQP-EKSLFFRYYQWILWFSFTLYFLTSFFITNKPIQ  62

Query  444  SAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NE  620
             +   R +  + S  SR L ES N +       +  +FKDLK++IY+LP++YN +WL N+
Sbjct  63   LSK-PRASGSKLSLPSRVLFESVNKTSQQPYLKNPAMFKDLKIFIYELPSEYNENWLSNK  121

Query  621  RCSSHLFASEVAIHRAL  671
            RCS+HLFASEVAIHRAL
Sbjct  122  RCSNHLFASEVAIHRAL  138



>ref|XP_006488015.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
isoform X1 [Citrus sinensis]
Length=457

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 102/144 (71%), Gaps = 12/144 (8%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQAS--EKSFCHRYfkwllwfslsfyffasfifTH  431
            M E  ++ ++ +GFYV M+LL + GRQ    EK+ C +Y+KW+LWFSL+ YFF+S+  +H
Sbjct  1    MEEPLKRPTKRRGFYVEMRLLHKNGRQQQQLEKNSCFKYYKWVLWFSLTLYFFSSYFISH  60

Query  432  -KPATSAIISRT--TVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
             KP     +SRT  +  + +  SRALIES N++ L  P   +   +DLK+Y+Y+LP+KYN
Sbjct  61   NKPIP---LSRTHFSNSKSNLPSRALIESVNTTSLQHPT--RGALEDLKIYVYELPSKYN  115

Query  603  VDWL-NERCSSHLFASEVAIHRAL  671
             DWL NERCS+HLFASEVAIHRAL
Sbjct  116  TDWLSNERCSNHLFASEVAIHRAL  139



>ref|XP_006488016.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
isoform X2 [Citrus sinensis]
Length=454

 Score = 96.7 bits (239),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 101/144 (70%), Gaps = 15/144 (10%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQAS--EKSFCHRYfkwllwfslsfyffasfifTH  431
            M E  ++ ++ +GFYV M+LL + GRQ    EK+ C +Y+KW+LWFSL+ YFF+S+  +H
Sbjct  1    MEEPLKRPTKRRGFYVEMRLLHKNGRQQQQLEKNSCFKYYKWVLWFSLTLYFFSSYFISH  60

Query  432  -KPATSAIISRT--TVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
             KP     +SRT  +  + +  SRALIES N++ L  P       +DLK+Y+Y+LP+KYN
Sbjct  61   NKPIP---LSRTHFSNSKSNLPSRALIESVNTTSLQHPTR-----EDLKIYVYELPSKYN  112

Query  603  VDWL-NERCSSHLFASEVAIHRAL  671
             DWL NERCS+HLFASEVAIHRAL
Sbjct  113  TDWLSNERCSNHLFASEVAIHRAL  136



>ref|XP_007207451.1| hypothetical protein PRUPE_ppa005437mg [Prunus persica]
 gb|EMJ08650.1| hypothetical protein PRUPE_ppa005437mg [Prunus persica]
Length=461

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 99/147 (67%), Gaps = 13/147 (9%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL--RPGR----QASEKSFCHRYfkwllwfslsfyffasfi  422
            M E + +  +N+GFYVRMKLL  + GR    Q  +KSF +R  KW+LW SLSFYFF+S++
Sbjct  1    MLEQKIRAPKNRGFYVRMKLLPSKHGRSSVPQLEKKSFFYRNCKWVLWLSLSFYFFSSYL  60

Query  423  fTHKPATSAIISRTTVVR---QSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPA  593
             ++ P  +     T++ +    S ASRAL ES  +++  +       F DLK+++YDLPA
Sbjct  61   ISNHPNQNNNKQPTSLSKTHFSSLASRALFESTTNNITQKQGLP---FNDLKIFVYDLPA  117

Query  594  KYNVDWL-NERCSSHLFASEVAIHRAL  671
            KYN DWL NERCS+HLFASEVAIHRAL
Sbjct  118  KYNTDWLKNERCSTHLFASEVAIHRAL  144



>gb|EYU36147.1| hypothetical protein MIMGU_mgv1a006282mg [Erythranthe guttata]
Length=449

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 90/140 (64%), Gaps = 28/140 (20%)
 Frame = +3

Query  264  TEMRRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPAT  443
            T   R +  N GF+                FC+RYFKW+LWFS+SFYFF+SF   + P +
Sbjct  8    TRNNRSSDNNGGFFF---------------FCYRYFKWILWFSISFYFFSSF--LNNPTS  50

Query  444  SAIISRTTVVRQSKASRALIESH--NSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-  614
            ++IISRTTV R   ASRALIE    NSS       H  +FK +KVY+YDLP+KYN DWL 
Sbjct  51   TSIISRTTVYRTKLASRALIEQSFVNSS-------HGVLFKGMKVYVYDLPSKYNADWLS  103

Query  615  -NERCSSHLFASEVAIHRAL  671
             N+RC SHLFASEVAIHRAL
Sbjct  104  TNQRCGSHLFASEVAIHRAL  123



>gb|ABI64067.1| glycosyltransferase GT47C [Populus tremula x Populus alba]
Length=442

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +3

Query  333  RQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAIISRTTVVR-QSKASRALIES  509
            +Q  +K+ C +Y+KWLLWFSL  YF +S  FTHKP     +S+T V   ++  SRAL ES
Sbjct  12   QQEKKKNLCFKYYKWLLWFSLLLYFLSSCFFTHKPIP---LSKTHVSESKTVVSRALFES  68

Query  510  HNSSLLHQP-NTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
             NS+ + Q  N ++ + KDLKVYIY+LP+KYN DWL NERCS+HLFASEVAIH+AL+S
Sbjct  69   SNSTFIQQSRNINRGLLKDLKVYIYELPSKYNTDWLENERCSNHLFASEVAIHKALSS  126



>ref|XP_008226491.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Prunus mume]
Length=461

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 97/148 (66%), Gaps = 15/148 (10%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGR-------QASEKSFCHRYfkwllwfslsfyffasf  419
            M E + +  +N+GFYVRMKLL PG+       Q  +K+F +R  KW+LW SLSFYFF+S+
Sbjct  1    MLEQKIRAPKNRGFYVRMKLL-PGKHGRSSVPQLEKKNFFYRNCKWVLWLSLSFYFFSSY  59

Query  420  ifTHKPATSAIISRTTVVR---QSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLP  590
            + ++ P        T + +    S ASRAL ES  +++  +       F DLK+++YDLP
Sbjct  60   LISNHPNQKNNKQPTALSKTHFSSLASRALFESTTNNITQKQGLP---FNDLKIFVYDLP  116

Query  591  AKYNVDWL-NERCSSHLFASEVAIHRAL  671
            AKYN DWL NERCS+HLFASEVAIHRAL
Sbjct  117  AKYNTDWLKNERCSTHLFASEVAIHRAL  144



>gb|AAX33322.1| secondary cell wall-related glycosyltransferase family 47 [Populus 
tremula x Populus tremuloides]
Length=442

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 87/118 (74%), Gaps = 6/118 (5%)
 Frame = +3

Query  333  RQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAIISRTTVVR-QSKASRALIES  509
            +Q  +K+ C +Y+KWLLWFSL  YF +S  FTHKP     +S+T V   ++  SRAL ES
Sbjct  12   QQEKKKNLCFKYYKWLLWFSLLLYFLSSCFFTHKPIP---LSKTHVSESKTVVSRALFES  68

Query  510  HNSSLLHQP-NTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
             NS+ + Q  N ++ + KDLKVYIY+LP+KYN DWL NERCS+HLFASEVAIH+AL+S
Sbjct  69   SNSTFIQQSRNINRGLLKDLKVYIYELPSKYNTDWLANERCSNHLFASEVAIHKALSS  126



>ref|XP_008349792.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Malus domestica]
Length=313

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 98/159 (62%), Gaps = 27/159 (17%)
 Frame = +3

Query  261  MTEMRRQ------TSRNKGFYVRMKLL----RPGR---QASEKSFCHRYfkwllwfslsf  401
            M E++ Q        R +GFYVRMKLL      GR   Q  +K+F +RY KW+LW SLS 
Sbjct  1    MVELQHQQKQIERAPRARGFYVRMKLLPTTKNGGRLVPQLEKKNFFYRYCKWVLWLSLSL  60

Query  402  yffasfifTH------KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKD  563
            YFF+SF+ ++      KP TS     +T    + A+RALIES   + ++       +F  
Sbjct  61   YFFSSFLISNHNEEQNKPPTSL----STTHFSTFAARALIES---ATINNATKQGTLFDG  113

Query  564  LKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            LKVY+YDLP KYN DWL NERCSSHLFASEVAIHRAL +
Sbjct  114  LKVYVYDLPPKYNTDWLKNERCSSHLFASEVAIHRALLT  152



>ref|XP_010111837.1| putative glucuronoxylan glucuronosyltransferase IRX7 [Morus notabilis]
 gb|EXC31802.1| putative glucuronoxylan glucuronosyltransferase IRX7 [Morus notabilis]
Length=471

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 88/151 (58%), Gaps = 20/151 (13%)
 Frame = +3

Query  276  RQTSRNKGFYVRMKLL--RPGRQASEKSFCHRY-------fkwllwfslsfyffasfifT  428
            ++T +N+GFYVRMKLL  + GR   EKS   RY          L +FS       +   T
Sbjct  9    KRTQKNRGFYVRMKLLQHKHGR-PHEKSCFFRYYKWLLWLSLTLYFFSPYLITTTTNTNT  67

