BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032L04

Length=701
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011070419.1|  PREDICTED: NAC domain-containing protein 4-like    330   3e-106   Sesamum indicum [beniseed]
emb|CDP12257.1|  unnamed protein product                                327   7e-105   Coffea canephora [robusta coffee]
ref|XP_007039299.1|  NAC domain-containing protein 78, putative i...    324   5e-103   
ref|XP_007210371.1|  hypothetical protein PRUPE_ppa001291mg             325   3e-101   Prunus persica
gb|KHG02383.1|  NAC domain-containing 74                                323   1e-100   Gossypium arboreum [tree cotton]
ref|XP_011081340.1|  PREDICTED: uncharacterized protein LOC105164...    315   3e-100   
ref|XP_011081339.1|  PREDICTED: uncharacterized protein LOC105164...    315   3e-100   Sesamum indicum [beniseed]
gb|KJB52429.1|  hypothetical protein B456_008G261400                    319   6e-100   Gossypium raimondii
ref|XP_002317040.2|  hypothetical protein POPTR_0011s15230g             316   7e-100   
ref|XP_008245853.1|  PREDICTED: uncharacterized protein LOC103344010    320   1e-99    Prunus mume [ume]
ref|XP_002300524.2|  hypothetical protein POPTR_0001s45700g             315   1e-99    
gb|KJB52425.1|  hypothetical protein B456_008G261400                    315   1e-99    Gossypium raimondii
gb|AIA57515.1|  NAC domain-containing protein                           315   1e-99    Boehmeria nivea [Chinese silk-plant]
ref|XP_011004356.1|  PREDICTED: uncharacterized protein LOC105110...    315   2e-99    Populus euphratica
ref|XP_006377880.1|  hypothetical protein POPTR_0011s15230g             316   2e-99    
ref|XP_011004351.1|  PREDICTED: uncharacterized protein LOC105110...    315   2e-99    Populus euphratica
gb|KJB52426.1|  hypothetical protein B456_008G261400                    316   2e-99    Gossypium raimondii
gb|KCW72635.1|  hypothetical protein EUGRSUZ_E01095                     313   3e-99    Eucalyptus grandis [rose gum]
ref|XP_007039300.1|  NAC domain-containing protein 78, putative i...    314   3e-99    
ref|XP_006377879.1|  hypothetical protein POPTR_0011s15230g             315   3e-99    
gb|KJB52427.1|  hypothetical protein B456_008G261400                    318   3e-99    Gossypium raimondii
ref|XP_010533527.1|  PREDICTED: uncharacterized protein LOC104809290    314   3e-99    Tarenaya hassleriana [spider flower]
ref|XP_006377878.1|  hypothetical protein POPTR_0011s15230g             314   3e-99    
gb|KJB52428.1|  hypothetical protein B456_008G261400                    319   3e-99    Gossypium raimondii
ref|XP_011004350.1|  PREDICTED: uncharacterized protein LOC105110...    315   5e-99    Populus euphratica
ref|XP_011004354.1|  PREDICTED: uncharacterized protein LOC105110...    314   6e-99    Populus euphratica
ref|XP_011004355.1|  PREDICTED: uncharacterized protein LOC105110...    314   6e-99    Populus euphratica
ref|XP_011004357.1|  PREDICTED: uncharacterized protein LOC105110...    313   6e-99    Populus euphratica
gb|AGL39711.1|  NAC transcription factor 055                            312   6e-99    Jatropha curcas
ref|XP_011004352.1|  PREDICTED: uncharacterized protein LOC105110...    314   6e-99    Populus euphratica
ref|XP_010056056.1|  PREDICTED: uncharacterized protein LOC104444143    313   9e-99    Eucalyptus grandis [rose gum]
ref|XP_011038026.1|  PREDICTED: uncharacterized protein LOC105135051    310   1e-97    Populus euphratica
ref|XP_002867065.1|  predicted protein                                  305   3e-97    
ref|NP_001119122.1|  NAC transcription factor-like 9                    305   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190927.1|  NAC transcription factor-like 9                    305   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567986.3|  NAC transcription factor-like 9                       304   5e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008360722.1|  PREDICTED: uncharacterized protein LOC103424418    311   2e-96    Malus domestica [apple tree]
ref|NP_001280864.1|  uncharacterized LOC103438687                       311   3e-96    Malus domestica [apple tree]
ref|XP_010446907.1|  PREDICTED: NAC domain-containing protein 86-...    301   9e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010437454.1|  PREDICTED: uncharacterized protein LOC104721220    301   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010432259.1|  PREDICTED: NAC domain-containing protein 1-l...    301   3e-95    
gb|KFK45050.1|  hypothetical protein AALP_AA1G337500                    303   3e-95    Arabis alpina [alpine rockcress]
ref|XP_006286077.1|  hypothetical protein CARUB_v10007613mg             300   4e-95    Capsella rubella
ref|XP_010432258.1|  PREDICTED: NAC domain-containing protein 1-l...    300   4e-95    Camelina sativa [gold-of-pleasure]
gb|KFK45049.1|  hypothetical protein AALP_AA1G337500                    303   4e-95    Arabis alpina [alpine rockcress]
ref|XP_009360232.1|  PREDICTED: uncharacterized protein LOC103950728    308   5e-95    Pyrus x bretschneideri [bai li]
gb|KJB18878.1|  hypothetical protein B456_003G073300                    300   5e-95    Gossypium raimondii
ref|XP_010104895.1|  NAC domain-containing protein 78                   305   6e-95    
gb|KJB18876.1|  hypothetical protein B456_003G073300                    301   2e-94    Gossypium raimondii
ref|XP_010499853.1|  PREDICTED: NAC domain-containing protein 86-...    301   3e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010499852.1|  PREDICTED: NAC domain-containing protein 86-...    301   3e-94    
ref|XP_010499854.1|  PREDICTED: NAC domain-containing protein 86-...    301   4e-94    
gb|KHF99264.1|  NAC domain-containing 78 -like protein                  300   4e-94    Gossypium arboreum [tree cotton]
ref|XP_006415127.1|  hypothetical protein EUTSA_v10007021mg             299   2e-93    Eutrema salsugineum [saltwater cress]
ref|XP_004309509.1|  PREDICTED: uncharacterized protein LOC101295292    300   2e-93    Fragaria vesca subsp. vesca
ref|XP_010529684.1|  PREDICTED: NAC domain-containing protein 86        297   6e-93    Tarenaya hassleriana [spider flower]
gb|EYU35608.1|  hypothetical protein MIMGU_mgv1a022295mg                291   1e-92    Erythranthe guttata [common monkey flower]
ref|XP_006306957.1|  hypothetical protein CARUB_v10008529mg             296   3e-92    Capsella rubella
ref|XP_006306958.1|  hypothetical protein CARUB_v10008529mg             296   3e-92    Capsella rubella
ref|XP_006306959.1|  hypothetical protein CARUB_v10008529mg             296   3e-92    Capsella rubella
ref|XP_002893753.1|  ANAC014                                            295   4e-92    
gb|AIU39715.1|  NAC transcription factor 14                             294   8e-92    Brassica napus [oilseed rape]
ref|XP_010478725.1|  PREDICTED: uncharacterized protein LOC104757...    295   8e-92    
emb|CDY66161.1|  BnaCnng49700D                                          294   9e-92    Brassica napus [oilseed rape]
ref|XP_010478726.1|  PREDICTED: uncharacterized protein LOC104757...    295   1e-91    
ref|XP_009151462.1|  PREDICTED: uncharacterized protein LOC103874777    293   2e-91    Brassica rapa
gb|KDO76787.1|  hypothetical protein CISIN_1g009388mg                   290   2e-91    Citrus sinensis [apfelsine]
ref|XP_006476249.1|  PREDICTED: uncharacterized protein LOC102621962    292   4e-91    Citrus sinensis [apfelsine]
gb|AAF31292.1|AC006424_21  CDS                                          290   8e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461128.1|  PREDICTED: NAC domain-containing protein 86        292   1e-90    
ref|XP_006439176.1|  hypothetical protein CICLE_v10019282mg             291   2e-90    Citrus clementina [clementine]
ref|NP_174582.3|  protein NAC 014                                       290   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_973954.1|  protein NAC 014                                       290   4e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010241066.1|  PREDICTED: uncharacterized protein LOC104585...    289   4e-90    
ref|XP_010241065.1|  PREDICTED: uncharacterized protein LOC104585...    289   4e-90    Nelumbo nucifera [Indian lotus]
ref|XP_010660382.1|  PREDICTED: uncharacterized protein LOC104877280    287   5e-89    Vitis vinifera
ref|XP_010542182.1|  PREDICTED: uncharacterized protein LOC104815470    286   1e-88    Tarenaya hassleriana [spider flower]
ref|XP_009351898.1|  PREDICTED: uncharacterized protein LOC103943342    281   1e-87    Pyrus x bretschneideri [bai li]
ref|XP_008381552.1|  PREDICTED: uncharacterized protein LOC103444404    280   3e-87    Malus domestica [apple tree]
ref|XP_002317831.2|  hypothetical protein POPTR_0012s00760g             281   6e-87    
ref|XP_006404132.1|  hypothetical protein EUTSA_v10010340mg             277   7e-87    Eutrema salsugineum [saltwater cress]
ref|XP_004156529.1|  PREDICTED: NAC domain-containing protein 74-...    280   1e-86    
ref|XP_004137298.1|  PREDICTED: NAC domain-containing protein 74-...    280   1e-86    
ref|XP_008462914.1|  PREDICTED: NAC domain-containing protein 74        277   1e-85    Cucumis melo [Oriental melon]
ref|XP_011043746.1|  PREDICTED: uncharacterized protein LOC105139114    278   1e-85    Populus euphratica
ref|XP_002518952.1|  transcription factor, putative                     276   4e-85    
ref|XP_010525539.1|  PREDICTED: NAC domain-containing protein 67-...    272   4e-85    Tarenaya hassleriana [spider flower]