Query  429  HKPATSAIISRTTVVRQSKASRALIESHNSS----LLHQPNTHQDVF---KDLKVYIYDL  587
            +       +S+T VV  S +SRALIE   S     +L Q +  Q +    KDLK+Y+YDL
Sbjct  68   NDNKNPTFLSKTRVV--SASSRALIEFTGSDSQSHILQQTHDQQGLLSSLKDLKIYVYDL  125

Query  588  PAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            P KYN DWL NERCS+HLFASEVAIHRAL +
Sbjct  126  PPKYNTDWLNNERCSNHLFASEVAIHRALLT  156



>ref|XP_009356930.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Pyrus x bretschneideri]
Length=464

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 95/148 (64%), Gaps = 13/148 (9%)
 Frame = +3

Query  258  EMTEMRRQTSRNKGFYVRMKLL----RPGR---QASEKSFCHRYfkwllwfslsfyffas  416
            E+ +  ++  R  GFYVRMKLL      GR   Q  +K+F +RY KW+LW SLS YFF+S
Sbjct  3    ELQQQIKRAPRATGFYVRMKLLPTTKNGGRLVPQLEKKNFFYRYCKWVLWLSLSLYFFSS  62

Query  417  fifTH--KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLP  590
            F+ ++  +  T    S +T    + A+RALIES   + ++       +F  L+VY+YDLP
Sbjct  63   FLISNHNEEQTKPTTSLSTTHFSTFAARALIES---ATINNATKQGTLFDGLRVYVYDLP  119

Query  591  AKYNVDWL-NERCSSHLFASEVAIHRAL  671
             KYN DWL NERCSSHLFASEVAIHRAL
Sbjct  120  PKYNTDWLKNERCSSHLFASEVAIHRAL  147



>ref|XP_011088792.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Sesamum indicum]
Length=461

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 13/149 (9%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQAS--EKSFCHR-YfkwllwfslsfyffasfifTH  431
            M E ++   R+ GFYVRM+L    R     +KSFC+R +   L +    ++F +  I ++
Sbjct  1    MLETKKPLIRSSGFYVRMRLPHNARNNRNLQKSFCYRCFKWILWFSISFYFFSSFLITSN  60

Query  432  KPATSAIISRTTVVRQSKASRALIESH----NSSLLHQPNTHQD--VFKDLKVYIYDLPA  593
            KP  S  +S+TT+    + +RALIE      +++  H      D  + K +KVY+YDLP+
Sbjct  61   KPTPS--LSKTTI-SHFREARALIEEQPLDSSAAFRHHLKNPGDSNILKGMKVYVYDLPS  117

Query  594  KYNVDWL-NERCSSHLFASEVAIHRALAS  677
            KYN DWL NERCSSHLFA+EVAIH AL S
Sbjct  118  KYNRDWLSNERCSSHLFAAEVAIHGALMS  146



>ref|XP_008385513.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Malus domestica]
Length=467

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 98/159 (62%), Gaps = 27/159 (17%)
 Frame = +3

Query  261  MTEMRRQ------TSRNKGFYVRMKLL----RPGR---QASEKSFCHRYfkwllwfslsf  401
            M E++ Q        R +GFYVRMKLL      GR   Q  +K+F +RY KW+LW SLS 
Sbjct  1    MVELQHQQKQIERAPRARGFYVRMKLLPTTKNGGRLVPQLEKKNFFYRYCKWVLWLSLSL  60

Query  402  yffasfifTH------KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKD  563
            YFF+SF+ ++      KP TS     +T    + A+RALIES   + ++       +F  
Sbjct  61   YFFSSFLISNHNEEQNKPPTSL----STTHFSTFAARALIES---ATINNATKQGTLFDG  113

Query  564  LKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            LKVY+YDLP KYN DWL NERCSSHLFASEVAIHRAL +
Sbjct  114  LKVYVYDLPPKYNTDWLKNERCSSHLFASEVAIHRALLT  152



>gb|EYU37036.1| hypothetical protein MIMGU_mgv1a0063812mg, partial [Erythranthe 
guttata]
Length=291

 Score = 90.1 bits (222),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 90/138 (65%), Gaps = 13/138 (9%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPA  440
            M E  ++  RN+GFY++MK L    +       HRYFKW+LWFS+SFYFF+ F+ T    
Sbjct  4    MAETTKRPLRNRGFYLKMKFLHNNTR-------HRYFKWILWFSISFYFFSYFLITQNKP  56

Query  441  TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-N  617
                +SRTT  R ++ASRA++E    S L +   +      +KVY+YDLPA+YN DWL N
Sbjct  57   IITSLSRTTFSR-TQASRAVVEESPLSYLQRFEENSG----MKVYVYDLPAEYNSDWLSN  111

Query  618  ERCSSHLFASEVAIHRAL  671
            ERC SHLFASEVA+HRAL
Sbjct  112  ERCGSHLFASEVAVHRAL  129



>ref|XP_010031409.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Eucalyptus grandis]
Length=469

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 96/152 (63%), Gaps = 16/152 (11%)
 Frame = +3

Query  261  MTEMRR--QTSRNKGFYVRMKLLRP-GRQ-----ASEKSFCHRYfkwllwfslsfyffas  416
            M E++R   TS+++GFYVRM+LL   G+        +KSF HRY+KW+LW SLSFYFF  
Sbjct  1    MAELKRAPPTSKSRGFYVRMRLLHGYGKHHQRLAQDKKSFFHRYYKWVLWLSLSFYFFCP  60

Query  417  fifTHKPATSAIISRTTVVRQSKASRALIESHNSSLL------HQPNTHQDVFKDLKVYI  578
            ++ +H P       RT     + +SRAL ES  S          +P   Q++ + LK+Y+
Sbjct  61   YLLSHSPKQRLNPLRTGSAGSTHSSRALFESSLSLSNSSSTRSQEPEIDQEL-RGLKIYV  119

Query  579  YDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            YDLP KYN +WL NERC +HLFASEVAIHRAL
Sbjct  120  YDLPPKYNSEWLSNERCRTHLFASEVAIHRAL  151



>gb|KCW50700.1| hypothetical protein EUGRSUZ_J00384 [Eucalyptus grandis]
Length=493

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 96/152 (63%), Gaps = 16/152 (11%)
 Frame = +3

Query  261  MTEMRR--QTSRNKGFYVRMKLLRP-GRQ-----ASEKSFCHRYfkwllwfslsfyffas  416
            M E++R   TS+++GFYVRM+LL   G+        +KSF HRY+KW+LW SLSFYFF  
Sbjct  1    MAELKRAPPTSKSRGFYVRMRLLHGYGKHHQRLAQDKKSFFHRYYKWVLWLSLSFYFFCP  60

Query  417  fifTHKPATSAIISRTTVVRQSKASRALIESHNSSLL------HQPNTHQDVFKDLKVYI  578
            ++ +H P       RT     + +SRAL ES  S          +P   Q++ + LK+Y+
Sbjct  61   YLLSHSPKQRLNPLRTGSAGSTHSSRALFESSLSLSNSSSTRSQEPEIDQEL-RGLKIYV  119

Query  579  YDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            YDLP KYN +WL NERC +HLFASEVAIHRAL
Sbjct  120  YDLPPKYNSEWLSNERCRTHLFASEVAIHRAL  151



>ref|XP_010267220.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Nelumbo nucifera]
Length=456

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 101/145 (70%), Gaps = 19/145 (13%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKP  437
            M E++R T        +M+LL + G+   +KSFC+RYF+W+LW SLS YFF+S++ +   
Sbjct  1    MVELKRTT--------KMRLLNKHGKH--DKSFCYRYFRWVLWVSLSLYFFSSYLISSSS  50

Query  438  ATSAIISRT-TVVRQSKASRALIESHNSSLLHQPNTH-----QDVFKDLKVYIYDLPAKY  599
             T+++   T +V + S  SRAL ES N+++  QP T+     + +F DLKVYIY+LP++Y
Sbjct  51   KTTSLPKTTVSVSKGSFLSRALFES-NTTVSQQPRTNGIHLSRGLFNDLKVYIYELPSRY  109

Query  600  NVDWL-NERCSSHLFASEVAIHRAL  671
            N DWL NERCS+HLFA+EVAIH+AL
Sbjct  110  NTDWLSNERCSNHLFAAEVAIHKAL  134



>ref|XP_009335974.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Pyrus x bretschneideri]
Length=466

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 93/148 (63%), Gaps = 21/148 (14%)
 Frame = +3

Query  276  RQTSRNKGFYVRMKLL----RPGR---QASEKSFCHRYfkwllwfslsfyffasfifTH-  431
            ++  R  GFYVRMKLL      GR   Q  +KSF ++Y KW+LW SLS YFF+SF+ ++ 
Sbjct  11   KRAPRANGFYVRMKLLPTTKNGGRLVPQLEKKSFFYKYCKWVLWLSLSLYFFSSFLISNH  70

Query  432  -----KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAK  596
                 KP TS     +T    + ASRAL ES   + ++       +F  +K+Y+YDLP K
Sbjct  71   NEQQNKPTTSL----STTHFSTFASRALFES---TAINNTTQQGALFDGMKIYVYDLPRK  123

Query  597  YNVDWL-NERCSSHLFASEVAIHRALAS  677
            YN DWL NERCS+HLFASEVAIHRAL +
Sbjct  124  YNTDWLKNERCSTHLFASEVAIHRALLT  151



>ref|XP_009345746.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Pyrus x bretschneideri]
Length=466

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 92/146 (63%), Gaps = 21/146 (14%)
 Frame = +3

Query  276  RQTSRNKGFYVRMKLL----RPGR---QASEKSFCHRYfkwllwfslsfyffasfifTH-  431
            ++  R  GFYVRMKLL      GR   Q  +KSF ++Y KW+LW SLS YFF+SF+ ++ 
Sbjct  11   KRAPRANGFYVRMKLLPTTKNGGRLVPQLEKKSFFYKYCKWVLWLSLSLYFFSSFLISNH  70