ref|XP_002321956.2|  hypothetical protein POPTR_0015s00640g             276   4e-85    
ref|XP_010519577.1|  PREDICTED: NAC domain-containing protein 67-...    271   1e-84    Tarenaya hassleriana [spider flower]
gb|AIA57510.1|  NAC domain-containing protein                           272   1e-84    Boehmeria nivea [Chinese silk-plant]
ref|XP_011470170.1|  PREDICTED: NAC domain-containing protein 86        274   2e-84    Fragaria vesca subsp. vesca
ref|XP_008234624.1|  PREDICTED: NAC domain-containing protein 7-like    272   5e-84    Prunus mume [ume]
ref|XP_006441278.1|  hypothetical protein CICLE_v10019368mg             270   1e-83    
gb|ACU23644.1|  unknown                                                 272   1e-83    Glycine max [soybeans]
ref|XP_006441281.1|  hypothetical protein CICLE_v10019368mg             270   1e-83    
ref|NP_001276211.1|  uncharacterized LOC100777071                       272   2e-83    
ref|NP_001280863.1|  uncharacterized LOC103439966                       270   3e-83    Malus domestica [apple tree]
gb|KDO44488.1|  hypothetical protein CISIN_1g007393mg                   271   3e-83    Citrus sinensis [apfelsine]
ref|XP_006441280.1|  hypothetical protein CICLE_v10019368mg             271   3e-83    Citrus clementina [clementine]
gb|KDO44489.1|  hypothetical protein CISIN_1g007393mg                   271   3e-83    Citrus sinensis [apfelsine]
ref|XP_006441279.1|  hypothetical protein CICLE_v10019368mg             271   3e-83    Citrus clementina [clementine]
ref|XP_006478082.1|  PREDICTED: NAC domain-containing protein 69-...    271   4e-83    Citrus sinensis [apfelsine]
ref|XP_006478081.1|  PREDICTED: NAC domain-containing protein 69-...    271   4e-83    Citrus sinensis [apfelsine]
ref|XP_006478080.1|  PREDICTED: NAC domain-containing protein 69-...    271   5e-83    Citrus sinensis [apfelsine]
ref|XP_004502779.1|  PREDICTED: uncharacterized protein LOC101492664    270   6e-83    Cicer arietinum [garbanzo]
ref|XP_007136363.1|  hypothetical protein PHAVU_009G039000g             270   9e-83    Phaseolus vulgaris [French bean]
ref|XP_009361256.1|  PREDICTED: NAC domain-containing protein 74-...    268   2e-82    Pyrus x bretschneideri [bai li]
ref|XP_006291082.1|  hypothetical protein CARUB_v10017199mg             265   3e-82    Capsella rubella
gb|AIS36140.1|  NAC transcription factor 91-2                           265   3e-82    Brassica napus [oilseed rape]
ref|XP_007039234.1|  NAC domain class transcription factor, putat...    265   3e-82    
emb|CDX80455.1|  BnaC07g29890D                                          264   4e-82    
ref|XP_007039233.1|  NAC domain class transcription factor, putat...    267   5e-82    
ref|XP_010503613.1|  PREDICTED: NAC domain-containing protein 19-...    263   9e-82    Camelina sativa [gold-of-pleasure]
emb|CDY05939.1|  BnaC08g21160D                                          263   1e-81    
ref|XP_003615518.1|  NAC domain protein                                 261   1e-81    
ref|XP_010426468.1|  PREDICTED: NAC domain-containing protein 74        263   1e-81    Camelina sativa [gold-of-pleasure]
gb|AES72662.2|  M20/M25/M40 family peptidase                            258   1e-81    Medicago truncatula
gb|AGL39710.1|  NAC transcription factor 054                            266   1e-81    Jatropha curcas
emb|CDX88115.1|  BnaA06g27060D                                          262   2e-81    
ref|XP_009150982.1|  PREDICTED: protein ATAF2-like isoform X1           263   2e-81    Brassica rapa
ref|XP_009150983.1|  PREDICTED: protein ATAF2-like isoform X2           262   2e-81    Brassica rapa
ref|XP_011003273.1|  PREDICTED: NAC domain-containing protein 45-...    265   4e-81    Populus euphratica
gb|KJB37428.1|  hypothetical protein B456_006G203800                    259   4e-81    Gossypium raimondii
ref|XP_010045303.1|  PREDICTED: uncharacterized protein LOC104434047    265   5e-81    Eucalyptus grandis [rose gum]
ref|XP_011003272.1|  PREDICTED: NAC domain-containing protein 45-...    265   8e-81    Populus euphratica
ref|XP_011075874.1|  PREDICTED: NAC domain-containing protein 45        265   9e-81    Sesamum indicum [beniseed]
ref|XP_010515305.1|  PREDICTED: NAC domain-containing protein 19-...    261   9e-81    Camelina sativa [gold-of-pleasure]
ref|XP_003615517.1|  NAC domain protein                                 265   1e-80    Medicago truncatula
gb|AFK41148.1|  unknown                                                 265   2e-80    Medicago truncatula
gb|KFK27735.1|  hypothetical protein AALP_AA8G422400                    260   2e-80    Arabis alpina [alpine rockcress]
ref|XP_006394714.1|  hypothetical protein EUTSA_v10004105mg             260   2e-80    
emb|CDY08139.1|  BnaA06g15870D                                          259   3e-80    Brassica napus [oilseed rape]
gb|KHN19577.1|  NAC domain-containing protein 78                        263   3e-80    Glycine soja [wild soybean]
gb|KJB37424.1|  hypothetical protein B456_006G203800                    259   3e-80    Gossypium raimondii
gb|KHG14091.1|  NAC domain-containing 78 -like protein                  262   3e-80    Gossypium arboreum [tree cotton]
ref|XP_003526771.1|  PREDICTED: uncharacterized protein LOC100808469    263   3e-80    Glycine max [soybeans]
gb|KJB37426.1|  hypothetical protein B456_006G203800                    260   4e-80    Gossypium raimondii
ref|XP_006394715.1|  hypothetical protein EUTSA_v10004105mg             259   4e-80    Eutrema salsugineum [saltwater cress]
ref|XP_003602412.1|  NAC domain-containing protein                      262   6e-80    Medicago truncatula
ref|XP_003602411.1|  IAA-amino acid hydrolase ILR1-like protein         258   6e-80    
gb|KJB37423.1|  hypothetical protein B456_006G203800                    260   6e-80    Gossypium raimondii
gb|AHJ79172.1|  NAC domain protein NAC31                                261   7e-80    Gossypium hirsutum [American cotton]
ref|XP_004514021.1|  PREDICTED: uncharacterized protein LOC101501154    262   8e-80    Cicer arietinum [garbanzo]
gb|KFK34231.1|  hypothetical protein AALP_AA5G118000                    258   9e-80    Arabis alpina [alpine rockcress]
ref|XP_003602413.1|  NAC domain-containing protein                      262   1e-79    
ref|XP_009149732.1|  PREDICTED: NAC transcription factor 29             258   2e-79    Brassica rapa
ref|XP_010662939.1|  PREDICTED: NAC domain-containing protein 77        260   2e-79    Vitis vinifera
gb|KHN46203.1|  NAC domain-containing protein 78                        260   3e-79    Glycine soja [wild soybean]
ref|NP_001276287.1|  NAC domain protein                                 260   3e-79    Glycine max [soybeans]
ref|XP_002521312.1|  transcription factor, putative                     260   3e-79    
gb|KHN40025.1|  NAC domain-containing protein 78                        260   4e-79    Glycine soja [wild soybean]
ref|XP_007141360.1|  hypothetical protein PHAVU_008G189100g             259   4e-79    Phaseolus vulgaris [French bean]
ref|XP_006287681.1|  hypothetical protein CARUB_v10000892mg             255   5e-79    
ref|XP_002877683.1|  ANAC062                                            256   7e-79    Arabidopsis lyrata subsp. lyrata
ref|XP_006287682.1|  hypothetical protein CARUB_v10000892mg             256   7e-79    Capsella rubella
ref|XP_002874210.1|  tip                                                256   8e-79    Arabidopsis lyrata subsp. lyrata
ref|XP_009111638.1|  PREDICTED: NAC domain-containing protein 74 ...    255   8e-79    Brassica rapa
ref|XP_009111639.1|  PREDICTED: NAC domain-containing protein 2 i...    255   9e-79    Brassica rapa
ref|XP_010493709.1|  PREDICTED: NAC domain-containing protein 74        255   1e-78    Camelina sativa [gold-of-pleasure]
ref|NP_190522.1|  transcription factor NTL6                             255   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006596412.1|  PREDICTED: NAC domain-containing protein 12-...    258   2e-78    Glycine max [soybeans]
emb|CAN73792.1|  hypothetical protein VITISV_034893                     261   2e-78    Vitis vinifera
ref|XP_010421284.1|  PREDICTED: NAC domain-containing protein 74-...    255   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010456676.1|  PREDICTED: NAC domain-containing protein 2-like    256   4e-78    Camelina sativa [gold-of-pleasure]
ref|NP_197847.3|  TCV-interacting protein                               253   4e-78    Arabidopsis thaliana [mouse-ear cress]
gb|KJB24042.1|  hypothetical protein B456_004G125900                    253   6e-78    Gossypium raimondii
gb|KJB24041.1|  hypothetical protein B456_004G125900                    254   7e-78    Gossypium raimondii
gb|AIS36139.1|  NAC transcription factor 91-1                           253   1e-77    Brassica napus [oilseed rape]
ref|XP_010103069.1|  NAC domain-containing protein 78                   256   1e-77    Morus notabilis
emb|CDX86970.1|  BnaC03g52400D                                          247   3e-77    
gb|KHG07501.1|  NAC domain-containing 78 -like protein                  253   1e-76    Gossypium arboreum [tree cotton]
gb|KJB39512.1|  hypothetical protein B456_007G017500                    247   2e-76    Gossypium raimondii
emb|CDX87118.1|  BnaC09g04330D                                          256   6e-76    
emb|CAN73478.1|  hypothetical protein VITISV_037597                     239   1e-75    Vitis vinifera
gb|KJB39511.1|  hypothetical protein B456_007G017500                    249   1e-75    Gossypium raimondii