Query  432  -----KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAK  596
                 KP TS     +T    + ASRAL ES   + ++       +F  +K+Y+YDLP K
Sbjct  71   NEQQNKPTTSL----STTHFSTFASRALFES---AAINNTTQQGALFDGMKIYVYDLPRK  123

Query  597  YNVDWL-NERCSSHLFASEVAIHRAL  671
            YN DWL NERCS+HLFASEVAIHRAL
Sbjct  124  YNTDWLKNERCSTHLFASEVAIHRAL  149



>gb|KHF98105.1| putative glucuronoxylan glucuronosyltransferase IRX7 -like protein 
[Gossypium arboreum]
Length=437

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 83/121 (69%), Gaps = 3/121 (2%)
 Frame = +3

Query  312  MKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAIISRTTVVRQSKAS  491
            M++L  GRQ SEKS   +Y+KW+LWFS + YF  SF  T+KP   +  +R +  + S AS
Sbjct  1    MRILHKGRQ-SEKSLFFKYYKWVLWFSFTLYFLTSFFITNKPLPLSK-TRVSGSKSSLAS  58

Query  492  RALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRA  668
            R L ES N +       +   FKDLK+++Y+LP++YN DWL N+RCS+HLFASEVAIHRA
Sbjct  59   RVLFESVNKTRHKSKPKNPAAFKDLKIFVYELPSEYNEDWLSNKRCSNHLFASEVAIHRA  118

Query  669  L  671
            L
Sbjct  119  L  119



>gb|KJB83884.1| hypothetical protein B456_013G269400 [Gossypium raimondii]
Length=437

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = +3

Query  312  MKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAIISRTTVVRQSKAS  491
            M+ L  GRQ SEKS   +Y+KW+LWFS + YF  SF  T+KP   +  +R +  + S AS
Sbjct  1    MRTLHKGRQ-SEKSLFFKYYKWVLWFSFTLYFLTSFFITNKPLPLSK-TRVSGSKSSLAS  58

Query  492  RALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRA  668
            R L ES N +       +   FKDLK++IY+LP++YN DWL N+RCS+HLFASEVAIHRA
Sbjct  59   RVLFESVNKTRHKSKPKNPAAFKDLKIFIYELPSEYNEDWLSNKRCSNHLFASEVAIHRA  118

Query  669  L  671
            L
Sbjct  119  L  119



>ref|XP_003539434.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
[Glycine max]
Length=459

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 94/146 (64%), Gaps = 19/146 (13%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasfif  425
            M+E +++  +++ FYVRMKLL     +P +  +   F H Y+KW+LWFS S YFF S++ 
Sbjct  1    MSE-QKKPPQSRVFYVRMKLLHKQGNKPQQDKNNNCF-HTYYKWVLWFSFSLYFFTSYLI  58

Query  426  THKPATSAIISRTTVVRQSKA---SRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAK  596
            T  P  +   + T+ V  S++   S  L+ES  ++L         V K++KV++Y+LP K
Sbjct  59   TSNPNNTPTSADTSHVSNSESNVVSPTLVESTTNTL--------GVLKNMKVFVYELPPK  110

Query  597  YNVDWL-NERCSSHLFASEVAIHRAL  671
            YN DWL NERCSSHLFASEVAIHRAL
Sbjct  111  YNTDWLANERCSSHLFASEVAIHRAL  136



>ref|XP_006409832.1| hypothetical protein EUTSA_v10016649mg [Eutrema salsugineum]
 gb|ESQ51285.1| hypothetical protein EUTSA_v10016649mg [Eutrema salsugineum]
Length=450

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 55/70 (79%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSL---LHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+++L     +PN   DVF +LK+Y+YDLP+K+N DWL N+RCS+HLFA+
Sbjct  65   ASRAVFESKIHDNTLGFAPQRPNIRTDVFNNLKIYVYDLPSKFNTDWLANDRCSNHLFAA  124

Query  648  EVAIHRALAS  677
            EVA+H+AL S
Sbjct  125  EVALHKALLS  134



>ref|XP_007132325.1| hypothetical protein PHAVU_011G085300g [Phaseolus vulgaris]
 gb|ESW04319.1| hypothetical protein PHAVU_011G085300g [Phaseolus vulgaris]
Length=459

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 88/145 (61%), Gaps = 21/145 (14%)
 Frame = +3

Query  270  MRRQTSRNKGFYVRMKLL-RPGR--QASEKSFCHRYfkwllwfslsfyffasfifTHKPA  440
            + +    ++G+YV+MKLL + GR     EK+  ++Y+KWLLW SLS YFF          
Sbjct  3    LHKTAPNSRGYYVKMKLLHKHGRLHHHQEKNCFYKYYKWLLWLSLSLYFF----------  52

Query  441  TSAIISRTTVVRQ------SKASRALIESHNSSLLHQPN-THQDVFKDLKVYIYDLPAKY  599
            TS +IS     +Q      +  SR LIES+N++     N       K+LKV++YDLP KY
Sbjct  53   TSYLISNNNTPKQPPSLKTTHGSRTLIESNNTAPPQSLNYLGHGSLKNLKVFVYDLPPKY  112

Query  600  NVDWL-NERCSSHLFASEVAIHRAL  671
            N DWL NERCS HLFASEVAIHRAL
Sbjct  113  NTDWLSNERCSKHLFASEVAIHRAL  137



>gb|AAL91236.1| unknown protein [Arabidopsis thaliana]
 gb|AAP13364.1| At2g28110 [Arabidopsis thaliana]
Length=214

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSLL---HQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     QPN   DVF +LK+Y+YDLP+K+N DWL N+RC++HLFA+
Sbjct  63   ASRAMFESKIHDHKLGFTSQQPNIKTDVFNNLKIYVYDLPSKFNKDWLANDRCTNHLFAA  122

Query  648  EVAIHRALAS  677
            EVA+H+A  S
Sbjct  123  EVALHKAFLS  132



>ref|XP_004287555.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Fragaria vesca subsp. vesca]
Length=456

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 82/146 (56%), Gaps = 12/146 (8%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasf-i  422
            M E  R   +++GFYVRMKL      RP  + S  ++C       L       +  S   
Sbjct  1    MLEQNR-APKSRGFYVRMKLQNSKHGRPQDKGSFYTYCKWVLWLSLTLYFFSSYLISNHP  59

Query  423  fTHKPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
              +KP TS  +S+T     +  SRAL ES   +       ++++FK LKV++YDLPAKYN
Sbjct  60   NQNKPTTS--LSKTHF--STLPSRALFESVIDNTTTALLKNKELFKGLKVFVYDLPAKYN  115

Query  603  VDWL-NERCSSHLFASEVAIHRALAS  677
             +WL N+RC +HLFA+EVAIHRA+ +
Sbjct  116  TNWLSNDRCRTHLFAAEVAIHRAILT  141



>ref|XP_009140845.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Brassica rapa]
Length=451

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 6/69 (9%)
 Frame = +3

Query  489  SRALIES-----HNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASE  650
            SRA+ ES      +   L +PN   DVF +LK+Y+YDLP+K+N DWL NERCS+HLFA+E
Sbjct  66   SRAMFESKIHDQRHGFPLQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANERCSNHLFAAE  125

Query  651  VAIHRALAS  677
            VA+H+AL S
Sbjct  126  VALHKALLS  134



>gb|KHN38711.1| Putative glucuronoxylan glucuronosyltransferase IRX7 [Glycine 
soja]
Length=460

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 94/152 (62%), Gaps = 25/152 (16%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRP-GRQA-------SEKSFCHRYfkwllwfslsfyffas  416
            M + +R  + ++G+YV+MKLL+  GR          EK+  +RY+KW+LW SLS YFF  
Sbjct  1    MAQQKRPPN-SRGYYVKMKLLQKHGRPHHHHHHHQQEKNCFYRYYKWVLWLSLSLYFF--  57

Query  417  fifTHKPATSAIISRTT---VVRQSKASRALIES-HNSSLLHQPNTHQDVFKDLKVYIYD  584
                    TS +IS        + S  SRALI+S H ++  H  N+ + + K LKV++YD
Sbjct  58   --------TSYLISNNNNHHTKKPSHVSRALIQSNHTTTPQHALNSPESL-KKLKVFVYD  108

Query  585  LPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            LP KYN DWL NERCS HLFASEVAIHRAL +
Sbjct  109  LPPKYNTDWLTNERCSKHLFASEVAIHRALLT  140



>emb|CDX77156.1| BnaC04g39510D [Brassica napus]
Length=504

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES-----HNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            +SRA+ ES      +   L +PN   DVF +LK+Y+YDLP+K+N DWL NERCS+HLFA+
Sbjct  65   SSRAMFESKIHDQRHGFPLQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANERCSNHLFAA  124

Query  648  EVAIHRALAS  677
            EVA+H+AL S
Sbjct  125  EVALHKALLS  134



>ref|XP_003538175.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
[Glycine max]
Length=460

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 71/152 (47%), Positives = 94/152 (62%), Gaps = 25/152 (16%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRP-GRQAS-------EKSFCHRYfkwllwfslsfyffas  416
            M + +R  + ++G+YV+MKLL+  GR          EK+  +RY+KW+LW SLS YFF  
Sbjct  1    MAQQKRPPN-SRGYYVKMKLLQKHGRPHHHHHHHQQEKNCFYRYYKWVLWLSLSLYFF--  57

Query  417  fifTHKPATSAIISRTT---VVRQSKASRALIES-HNSSLLHQPNTHQDVFKDLKVYIYD  584
                    TS +IS        + S  SRALI+S H ++  H  N+ + + K LKV++YD
Sbjct  58   --------TSYLISNNNNHHTKKPSHVSRALIQSNHTTTPQHALNSPESL-KKLKVFVYD  108

Query  585  LPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            LP KYN DWL NERCS HLFASEVAIHRAL +
Sbjct  109  LPPKYNTDWLTNERCSKHLFASEVAIHRALLT  140



>ref|XP_010473197.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Camelina sativa]
Length=451

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSLL---HQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     +PN   DVF +LK+Y+YDLP+K+N DWL N+RCS+HLFA+
Sbjct  67   ASRAMFESKIHDHKLWFAPQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANDRCSNHLFAA  126

Query  648  EVAIHRALAS  677
            EVA+H+AL S
Sbjct  127  EVALHKALLS  136



>emb|CDY30507.1| BnaA04g16260D [Brassica napus]
Length=451

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 6/69 (9%)
 Frame = +3

Query  489  SRALIES-----HNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASE  650
            SRA+ ES      +   L +PN   DVF +LK+Y+YDLP+K+N DWL NERCS+HLFA+E
Sbjct  66   SRAMFESKIHDQRHGFPLQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANERCSNHLFAAE  125

Query  651  VAIHRALAS  677
            VA+H+AL S
Sbjct  126  VALHKALLS  134



>ref|XP_006294207.1| hypothetical protein CARUB_v10023203mg [Capsella rubella]
 gb|EOA27105.1| hypothetical protein CARUB_v10023203mg [Capsella rubella]
Length=449

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSL---LHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     +PN   DVF +LK+Y+YDLP+K+N DWL NERCS+HLFA+
Sbjct  64   ASRAMFESNIHDHKLGFAPQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANERCSNHLFAA  123

Query  648  EVAIHRALAS  677
            EVA+H+A  S
Sbjct  124  EVALHKAFLS  133



>gb|KHN21487.1| Putative glucuronoxylan glucuronosyltransferase IRX7 [Glycine 
soja]
Length=458

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 93/146 (64%), Gaps = 17/146 (12%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasfif  425
            M+E +++  +++ FY+RMKLL     +P +Q    ++ H Y+KW+LW S S YFF S++ 
Sbjct  1    MSE-QKKPPKSRVFYLRMKLLHKQGNKP-QQDKNNNWFHTYYKWVLWLSFSLYFFTSYLI  58

Query  426  THKPA-TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
            T  P  T+   S  +    +   R L+ES +++L         V K++KV++Y+LP KYN
Sbjct  59   TSNPNNTNTPTSHVSNSESNVVPRTLVESTSNTL--------GVLKNMKVFVYELPPKYN  110

Query  603  VDWL-NERCSSHLFASEVAIHRALAS  677
             DWL NERCS+HLFASEVAIHRAL +
Sbjct  111  TDWLANERCSNHLFASEVAIHRALLT  136



>ref|XP_010417952.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
isoform X1 [Camelina sativa]
 ref|XP_010417953.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
isoform X2 [Camelina sativa]
Length=453

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSL---LHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     +PN   DVF +LK+Y+YDLP+K+N DWL N+RCS+HLFA+
Sbjct  69   ASRAMFESKIHDHKLGFAPQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANDRCSNHLFAA  128

Query  648  EVAIHRALAS  677
            EVA+H+AL S
Sbjct  129  EVALHKALLS  138



>ref|XP_003541982.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
[Glycine max]
Length=458

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 93/146 (64%), Gaps = 17/146 (12%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasfif  425
            M+E +++  +++ FY+RMKLL     +P +Q    ++ H Y+KW+LW S S YFF S++ 
Sbjct  1    MSE-QKKPPKSRVFYLRMKLLHKQGNKP-QQDKNNNWFHTYYKWVLWLSFSLYFFTSYLI  58

Query  426  THKPA-TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYN  602
            T  P  T+   S  +    +   R L+ES +++L         V K++KV++Y+LP KYN
Sbjct  59   TSNPNNTNTPTSHVSNSESNVVPRTLVESTSNTL--------GVLKNMKVFVYELPPKYN  110

Query  603  VDWL-NERCSSHLFASEVAIHRALAS  677
             DWL NERCS+HLFASEVAIHRAL +
Sbjct  111  TDWLANERCSNHLFASEVAIHRALLT  136



>gb|KFK33941.1| hypothetical protein AALP_AA5G081400 [Arabis alpina]
Length=380

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = +3

Query  510  HNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            H+  L  +PN   DVF  LK+Y+YDLP+K+N DWL NERCS+HLFA+EVA+H+AL S
Sbjct  7    HDHKLGPRPNIRTDVFNKLKIYVYDLPSKFNKDWLANERCSNHLFAAEVALHKALLS  63



>ref|NP_850113.2| probable glucuronoxylan glucuronosyltransferase IRX7 [Arabidopsis 
thaliana]
 sp|Q9ZUV3.1|IRX7_ARATH RecName: Full=Probable glucuronoxylan glucuronosyltransferase 
IRX7; AltName: Full=Protein FRAGILE FIBER 8; AltName: Full=Protein 
IRREGULAR XYLEM 7 [Arabidopsis thaliana]
 gb|AAC98455.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABA60868.1| putative glucuronyltransferase [Arabidopsis thaliana]
 gb|ABA60869.1| putative glucuronyltransferase [Arabidopsis thaliana]
 gb|AEC08081.1| probable glucuronoxylan glucuronosyltransferase IRX7 [Arabidopsis 
thaliana]
 gb|AHL38834.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=448

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSLL---HQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     QPN   DVF +LK+Y+YDLP+K+N DWL N+RC++HLFA+
Sbjct  63   ASRAMFESKIHDHKLGFTSQQPNIKTDVFNNLKIYVYDLPSKFNKDWLANDRCTNHLFAA  122

Query  648  EVAIHRALAS  677
            EVA+H+A  S
Sbjct  123  EVALHKAFLS  132



>ref|XP_009103648.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Brassica rapa]
Length=453

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSLL---HQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            AS A+ ES  H+ +L+    +PN   DVF +LK+Y+YDLP+K+N DWL N RCS+HLFA+
Sbjct  67   ASHAVFESKIHDHALIFPPQRPNIRTDVFNNLKIYVYDLPSKFNTDWLANNRCSNHLFAA  126

Query  648  EVAIHRALAS  677
            EVA+H+AL S
Sbjct  127  EVALHKALLS  136



>ref|XP_002879114.1| hypothetical protein ARALYDRAFT_481698 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55373.1| hypothetical protein ARALYDRAFT_481698 [Arabidopsis lyrata subsp. 
lyrata]
Length=452

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSLL---HQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     +PN   DVF +LK+Y+YDLP+K+N DWL N+RCS+HLFA+
Sbjct  67   ASRAMFESKIHDHKLGFAPQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANDRCSNHLFAA  126

Query  648  EVAIHRALAS  677
            EVA+H+A  S
Sbjct  127  EVALHKAFLS  136



>ref|XP_004506065.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H-like 
[Cicer arietinum]
Length=449

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 87/141 (62%), Gaps = 14/141 (10%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKP  437
            M    ++ S+N+G+YV+MKL+ + GR   EK+F  +Y+K++LW SLSFYFF         
Sbjct  1    MENQNKRPSKNRGYYVKMKLMHKHGRPQQEKNFFIKYYKYVLWLSLSFYFF---------  51

Query  438  ATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-  614
             +S +I+   +      +  +  S + S     N  +   K+LK++IYDLP  YN +WL 
Sbjct  52   -SSYLINNNNIKHPKTTTTHISISLSQSF--STNKTKSHLKNLKLFIYDLPPNYNTNWLS  108

Query  615  NERCSSHLFASEVAIHRALAS  677
            NERCS+HLFASEVAIHRAL +
Sbjct  109  NERCSTHLFASEVAIHRALLT  129



>ref|XP_010510691.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Camelina sativa]
Length=452

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSL---LHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            ASRA+ ES  H+  L     +PN   DVF +LK+Y+YDLP+K+N DWL N+RCS+HLFA+
Sbjct  67   ASRAMFESKIHDHKLGFAPQRPNIRTDVFNNLKIYVYDLPSKFNKDWLANDRCSNHLFAA  126

Query  648  EVAIHRALAS  677
            EVA+H+A  S
Sbjct  127  EVALHKAFLS  136



>ref|XP_010689136.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 78/138 (57%), Gaps = 5/138 (4%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPA  440
            M +    T   KGFYVRM+LL    +  +++  H Y+ +  +    ++F + ++F   P 
Sbjct  1    MVDFNIPTKGRKGFYVRMRLLNTNNRHGKRNSPHYYYFYRCFKWFVWFFISFYLFISFPP  60

Query  441  TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-N  617
                I+       S  SR L+E   +      ++  D F+ LK+Y+YDLPAKYN DWL N
Sbjct  61   ---FINSDHSPNSSIKSRLLVE-QTTPSSSSSSSSSDSFEGLKIYVYDLPAKYNKDWLIN  116

Query  618  ERCSSHLFASEVAIHRAL  671
            +RC SHLFASEVAIH+AL
Sbjct  117  KRCKSHLFASEVAIHKAL  134



>gb|KHN21068.1| Putative glucuronoxylan glucuronosyltransferase IRX7 [Glycine 
soja]
Length=461

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 86/153 (56%), Gaps = 26/153 (17%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQAS-------EKSFCHRYfkwllwfslsfyffasf  419
            M + R   SR  G+YV+MKLL    +         EK+  +RY+KW+LW SLS YFF   
Sbjct  1    MAQKRPPNSR--GYYVKMKLLHKHGRPHHHHQQQQEKNCLYRYYKWVLWLSLSLYFF---  55