gb|KHG05224.1|  NAC domain-containing 78 -like protein                  249   2e-75    Gossypium arboreum [tree cotton]
gb|AHJ79190.1|  NAC domain protein NAC49                                251   2e-75    Gossypium hirsutum [American cotton]
ref|XP_004241429.1|  PREDICTED: uncharacterized protein LOC101257973    250   3e-75    
gb|AGV29497.1|  putative NAC domain class transcription factor          239   3e-75    Tamarix hispida
ref|XP_004972796.1|  PREDICTED: uncharacterized protein LOC101763561    250   1e-74    Setaria italica
gb|AGT96630.1|  NAC transcription factor                                240   4e-74    Suaeda liaotungensis
ref|XP_010671303.1|  PREDICTED: NAC domain-containing protein 86-...    247   7e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006347316.1|  PREDICTED: uncharacterized protein LOC102605066    247   1e-73    Solanum tuberosum [potatoes]
ref|XP_008788721.1|  PREDICTED: uncharacterized protein LOC103706...    248   1e-73    Phoenix dactylifera
ref|XP_008788722.1|  PREDICTED: uncharacterized protein LOC103706...    248   1e-73    Phoenix dactylifera
ref|XP_010671302.1|  PREDICTED: uncharacterized protein LOC104888...    246   1e-73    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008811393.1|  PREDICTED: NAC domain-containing protein 74-...    237   2e-73    
ref|XP_009150140.1|  PREDICTED: NAC transcription factor 29-like        241   2e-73    Brassica rapa
ref|XP_009760821.1|  PREDICTED: NAC domain-containing protein 74-...    240   3e-73    Nicotiana sylvestris
ref|XP_009385839.1|  PREDICTED: uncharacterized protein LOC103973...    247   5e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67213.1|  hypothetical protein M569_07559                         248   5e-73    Genlisea aurea
ref|XP_009385838.1|  PREDICTED: uncharacterized protein LOC103973...    246   6e-73    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45332.1|  hypothetical protein MIMGU_mgv1a003123mg                243   3e-72    Erythranthe guttata [common monkey flower]
ref|XP_008783552.1|  PREDICTED: uncharacterized protein LOC103702771    244   3e-72    Phoenix dactylifera
ref|NP_001274765.1|  uncharacterized LOC102593794                       243   3e-72    Solanum tuberosum [potatoes]
ref|XP_009760820.1|  PREDICTED: uncharacterized protein LOC104213...    243   4e-72    Nicotiana sylvestris
gb|AGY49286.1|  putative membrane bound NAC transcription factor 1      242   5e-72    Nicotiana benthamiana
ref|XP_010318064.1|  PREDICTED: uncharacterized protein LOC101253566    242   7e-72    
ref|XP_009759914.1|  PREDICTED: uncharacterized protein LOC104212382    241   2e-71    Nicotiana sylvestris
ref|XP_009608176.1|  PREDICTED: uncharacterized protein LOC104102223    241   2e-71    Nicotiana tomentosiformis
gb|AAM47025.1|  nam-like protein 1                                      240   2e-71    Petunia x hybrida [garden petunia]
gb|AGV29473.1|  putative NAC domain class transcription factor          239   2e-71    Tamarix hispida
emb|CDP04976.1|  unnamed protein product                                241   2e-71    Coffea canephora [robusta coffee]
ref|XP_002445085.1|  hypothetical protein SORBIDRAFT_07g003900          241   3e-71    Sorghum bicolor [broomcorn]
ref|XP_008808290.1|  PREDICTED: uncharacterized protein LOC103720389    238   1e-70    Phoenix dactylifera
ref|XP_006659850.1|  PREDICTED: uncharacterized protein LOC102700454    239   2e-70    Oryza brachyantha
ref|XP_009596681.1|  PREDICTED: NAC domain-containing protein 74-...    238   3e-70    Nicotiana tomentosiformis
gb|EEC82928.1|  hypothetical protein OsI_27885                          239   3e-70    Oryza sativa Indica Group [Indian rice]
ref|NP_001061034.1|  Os08g0157900                                       239   3e-70    
gb|EMS48745.1|  NAC domain-containing protein 78                        238   6e-70    Triticum urartu
ref|XP_010234378.1|  PREDICTED: uncharacterized protein LOC100838012    239   7e-70    Brachypodium distachyon [annual false brome]
gb|EMT07892.1|  NAC domain-containing protein 78                        238   7e-70    
dbj|BAJ97142.1|  predicted protein                                      238   7e-70    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010934041.1|  PREDICTED: uncharacterized protein LOC105054...    237   1e-69    Elaeis guineensis
ref|XP_010934040.1|  PREDICTED: uncharacterized protein LOC105054...    237   1e-69    Elaeis guineensis
ref|XP_010941181.1|  PREDICTED: uncharacterized protein LOC105059...    238   1e-69    Elaeis guineensis
ref|XP_009397631.1|  PREDICTED: uncharacterized protein LOC103982434    236   2e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010941180.1|  PREDICTED: uncharacterized protein LOC105059...    238   2e-69    