Query  420  ifTHKPATSAIISRTTVV-----RQSKASRALIES-HNSSLLHQPNTHQDVFKDLKVYIY  581
                   TS +IS          + S  SRAL+ES H +    Q        K+LKV++Y
Sbjct  56   -------TSYLISNNNNNNNHSKQPSHVSRALMESNHTTPPQQQALNSLGSLKNLKVFVY  108

Query  582  DLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            DLP KYN DWL NERCS HLFASEVAIHRAL +
Sbjct  109  DLPQKYNTDWLSNERCSKHLFASEVAIHRALLT  141



>ref|XP_003539788.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
isoform X1 [Glycine max]
 ref|XP_006592279.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
isoform X2 [Glycine max]
 ref|XP_006592280.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
isoform X3 [Glycine max]
Length=461

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 86/153 (56%), Gaps = 26/153 (17%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLLRPGRQAS-------EKSFCHRYfkwllwfslsfyffasf  419
            M + R   SR  G+YV+MKLL    +         EK+  +RY+KW+LW SLS YFF   
Sbjct  1    MAQKRPPNSR--GYYVKMKLLHKHGRPHHHHQQQQEKNCLYRYYKWVLWLSLSLYFF---  55

Query  420  ifTHKPATSAIISRTTVV-----RQSKASRALIES-HNSSLLHQPNTHQDVFKDLKVYIY  581
                   TS +IS          + S  SRAL+ES H +    Q        K+LKV++Y
Sbjct  56   -------TSYLISNNNNNNHHSKQPSHVSRALMESNHTTPPQQQALNSLGSLKNLKVFVY  108

Query  582  DLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            DLP KYN DWL NERCS HLFASEVAIHRAL +
Sbjct  109  DLPQKYNTDWLSNERCSKHLFASEVAIHRALLT  141



>gb|KJB83885.1| hypothetical protein B456_013G269400 [Gossypium raimondii]
Length=433

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 81/121 (67%), Gaps = 7/121 (6%)
 Frame = +3

Query  312  MKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAIISRTTVVRQSKAS  491
            M+ L  GRQ SEKS   +Y+KW+LWFS + YF  SF  T+KP   +  +R +  + S AS
Sbjct  1    MRTLHKGRQ-SEKSLFFKYYKWVLWFSFTLYFLTSFFITNKPLPLSK-TRVSGSKSSLAS  58

Query  492  RALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRA  668
            R L ES N +  H+         DLK++IY+LP++YN DWL N+RCS+HLFASEVAIHRA
Sbjct  59   RVLFESVNKTR-HKSKPKN---PDLKIFIYELPSEYNEDWLSNKRCSNHLFASEVAIHRA  114

Query  669  L  671
            L
Sbjct  115  L  115



>emb|CDY04537.1| BnaA07g13630D [Brassica napus]
Length=453

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 6/70 (9%)
 Frame = +3

Query  486  ASRALIES--HNSSLL---HQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFAS  647
            AS A+ ES  H+ +L+    +PN   DVF ++K+Y+YDLP+K+N DWL N RC +HLFA+
Sbjct  67   ASHAVFESKIHDHALIFPPQRPNIRTDVFNNMKIYVYDLPSKFNTDWLANNRCRNHLFAA  126

Query  648  EVAIHRALAS  677
            EVA+H+AL S
Sbjct  127  EVALHKALLS  136



>ref|XP_007150147.1| hypothetical protein PHAVU_005G130800g [Phaseolus vulgaris]
 gb|ESW22141.1| hypothetical protein PHAVU_005G130800g [Phaseolus vulgaris]
Length=451

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 90/141 (64%), Gaps = 16/141 (11%)
 Frame = +3

Query  261  MTEMRRQTSRNKGFYVRMKLL-RPGRQASEK--SFCHRYfkwllwfslsfyffasfifTH  431
            M+E +++  +++  YV MKLL +PG +  ++  SF H Y+KW+LW SLS YFF S++ T 
Sbjct  1    MSE-QKKPPKSRVIYVGMKLLHKPGNKPLQEKNSFFHAYYKWVLWLSLSLYFFTSYLITS  59

Query  432  KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDW  611
             P  +     T+        RA +++  +SL         V K+LK+++Y+LP KYN DW
Sbjct  60   NPNNAPTSPDTS---SHVVPRAFVDTTTNSL--------GVLKNLKLFVYELPPKYNTDW  108

Query  612  L-NERCSSHLFASEVAIHRAL  671
            L N+RC++HLFASEVAIHRAL
Sbjct  109  LANKRCANHLFASEVAIHRAL  129



>ref|XP_010521727.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Tarenaya hassleriana]
Length=450

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 3/63 (5%)
 Frame = +3

Query  486  ASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIH  662
            ASRA+IES   S+   PN        LK+Y+Y+LP+K+N DWL N+RC SHLFA+EVA+H
Sbjct  71   ASRAVIESE--SIGQDPNVKPGKLNGLKIYVYELPSKFNKDWLQNDRCGSHLFAAEVALH  128

Query  663  RAL  671
            RAL
Sbjct  129  RAL  131



>emb|CDX71023.1| BnaC03g11070D [Brassica napus]
Length=463

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 6/68 (9%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  S ALIES   S + +P  H  +F  +K+Y+YDLPA+YNVDW+  ++RC+SHLFA+EV
Sbjct  84   SLPSHALIES---SAIVKP-AHTSIFSGMKIYVYDLPARYNVDWVTASDRCASHLFAAEV  139

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  140  AIHRALLS  147



>gb|AFK36383.1| unknown [Medicago truncatula]
Length=316

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 90/152 (59%), Gaps = 29/152 (19%)
 Frame = +3

Query  273  RRQTSRNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKP  437
            +++ S+NKG+YV+MKL+     RP +Q  EK+  H+Y+KW+LW SLS YFF         
Sbjct  6    KKKPSKNKGYYVKMKLMHKHGIRPQQQ--EKNHFHKYYKWILWLSLSLYFF---------  54

Query  438  ATSAIISRTTVVRQSKASR-----ALIESHNSSL-----LHQPNTHQDV-FKDLKVYIYD  584
             TS +IS       +   +     + I+S + SL        P T Q    K+LK+++YD
Sbjct  55   -TSYLISNNNNHNHNNNIKHHQITSTIKSLSQSLSIKKTTSSPQTLQKTSLKNLKIFVYD  113

Query  585  LPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            LP KYN +WL N RC +HLFASEVAIHRAL +
Sbjct  114  LPPKYNKNWLKNPRCKTHLFASEVAIHRALLT  145



>ref|XP_010493404.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Camelina sativa]
Length=469

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 7/68 (10%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES  S+L     T  D+F  +K+Y+YDLPA YN DW+  +ERCS+HLFA+EV
Sbjct  91   SLPSRALIES--SALT---TTSIDMFSGMKIYVYDLPASYNEDWVKSSERCSTHLFAAEV  145

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  146  AIHRALLS  153



>ref|XP_010421093.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Camelina sativa]
 ref|XP_010421094.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Camelina sativa]
Length=470

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 48/68 (71%), Gaps = 7/68 (10%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES   +      T  D+F  +K+Y+YDLPA YN DW+  +ERCS+HLFA+EV
Sbjct  92   SLPSRALIESSAIT-----TTSIDMFSGMKIYVYDLPASYNDDWVKSSERCSTHLFAAEV  146

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  147  AIHRALLS  154



>gb|AES88544.2| glycosyltransferase family 47 protein [Medicago truncatula]
Length=465

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 90/152 (59%), Gaps = 29/152 (19%)
 Frame = +3

Query  273  RRQTSRNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKP  437
            +++ S+NKG+YV+MKL+     RP +Q  EK+  H+Y+KW+LW SLS YFF         
Sbjct  6    KKKPSKNKGYYVKMKLMHKHGIRPQQQ--EKNHFHKYYKWILWLSLSLYFF---------  54

Query  438  ATSAIISRTTVVRQSKASR-----ALIESHNSSL-----LHQPNTHQDV-FKDLKVYIYD  584
             TS +IS       +   +     + I+S + SL        P T Q    K+LK+++YD
Sbjct  55   -TSYLISNNNNHNHNNNIKHHQITSTIKSLSQSLSIKKTTSSPQTLQKTSLKNLKIFVYD  113

Query  585  LPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            LP KYN +WL N RC +HLFASEVAIHRAL +
Sbjct  114  LPPKYNKNWLKNPRCKTHLFASEVAIHRALLT  145



>ref|XP_008359956.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7 
[Malus domestica]
Length=451

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = +3

Query  486  ASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIH  662
            ASRAL ES   + ++       +F  LK+Y+Y LP KYN DWL NERCS+HLFASEVAIH
Sbjct  75   ASRALFES---AAINNTTQQGALFDGLKIYVYXLPPKYNTDWLKNERCSTHLFASEVAIH  131

Query  663  RAL  671
            R L
Sbjct  132  RTL  134



>emb|CDY26971.1| BnaC09g36120D [Brassica napus]
Length=466

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 51/68 (75%), Gaps = 8/68 (12%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES   S + +P     +F  +K+Y+YDLPA++NVDW+  ++RC+SHLFA+EV
Sbjct  89   SLPSRALIES---SAILKPG---GLFSGMKIYVYDLPARFNVDWVTASDRCASHLFAAEV  142

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  143  AIHRALLS  150



>ref|XP_009131900.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Brassica rapa]
Length=463

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 6/68 (9%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  S ALIES   S + +P  H  +F  +K+Y+YDLPA++N DW+  ++RC+SHLFA+EV
Sbjct  84   SLPSHALIES---SAIVKP-AHASIFSGMKIYVYDLPARFNADWVTSSDRCASHLFAAEV  139

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  140  AIHRALLS  147



>ref|XP_006400803.1| hypothetical protein EUTSA_v10013464mg [Eutrema salsugineum]
 gb|ESQ42256.1| hypothetical protein EUTSA_v10013464mg [Eutrema salsugineum]
Length=465

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 9/68 (13%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES   S +  P     +F  +K+YIYDLPA++NVDW+  ++RC++HLFA+EV
Sbjct  89   SLPSRALIES---SAIVTPG----IFSGMKIYIYDLPARFNVDWVTKSDRCATHLFAAEV  141

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  142  AIHRALLS  149



>emb|CDX88775.1| BnaA03g08740D [Brassica napus]
Length=463

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 50/68 (74%), Gaps = 6/68 (9%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  S ALIES   S + +P  H  +F  +K+Y+YDLPA++N DW+  ++RC+SHLFA+EV
Sbjct  84   SLPSHALIES---SAIVKP-AHASIFSGMKIYVYDLPARFNADWVTSSDRCASHLFAAEV  139

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  140  AIHRALLS  147



>ref|XP_009120620.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Brassica rapa]
Length=467

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 8/68 (12%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES   S + +P      F  +K+Y+YDLPA++NVDW+  ++RC+SHLFA+EV
Sbjct  90   SLPSRALIES---SAILKPGGP---FSGMKIYVYDLPARFNVDWVTASDRCASHLFAAEV  143

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  144  AIHRALLS  151



>emb|CDY50331.1| BnaA10g13640D [Brassica napus]
Length=467

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 50/68 (74%), Gaps = 8/68 (12%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES   S + +P      F  +K+Y+YDLPA++NVDW+  ++RC+SHLFA+EV
Sbjct  90   SLPSRALIES---SAILKPGGP---FSGMKIYVYDLPARFNVDWVTASDRCASHLFAAEV  143

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  144  AIHRALLS  151



>ref|XP_004487567.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase IRX7-like 
[Cicer arietinum]
Length=464

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 12/137 (9%)
 Frame = +3

Query  288  RNKGFYVRMKLL------RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSA  449
            ++K +YV+MKL+      RP  Q  +  F   Y+KW+LW SLS YFF S++ T+ P    
Sbjct  9    KSKEWYVKMKLMNKHNNTRP--QHDKTCFFFTYYKWVLWLSLSLYFFTSYLITNDPIPQP  66

Query  450  IISRTTVVRQSKASRALIESHNSSLLHQPNTHQ--DVFKDLKVYIYDLPAKYNVDWL-NE  620
                T     +  S  +  SH  +  +  +TH    V K+LKV+IY+LP++YN DWL NE
Sbjct  67   TSQDTLTHVSNYKSNVVFHSHFETT-NTTSTHNALGVLKNLKVFIYELPSRYNKDWLFNE  125

Query  621  RCSSHLFASEVAIHRAL  671
            RC SHLFASEVAIHRAL
Sbjct  126  RCKSHLFASEVAIHRAL  142



>ref|XP_010535629.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Tarenaya hassleriana]
Length=474

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 8/67 (12%)
 Frame = +3

Query  489  SRALIESH--NSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEVA  656
            SRALIES   N++ + +P      FK +K+YIYDLP KYN DW+  ++RC++HLFA+EV+
Sbjct  96   SRALIESSAVNATSMVRPGA----FKGMKIYIYDLPEKYNSDWVASSDRCATHLFAAEVS  151

Query  657  IHRALAS  677
            +HRAL S
Sbjct  152  VHRALLS  158



>ref|XP_010454575.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Camelina sativa]
 ref|XP_010454576.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Camelina sativa]
Length=466

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 48/68 (71%), Gaps = 7/68 (10%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES   +      T  D+F  +K+Y+Y+LPA YN DW+  +ERC++HLFA+EV
Sbjct  88   SLPSRALIESSAIT-----TTSIDMFSGMKIYVYNLPASYNDDWVKSSERCATHLFAAEV  142

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  143  AIHRALLS  150



>gb|EPS70309.1| hypothetical protein M569_04450 [Genlisea aurea]
Length=407

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 52/82 (63%), Gaps = 7/82 (9%)
 Frame = +3

Query  444  SAIISRTTVVRQSKASRALIESH--NSS---LLHQPNTHQDVFKDLKVYIYDLPAKYNVD  608
            S  +SR TV   SKASRAL E    NSS        +    +F+ +KVY+YDLP KYN D
Sbjct  10   SVSVSRKTV-SPSKASRALAEDSYLNSSAPRRRRYRDDGDILFEGMKVYVYDLPEKYNRD  68

Query  609  WL-NERCSSHLFASEVAIHRAL  671
            WL +ERC  HLFA+EVAIH AL
Sbjct  69   WLSDERCGRHLFAAEVAIHEAL  90



>ref|NP_197685.2| probable glucuronoxylan glucuronosyltransferase F8H [Arabidopsis 
thaliana]
 sp|Q6NMM8.1|F8H_ARATH RecName: Full=Probable glucuronoxylan glucuronosyltransferase 
F8H; AltName: Full=FRA8 homolog; AltName: Full=Protein FRAGILE 
FIBER 8 homolog [Arabidopsis thaliana]
 gb|AAS47635.1| At5g22940 [Arabidopsis thaliana]
 gb|AAT47813.1| At5g22940 [Arabidopsis thaliana]
 gb|AED93099.1| probable glucuronoxylan glucuronosyltransferase F8H [Arabidopsis 
thaliana]
 gb|AHL38611.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=469

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 7/68 (10%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES          T   +F  +K+Y+YDLPA YN DW+  ++RC+SHLFA+EV
Sbjct  86   SLPSRALIESSAIK-----TTSIGLFTGMKIYVYDLPASYNDDWVTASDRCASHLFAAEV  140

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  141  AIHRALLS  148



>gb|KEH38871.1| glucuronoxylan glucuronosyltransferase, putative [Medicago truncatula]
Length=443

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 76/134 (57%), Gaps = 23/134 (17%)
 Frame = +3

Query  288  RNKGFYVRMKLL-----RPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAI  452
            +NKGFYVRMKL+     +P +   +  F   Y+KWLLWFSLS YFF S++ T+ P     
Sbjct  9    KNKGFYVRMKLMNKHNTKPQQDHHKTFFFFTYYKWLLWFSLSLYFFTSYLITNDPQDITT  68

Query  453  ISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCS  629
            I   +       +                   D+ K+LKV++Y+LP+KYN DWL N RC 
Sbjct  69   IVSNSNSNVVSHNSL-----------------DMLKNLKVFVYELPSKYNNDWLVNGRCK  111

Query  630  SHLFASEVAIHRAL  671
            +HLFASEVAIH AL
Sbjct  112  THLFASEVAIHTAL  125



>gb|KFK27620.1| hypothetical protein AALP_AA8G407200 [Arabis alpina]
Length=458

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 10/85 (12%)
 Frame = +3

Query  429  HKPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVD  608
            + P T+   +R      S  SRALIES   S +++ +    +F  +K+Y+Y+LP++YN D
Sbjct  67   YNPTTT---TRLLSYHSSLPSRALIES---SAINKSSI--GMFNGMKIYVYELPSRYNED  118

Query  609  WLNE--RCSSHLFASEVAIHRALAS  677
            W+ +  RCS+HLFASEVAIHRAL+S
Sbjct  119  WVTKSSRCSTHLFASEVAIHRALSS  143



>ref|XP_006851286.1| hypothetical protein AMTR_s00050p00076540 [Amborella trichopoda]
 gb|ERN12867.1| hypothetical protein AMTR_s00050p00076540 [Amborella trichopoda]
Length=367

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +3

Query  459  RTTV-VRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSS  632
            +TTV    S  SRAL+E + + +         ++  +KVY+YDLP+KYN  WL N RCS+
Sbjct  81   KTTVSTSDSLVSRALVELNETRMQPVQTLSPGLWNGMKVYVYDLPSKYNTRWLSNPRCST  140

Query  633  HLFASEVAIHRAL  671
            HLFA+EVAIH+ L
Sbjct  141  HLFAAEVAIHKVL  153



>ref|XP_010541310.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
isoform X2 [Tarenaya hassleriana]
Length=460

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 2/44 (5%)
 Frame = +3

Query  552  VFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            +FK +++YIYDLPAKYN DW+  ++RC++HLFA+EVA+HRAL S
Sbjct  101  IFKGMRIYIYDLPAKYNSDWVASSDRCATHLFAAEVAVHRALLS  144



>ref|XP_010541309.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
isoform X1 [Tarenaya hassleriana]
Length=467

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 39/44 (89%), Gaps = 2/44 (5%)
 Frame = +3

Query  552  VFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            +FK +++YIYDLPAKYN DW+  ++RC++HLFA+EVA+HRAL S
Sbjct  101  IFKGMRIYIYDLPAKYNSDWVASSDRCATHLFAAEVAVHRALLS  144



>ref|XP_003606347.1| Secondary cell wall-related glycosyltransferase family [Medicago 
truncatula]
Length=427

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 69/139 (50%), Gaps = 41/139 (29%)
 Frame = +3

Query  273  RRQTSRNKGFYVRMKLLRPGRQASEKSFCHRYfkwllwfslsfyffasfifTHKPATSAI  452
            +++ S+NKG+YV+MKL+         +                         H   TS I
Sbjct  6    KKKPSKNKGYYVKMKLINNNNHNHNNNI-----------------------KHHQITSTI  42