ref|XP_009391051.1|  PREDICTED: uncharacterized protein LOC103977...    236   4e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391053.1|  PREDICTED: uncharacterized protein LOC103977...    236   4e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846446.1|  hypothetical protein AMTR_s00018p00071850          233   8e-69    Amborella trichopoda
ref|XP_010919012.1|  PREDICTED: uncharacterized protein LOC105043...    233   8e-69    Elaeis guineensis
ref|XP_010919011.1|  PREDICTED: uncharacterized protein LOC105043...    232   3e-68    Elaeis guineensis
ref|XP_002268892.1|  PREDICTED: NAC transcription factor NAM-B1-l...    230   5e-68    Vitis vinifera
ref|XP_010661534.1|  PREDICTED: uncharacterized protein LOC100252...    231   5e-68    Vitis vinifera
ref|XP_010661535.1|  PREDICTED: uncharacterized protein LOC100252...    230   9e-68    Vitis vinifera
emb|CBI38740.3|  unnamed protein product                                222   4e-67    Vitis vinifera
ref|XP_008662159.1|  PREDICTED: putative NAC domain transcription...    228   3e-66    Zea mays [maize]
ref|XP_008662161.1|  PREDICTED: putative NAC domain transcription...    228   3e-66    Zea mays [maize]
ref|XP_008662160.1|  PREDICTED: putative NAC domain transcription...    228   3e-66    Zea mays [maize]
ref|NP_001169185.1|  putative NAC domain transcription factor sup...    228   3e-66    Zea mays [maize]
ref|XP_010934906.1|  PREDICTED: uncharacterized protein LOC105054...    227   6e-66    Elaeis guineensis
ref|XP_010934904.1|  PREDICTED: uncharacterized protein LOC105054...    227   1e-65    Elaeis guineensis
ref|XP_010934905.1|  PREDICTED: uncharacterized protein LOC105054...    227   1e-65    Elaeis guineensis
gb|KDO44487.1|  hypothetical protein CISIN_1g007393mg                   221   3e-64    Citrus sinensis [apfelsine]
ref|XP_009389904.1|  PREDICTED: uncharacterized protein LOC103976...    222   4e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389911.1|  PREDICTED: uncharacterized protein LOC103976...    221   4e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389125.1|  PREDICTED: NAC domain-containing protein 19-...    215   6e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001056531.1|  Os06g0101800                                       214   7e-64    
ref|XP_009382806.1|  PREDICTED: uncharacterized protein LOC103970...    221   9e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382805.1|  PREDICTED: uncharacterized protein LOC103970...    221   1e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382803.1|  PREDICTED: uncharacterized protein LOC103970...    221   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382804.1|  PREDICTED: uncharacterized protein LOC103970...    221   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846443.1|  hypothetical protein AMTR_s00018p00070180          206   7e-63    
gb|EEE64934.1|  hypothetical protein OsJ_19800                          215   3e-61    Oryza sativa Japonica Group [Japonica rice]
gb|EAY99297.1|  hypothetical protein OsI_21263                          214   3e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_002436309.1|  hypothetical protein SORBIDRAFT_10g000101          206   6e-61    
ref|XP_008658885.1|  PREDICTED: putative NAC domain transcription...    209   8e-60    Zea mays [maize]
ref|NP_001169690.1|  putative NAC domain transcription factor sup...    209   8e-60    Zea mays [maize]
ref|XP_004964251.1|  PREDICTED: uncharacterized protein LOC101755...    209   1e-59    Setaria italica
ref|XP_004964250.1|  PREDICTED: uncharacterized protein LOC101755...    209   1e-59    Setaria italica
emb|CBI38735.3|  unnamed protein product                                198   1e-59    Vitis vinifera
ref|XP_008813657.1|  PREDICTED: NAC domain-containing protein 74-...    202   1e-58    
emb|CBI38736.3|  unnamed protein product                                196   2e-58    Vitis vinifera
ref|XP_010661529.1|  PREDICTED: transcription factor JUNGBRUNNEN ...    202   2e-58    Vitis vinifera
ref|XP_010661532.1|  PREDICTED: transcription factor JUNGBRUNNEN ...    202   2e-58    
ref|XP_008465949.1|  PREDICTED: NAC domain-containing protein 67-...    199   2e-58    Cucumis melo [Oriental melon]
ref|XP_009588904.1|  PREDICTED: protein BEARSKIN1-like                  204   2e-58    Nicotiana tomentosiformis
ref|XP_004148491.1|  PREDICTED: NAC domain-containing protein 89-...    199   4e-58    Cucumis sativus [cucumbers]
ref|XP_010661530.1|  PREDICTED: transcription factor JUNGBRUNNEN ...    202   4e-58    Vitis vinifera
ref|XP_009383033.1|  PREDICTED: NAC domain-containing protein 67-...    199   9e-58    
ref|XP_009765145.1|  PREDICTED: NAC domain-containing protein 78-...    202   1e-57    Nicotiana sylvestris