Query  453  --ISRTTVVRQSKASRALIESHNSSLLHQPNTHQDV-FKDLKVYIYDLPAKYNVDWL-NE  620
              +S++  ++++ +S              P T Q    K+LK+++YDLP KYN +WL N 
Sbjct  43   KSLSQSLSIKKTTSS--------------PQTLQKTSLKNLKIFVYDLPPKYNKNWLKNP  88

Query  621  RCSSHLFASEVAIHRALAS  677
            RC +HLFASEVAIHRAL +
Sbjct  89   RCKTHLFASEVAIHRALLT  107



>ref|XP_006288015.1| hypothetical protein CARUB_v10001248mg [Capsella rubella]
 gb|EOA20913.1| hypothetical protein CARUB_v10001248mg [Capsella rubella]
Length=360

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = +3

Query  552  VFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            +F  +K+Y+YDLPA YN DW+  +ERC++HLFA+EVAIHRAL S
Sbjct  1    MFSGMKIYVYDLPASYNEDWVKASERCATHLFAAEVAIHRALLS  44



>ref|XP_002872025.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48284.1| exostosin family protein [Arabidopsis lyrata subsp. lyrata]
Length=465

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 51/68 (75%), Gaps = 7/68 (10%)
 Frame = +3

Query  480  SKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEV  653
            S  SRALIES  S++  + N+   +F  +K+Y+YDLPA +N DW+  ++RC++HLFA+EV
Sbjct  87   SLPSRALIES--SAI--KTNSF-GLFSGMKIYVYDLPASFNDDWVTASDRCATHLFAAEV  141

Query  654  AIHRALAS  677
            AIHRAL S
Sbjct  142  AIHRALLS  149



>dbj|BAB10615.1| unnamed protein product [Arabidopsis thaliana]
Length=498

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +3

Query  546  QDVFKDLKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            + +F  +K+Y+YDLPA YN DW+  ++RC+SHLFA+EVAIHRAL S
Sbjct  132  KGLFTGMKIYVYDLPASYNDDWVTASDRCASHLFAAEVAIHRALLS  177



>ref|XP_008803446.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Phoenix 
dactylifera]
Length=450

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 10/78 (13%)
 Frame = +3

Query  441  TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-N  617
            T   + +TT+  ++   RALIE+ N+S    P         LK+Y+YDLP+KYN DWL +
Sbjct  56   TPTSLPKTTLPLKT-TPRALIEARNTSTQPPP--------PLKIYVYDLPSKYNRDWLAD  106

Query  618  ERCSSHLFASEVAIHRAL  671
             RC +HLF +EVA+H A 
Sbjct  107  RRCETHLFGAEVALHEAF  124



>ref|XP_008463382.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H 
[Cucumis melo]
Length=446

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 9/64 (14%)
 Frame = +3

Query  489  SRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWLNE-RCSSHLFASEVAIHR  665
            S+AL+ES   +     NT+     DLK+++YDLP ++N +WL++ RC  HLFASEVAIHR
Sbjct  79   SKALVES---TFDFHDNTN-----DLKIFVYDLPPEFNANWLSDARCGGHLFASEVAIHR  130

Query  666  ALAS  677
            AL +
Sbjct  131  ALLT  134



>ref|XP_004147302.1| PREDICTED: probable glucuronoxylan glucuronosyltransferase F8H-like 
[Cucumis sativus]
 gb|KGN64765.1| hypothetical protein Csa_1G095020 [Cucumis sativus]
Length=447

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 9/64 (14%)
 Frame = +3

Query  489  SRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWLNE-RCSSHLFASEVAIHR  665
            S+AL+ES   +  +  NT+     DLKV++YDLP ++N +WL++ RC  HLFASEVAIH+
Sbjct  80   SKALVES---TFDYYGNTN-----DLKVFVYDLPPEFNANWLSDARCGGHLFASEVAIHK  131

Query  666  ALAS  677
            AL +
Sbjct  132  ALLT  135



>ref|XP_002877828.1| hypothetical protein ARALYDRAFT_906539 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54087.1| hypothetical protein ARALYDRAFT_906539 [Arabidopsis lyrata subsp. 
lyrata]
Length=107

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            +K+Y+YDLPA +N DW+  ++RC++HLFA+EVAIHR L S
Sbjct  1    MKIYVYDLPASFNDDWVTASDRCATHLFAAEVAIHRTLLS  40



>ref|XP_009382125.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Musa 
acuminata subsp. malaccensis]
Length=441

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +3

Query  567  KVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            K+Y+YDLP++YN DWL N RC SHLFASEVAIH AL
Sbjct  86   KIYVYDLPSRYNKDWLSNSRCGSHLFASEVAIHEAL  121



>ref|XP_001754437.1| predicted protein [Physcomitrella patens]
 gb|EDQ80887.1| predicted protein, partial [Physcomitrella patens]
Length=353

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            +++Y+YDLPAK+N DWL +ERCS+HLFA+EVAIH+ L +
Sbjct  5    IRIYVYDLPAKFNEDWLADERCSNHLFAAEVAIHKVLMT  43



>ref|XP_001781950.1| predicted protein [Physcomitrella patens]
 gb|EDQ53246.1| predicted protein, partial [Physcomitrella patens]
Length=356

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            ++VY+YDLP K+N DWL +ERCS+HLFASEVAIH+ L S
Sbjct  5    IRVYVYDLPQKFNKDWLVDERCSNHLFASEVAIHKILLS  43



>ref|XP_002975186.1| glycosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ23971.1| glycosyltransferase-like protein [Selaginella moellendorffii]
Length=405

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  561  DLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            ++KVYIYDLP+ YN DWL + RCSSHLFA+EVAIH+ L
Sbjct  54   NIKVYIYDLPSSYNTDWLVDSRCSSHLFAAEVAIHQNL  91



>ref|XP_009413136.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Musa 
acuminata subsp. malaccensis]
Length=422

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 11/68 (16%)
 Frame = +3

Query  471  VRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWLNE-RCSSHLFAS  647
            ++ +  +RALIE+   S    P          KVY+Y+LP++YN DWL++ RC SHLFAS
Sbjct  53   LKPNLPARALIEAREPSSSPLP----------KVYVYELPSRYNKDWLSDPRCGSHLFAS  102

Query  648  EVAIHRAL  671
            EVAIH+AL
Sbjct  103  EVAIHQAL  110



>ref|XP_002994684.1| glycosyltransferase-like protein, partial [Selaginella moellendorffii]
 gb|EFJ04250.1| glycosyltransferase-like protein, partial [Selaginella moellendorffii]
Length=332

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  561  DLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            ++KVYIYDLP+ YN DWL + RCSSHLFA+EVAIH+ L
Sbjct  5    NIKVYIYDLPSSYNTDWLVDSRCSSHLFAAEVAIHQNL  42



>ref|XP_002977591.1| glycosyltransferase-like protein, partial [Selaginella moellendorffii]
 gb|EFJ21595.1| glycosyltransferase-like protein, partial [Selaginella moellendorffii]
Length=345

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 1/38 (3%)
 Frame = +3

Query  561  DLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            ++KVYIYDLP+ YN DWL + RCSSHLFA+EVAIH+ L
Sbjct  5    NIKVYIYDLPSSYNTDWLVDSRCSSHLFAAEVAIHQNL  42



>ref|XP_001777222.1| predicted protein [Physcomitrella patens]
 gb|EDQ58002.1| predicted protein [Physcomitrella patens]
Length=368

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = +3

Query  510  HNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRALAS  677
            H S     P    ++   +++Y+YDLP K+N DWL +ERCS+HLFASEVAIH+ L +
Sbjct  2    HLSGFDTTPFNPLNLTNAIRIYVYDLPPKFNEDWLVDERCSNHLFASEVAIHKILLT  58



>ref|XP_010918601.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Elaeis 
guineensis]
Length=462

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 13/81 (16%)
 Frame = +3

Query  432  KPATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDW  611
            +P  S++   T  ++ +   RALIE+ N S              LK+Y+YDLP+KYN DW
Sbjct  74   RPTPSSLPKTTLPLKTT--PRALIEARNIS----------TSPSLKIYVYDLPSKYNRDW  121

Query  612  L-NERCSSHLFASEVAIHRAL  671
            L + RC +HLF +EVA+H A 
Sbjct  122  LADRRCETHLFGAEVALHEAF  142



>ref|XP_008809907.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Phoenix 
dactylifera]
Length=461

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 47/78 (60%), Gaps = 12/78 (15%)
 Frame = +3

Query  441  TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-N  617
            T   + +TT+  ++   RALIE+ N+S               K+Y+YDLP++YN DWL +
Sbjct  75   TPTSLPKTTLPLKT-TPRALIEARNTS----------TSPPFKIYVYDLPSRYNRDWLAD  123

Query  618  ERCSSHLFASEVAIHRAL  671
             RC +HLFA+EVA+H A 
Sbjct  124  RRCETHLFAAEVALHEAF  141



>ref|XP_010908507.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Elaeis 
guineensis]
Length=460

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 48/78 (62%), Gaps = 12/78 (15%)
 Frame = +3

Query  441  TSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL-N  617
            T   + +TT+  ++   RALIE+ N+S               K+Y+YDLP+++N DWL +
Sbjct  74   TPTSLPQTTLPLKT-TPRALIEARNTS----------TSPPFKIYVYDLPSRFNRDWLAD  122

Query  618  ERCSSHLFASEVAIHRAL  671
            +RC +HLFA+EVA+H A 
Sbjct  123  QRCETHLFAAEVALHEAF  140



>ref|XP_009400247.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Musa 
acuminata subsp. malaccensis]
Length=459