ref|XP_010528600.1|  PREDICTED: NAC domain-containing protein 86 ...    204   1e-57    Tarenaya hassleriana [spider flower]
ref|XP_010528598.1|  PREDICTED: NAC domain-containing protein 86 ...    204   1e-57    Tarenaya hassleriana [spider flower]
gb|KGN60409.1|  hypothetical protein Csa_3G903490                       199   1e-57    Cucumis sativus [cucumbers]
ref|XP_010661533.1|  PREDICTED: NAC domain-containing protein 55-...    200   2e-57    
ref|XP_009774486.1|  PREDICTED: NAC domain-containing protein 67-...    198   3e-57    Nicotiana sylvestris
gb|EMS58787.1|  NAC domain-containing protein 78                        196   4e-57    Triticum urartu
ref|XP_010228157.1|  PREDICTED: NAC domain-containing protein 69-...    202   6e-57    Brachypodium distachyon [annual false brome]
ref|XP_008227899.1|  PREDICTED: uncharacterized protein LOC103327366    202   6e-57    
ref|XP_010694972.1|  PREDICTED: NAC domain-containing protein 86-...    192   6e-57    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002888465.1|  predicted protein                                  202   9e-57    Arabidopsis lyrata subsp. lyrata
gb|EMT33279.1|  NAC domain-containing protein 74                        191   9e-57    
ref|XP_006350487.1|  PREDICTED: NAC domain-containing protein 78-...    197   9e-57    
ref|XP_007215001.1|  hypothetical protein PRUPE_ppa002384mg             202   9e-57    
ref|XP_010908788.1|  PREDICTED: NAC domain-containing protein 86-...    198   1e-56    
gb|KDO61523.1|  hypothetical protein CISIN_1g036998mg                   192   1e-56    Citrus sinensis [apfelsine]
ref|XP_009400096.1|  PREDICTED: NAC domain-containing protein 72-...    194   1e-56    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010470463.1|  PREDICTED: NAC domain-containing protein 86-...    201   1e-56    Camelina sativa [gold-of-pleasure]
ref|XP_008343143.1|  PREDICTED: uncharacterized protein LOC103405...    202   1e-56    
ref|XP_010415136.1|  PREDICTED: NAC domain-containing protein 86-...    201   1e-56    
ref|XP_009367106.1|  PREDICTED: uncharacterized protein LOC103956792    202   2e-56    
ref|XP_008381391.1|  PREDICTED: uncharacterized protein LOC103444...    202   2e-56    
ref|XP_006282929.1|  hypothetical protein CARUB_v10007390mg             192   2e-56    
ref|NP_176766.1|  NAC domain containing protein 28                      201   2e-56    
ref|XP_010470462.1|  PREDICTED: NAC domain-containing protein 86-...    201   2e-56    
ref|XP_010415135.1|  PREDICTED: NAC domain-containing protein 86-...    201   2e-56    
gb|AGL39704.1|  NAC transcription factor 048                            191   2e-56    
ref|XP_010105605.1|  NAC domain-containing protein 78                   197   2e-56    
ref|XP_009131585.1|  PREDICTED: protein SOMBRERO-like                   198   2e-56    
ref|XP_009598688.1|  PREDICTED: protein BEARSKIN1-like isoform X2       195   3e-56    
ref|XP_010940742.1|  PREDICTED: NAC domain-containing protein 86-...    198   3e-56    
ref|XP_008778272.1|  PREDICTED: uncharacterized protein LOC103698082    201   3e-56    
gb|KDO57313.1|  hypothetical protein CISIN_1g0079381mg                  195   3e-56    
ref|XP_007010878.1|  NAC domain containing protein 57                   191   3e-56    
ref|XP_009413063.1|  PREDICTED: uncharacterized protein LOC103994...    195   4e-56    
ref|XP_006391326.1|  hypothetical protein EUTSA_v10018275mg             200   4e-56    
ref|XP_009370574.1|  PREDICTED: uncharacterized protein LOC103959...    201   4e-56    
ref|XP_004289565.1|  PREDICTED: NAC domain-containing protein 86 ...    201   4e-56    
gb|EYU38937.1|  hypothetical protein MIMGU_mgv1a0250772mg               194   5e-56    
ref|XP_011072043.1|  PREDICTED: NAC domain-containing protein 86        190   5e-56    
ref|XP_010661526.1|  PREDICTED: NAC domain-containing protein 68-...    198   5e-56    
emb|CBI24139.3|  unnamed protein product                                191   5e-56    
ref|XP_006374257.1|  no apical meristem family protein                  190   5e-56    
ref|XP_009127458.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    200   6e-56    
ref|XP_003600640.1|  NAC domain protein                                 200   7e-56    
ref|XP_011047785.1|  PREDICTED: NAC domain-containing protein 86 ...    190   7e-56    
ref|XP_010661524.1|  PREDICTED: uncharacterized protein LOC100262...    198   7e-56    
ref|XP_008383208.1|  PREDICTED: NAC transcription factor 29-like        193   7e-56    
ref|XP_010238477.1|  PREDICTED: NAC domain-containing protein 86-...    189   8e-56    
gb|KCW69453.1|  hypothetical protein EUGRSUZ_F02910                     199   8e-56    
ref|XP_006301376.1|  hypothetical protein CARUB_v10021788mg             199   8e-56    