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL-NERCSSHLFASEVAIHRAL  671
            L++Y+Y+LP+ YN DWL N RC +HLFASEVAIH AL
Sbjct  104  LRIYVYELPSSYNRDWLSNPRCRNHLFASEVAIHEAL  140



>ref|XP_004986049.1| PREDICTED: probable glucuronosyltransferase Os03g0107900-like 
[Setaria italica]
Length=462

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRAL  671
            +++Y+YDLPA++N DW+  + RC+ HLFA+EVA+H AL
Sbjct  110  VRIYVYDLPARFNRDWVAADARCARHLFAAEVAVHEAL  147



>tpg|DAA42850.1| TPA: hypothetical protein ZEAMMB73_024068 [Zea mays]
Length=434

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRAL  671
            +++Y+YDLPA++N DW   + RCS HLFA+EVA+H AL
Sbjct  78   VRIYVYDLPARFNRDWAAADARCSRHLFAAEVAVHEAL  115



>ref|XP_003562215.1| PREDICTED: probable glucuronosyltransferase Os03g0107900 [Brachypodium 
distachyon]
Length=441

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 13/81 (16%)
 Frame = +3

Query  435  PATSAIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKDLKVYIYDLPAKYNVDWL  614
            PA S ++ R       K  RAL E   S+    P         +++Y+YDLP ++N DWL
Sbjct  57   PAASPLLRRPPAFLHHK-PRALAEETTSA---PPPA-------VRIYVYDLPRRFNRDWL  105

Query  615  --NERCSSHLFASEVAIHRAL  671
              + RC+ HLFA+EVA+H AL
Sbjct  106  AADPRCARHLFAAEVALHEAL  126



>ref|NP_001169191.1| uncharacterized protein LOC100383044 [Zea mays]
 gb|ACN31903.1| unknown [Zea mays]
 gb|AFW89861.1| hypothetical protein ZEAMMB73_311893 [Zea mays]
Length=428

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDW--LNERCSSHLFASEVAIHRAL  671
            +++Y+YDLPA++N DW   + RC+ HLFA+EVA+H AL
Sbjct  74   VRIYVYDLPARFNRDWAVADARCARHLFAAEVAVHEAL  111



>ref|XP_002468679.1| hypothetical protein SORBIDRAFT_01g050110 [Sorghum bicolor]
 gb|EER95677.1| hypothetical protein SORBIDRAFT_01g050110 [Sorghum bicolor]
Length=429

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDW--LNERCSSHLFASEVAIHRAL  671
            +++Y+YDLPA++N DW   + RC+ HLFA+EVA+H AL
Sbjct  75   VRIYVYDLPARFNRDWAAADARCARHLFAAEVAVHEAL  112



>ref|XP_004961861.1| PREDICTED: probable glucuronosyltransferase Os01g0926700-like 
[Setaria italica]
Length=423

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 7/54 (13%)
 Frame = +3

Query  537  NTHQDVFKD-----LKVYIYDLPAKYNVDWLNE--RCSSHLFASEVAIHRALAS  677
             +  DV +D     LKVY+YDLPAKYN   + +  RC +H+FA+EV +HR+L S
Sbjct  40   GSAGDVLEDDPVGRLKVYVYDLPAKYNTKLVEDDPRCLTHMFATEVFVHRSLLS  93



>ref|NP_001048697.1| Os03g0107900 [Oryza sativa Japonica Group]
 sp|Q10SX7.1|GT31_ORYSJ RecName: Full=Probable glucuronosyltransferase Os03g0107900 [Oryza 
sativa Japonica Group]
 gb|ABF93559.1| exostosin family protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10611.1| Os03g0107900 [Oryza sativa Japonica Group]
 gb|EAY88216.1| hypothetical protein OsI_09667 [Oryza sativa Indica Group]
 dbj|BAG98793.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58174.1| hypothetical protein OsJ_09104 [Oryza sativa Japonica Group]
Length=427

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRAL  671
            L++Y+YDLPA++N  W+  + RC++HLFA+EVA+H AL
Sbjct  74   LRIYVYDLPARFNRHWVAADARCATHLFAAEVALHEAL  111



>gb|AAN62780.1| Unknown protein [Oryza sativa Japonica Group]
Length=449

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRAL  671
            L++Y+YDLPA++N  W+  + RC++HLFA+EVA+H AL
Sbjct  74   LRIYVYDLPARFNRHWVAADARCATHLFAAEVALHEAL  111



>ref|XP_002441217.1| hypothetical protein SORBIDRAFT_09g022500 [Sorghum bicolor]
 gb|EES19647.1| hypothetical protein SORBIDRAFT_09g022500 [Sorghum bicolor]
Length=422

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +3

Query  465  TVVRQSKASRALIESHNSSLLHQPNTHQDVFKD-----LKVYIYDLPAKYNVDWL--NER  623
             V+     ++ L++SH++  +    +  DV +D     LKV++YDLPAKYN   +  + R
Sbjct  18   VVLFHGSDAQELMQSHHTERIS--GSGGDVLEDDPVGKLKVFVYDLPAKYNTKPVEKDPR  75

Query  624  CSSHLFASEVAIHRALAS  677
            C +H+FA+E+ +HR+L S
Sbjct  76   CLTHMFATEIFVHRSLLS  93



>ref|XP_009126553.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX10 [Brassica 
rapa]
Length=149

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 38/63 (60%), Gaps = 7/63 (11%)
 Frame = +3

Query  510  HNSSLLHQPNTHQDVFKD-----LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRA  668
            HN+       +  DV +D     LKVY+YDLP+KYN   L  + RC +H+FA+E+ +HR 
Sbjct  22   HNARTERISGSAGDVLEDNPVGRLKVYVYDLPSKYNKKLLQKDPRCLTHMFAAEIFMHRF  81

Query  669  LAS  677
            L S
Sbjct  82   LLS  84



>ref|XP_009420168.1| PREDICTED: probable beta-1,4-xylosyltransferase IRX10 [Musa acuminata 
subsp. malaccensis]
Length=417

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 50/84 (60%), Gaps = 9/84 (11%)
 Frame = +3

Query  447  AIISRTTVVRQSKASRALIESHNSSLLHQPNTHQDVFKD-----LKVYIYDLPAKYNVDW  611
            +I+  T ++ Q    + L +SH    +   NT  DV +D     LKV++Y+LP+KYN D 
Sbjct  9    SIVICTYLLLQQTNGQTLEQSHQIGKIEG-NT-GDVLEDGPVGSLKVFVYELPSKYNEDL  66

Query  612  L--NERCSSHLFASEVAIHRALAS  677
            +  + RC +H+FA+E+ +HR L S
Sbjct  67   VEKDPRCLTHMFAAEIFMHRFLLS  90



>ref|XP_006662226.1| PREDICTED: probable glucuronosyltransferase GUT1-like [Oryza 
brachyantha]
Length=409

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 2/40 (5%)
 Frame = +3

Query  564  LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            LKVY+YDLP KYN + L  + RC SH+FA+E+ IHR L S
Sbjct  43   LKVYVYDLPPKYNKNILAKDSRCLSHMFATEIFIHRFLLS  82



>ref|NP_001241842.1| hypothetical protein precursor [Zea mays]
 gb|ACF86410.1| unknown [Zea mays]
 gb|ACN36179.1| unknown [Zea mays]
 tpg|DAA56027.1| TPA: hypothetical protein ZEAMMB73_615997 [Zea mays]
Length=418

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 7/50 (14%)
 Frame = +3

Query  549  DVFKD-----LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            DV +D     LKVY+YDLP+KYN   L  + RC SH+FA+E+ +HR L S
Sbjct  41   DVLEDNPVGRLKVYVYDLPSKYNKKLLKKDPRCLSHMFAAEIFMHRFLLS  90



>ref|NP_001130059.1| uncharacterized protein LOC100191151 precursor [Zea mays]
 gb|ACF78180.1| unknown [Zea mays]
Length=418

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%), Gaps = 7/50 (14%)
 Frame = +3

Query  549  DVFKD-----LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRALAS  677
            DV +D     LKVY+YDLP+KYN   L  + RC SH+FA+E+ +HR L S
Sbjct  41   DVLEDNPVGRLKVYVYDLPSKYNKKLLKKDPRCLSHMFAAEIFMHRFLLS  90



>ref|XP_002512676.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50128.1| conserved hypothetical protein [Ricinus communis]
Length=145

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 14/69 (20%)
 Frame = +3

Query  513  NSSLLHQ-PNTHQ------DVFKD-----LKVYIYDLPAKYNVDWL--NERCSSHLFASE  650
            N +  HQ P T +      DV +D     LKVY+Y+LP+KYN   L  + RC +H+FA+E
Sbjct  18   NRTFAHQKPRTERISGSAGDVLEDDPVGRLKVYVYELPSKYNKKLLQKDPRCLTHMFAAE  77

Query  651  VAIHRALAS  677
            + +HR L S
Sbjct  78   IFMHRFLLS  86



>ref|XP_001753186.1| predicted protein [Physcomitrella patens]
 sp|A9RGD8.1|GT47A_PHYPA RecName: Full=Probable glucuronosyltransferase 47 A; Short=PpGT47A 
[Physcomitrella patens]
 gb|EDQ82227.1| predicted protein [Physcomitrella patens]
Length=449

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 7/48 (15%)
 Frame = +3

Query  549  DVFKD-----LKVYIYDLPAKYNVDWL--NERCSSHLFASEVAIHRAL  671
            DV +D     LKV+IYD+P+KYN DWL  + RC +H+FA E  +H  L
Sbjct  69   DVLEDNPVGRLKVFIYDIPSKYNTDWLKKDPRCLTHMFAVEEYLHDFL  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420