ref|XP_002865174.1|  ANAC096                                            191   8e-56    
ref|XP_010492671.1|  PREDICTED: NAC domain-containing protein 86-...    196   9e-56    
dbj|BAJ90716.1|  predicted protein                                      190   9e-56    
ref|XP_010062323.1|  PREDICTED: NAC domain-containing protein 78        199   9e-56    
ref|XP_006406699.1|  hypothetical protein EUTSA_v10021408mg             189   9e-56    
ref|XP_004140020.1|  PREDICTED: NAC domain-containing protein 43-...    193   9e-56    
ref|XP_010511514.1|  PREDICTED: NAC domain-containing protein 86 ...    198   9e-56    
ref|XP_010315723.1|  PREDICTED: NAC domain-containing protein 86-...    197   1e-55    
ref|XP_006298357.1|  hypothetical protein CARUB_v10014426mg             190   1e-55    
ref|XP_009401257.1|  PREDICTED: NAC domain-containing protein 72-...    193   1e-55    
ref|NP_188400.1|  NAC domain containing protein 57                      189   1e-55    
gb|EPS65413.1|  hypothetical protein M569_09365                         192   1e-55    
emb|CDY44498.1|  BnaC01g10510D                                          191   1e-55    
ref|XP_010645088.1|  PREDICTED: NAC domain-containing protein 45        192   1e-55    
ref|XP_002883083.1|  predicted protein                                  189   1e-55    
ref|XP_009385171.1|  PREDICTED: uncharacterized protein LOC103972538    198   1e-55    
ref|XP_010690417.1|  PREDICTED: NAC domain-containing protein 86-...    192   1e-55    
ref|XP_010275272.1|  PREDICTED: NAC domain-containing protein 45-...    193   1e-55    
ref|XP_008463166.1|  PREDICTED: uncharacterized protein LOC103501372    199   1e-55    
emb|CDX70745.1|  BnaC03g08290D                                          196   2e-55    
ref|XP_004957583.1|  PREDICTED: NAC domain-containing protein 74-...    188   2e-55    
ref|XP_010559290.1|  PREDICTED: NAC domain-containing protein 86-...    191   2e-55    
gb|ABR16648.1|  unknown                                                 199   2e-55    
ref|XP_002280894.2|  PREDICTED: NAC domain-containing protein 86        192   2e-55    
ref|XP_004293835.1|  PREDICTED: NAC domain-containing protein 86        192   2e-55    
emb|CAN78113.1|  hypothetical protein VITISV_004432                     192   2e-55    
ref|XP_010511513.1|  PREDICTED: NAC domain-containing protein 86 ...    198   2e-55    
ref|XP_010661527.1|  PREDICTED: uncharacterized protein LOC100262...    197   2e-55    
ref|XP_006422300.1|  hypothetical protein CICLE_v10005341mg             192   2e-55    
ref|XP_009136888.1|  PREDICTED: NAC domain-containing protein 78        190   2e-55    
emb|CDY16943.1|  BnaC09g40700D                                          196   2e-55    
ref|XP_010465831.1|  PREDICTED: NAC domain-containing protein 86-...    189   2e-55    
ref|XP_010908787.1|  PREDICTED: NAC domain-containing protein 86-...    198   2e-55    
ref|XP_010487668.1|  PREDICTED: NAC domain-containing protein 86-...    189   2e-55    
gb|EYU22270.1|  hypothetical protein MIMGU_mgv1a022636mg                187   2e-55    
gb|KFK28483.1|  hypothetical protein AALP_AA7G001800                    190   3e-55    
ref|XP_009131224.1|  PREDICTED: NAC domain-containing protein 78-...    188   3e-55    
emb|CDX90431.1|  BnaA03g43500D                                          190   3e-55    
ref|XP_010505816.1|  PREDICTED: NAC domain-containing protein 86-...    188   3e-55    
ref|XP_003549977.1|  PREDICTED: NAC domain-containing protein 78-...    191   3e-55    
ref|XP_010092473.1|  NAC domain-containing protein 78                   191   3e-55    
ref|XP_004148915.1|  PREDICTED: uncharacterized protein LOC101209310    197   3e-55    
ref|XP_004503093.1|  PREDICTED: protein FEZ-like isoform X1             197   3e-55    
ref|XP_006649289.1|  PREDICTED: uncharacterized protein LOC102717876    197   4e-55    
ref|XP_004157040.1|  PREDICTED: uncharacterized protein LOC101224912    197   4e-55    
ref|XP_011096933.1|  PREDICTED: NAC domain-containing protein 45        197   4e-55    
emb|CBI27341.3|  unnamed protein product                                197   4e-55    
ref|NP_197228.1|  NAC domain containing protein 86                      194   4e-55    
emb|CDY01508.1|  BnaC07g34980D                                          189   4e-55    
gb|KJB22460.1|  hypothetical protein B456_004G048200                    197   5e-55    
ref|XP_007146987.1|  hypothetical protein PHAVU_006G087000g             197   5e-55    
gb|EAY88306.1|  hypothetical protein OsI_09763                          197   5e-55    
ref|XP_002267333.1|  PREDICTED: NAC domain-containing protein 86        197   5e-55    
ref|XP_006400258.1|  hypothetical protein EUTSA_v10013344mg             194   5e-55    
emb|CAN80539.1|  hypothetical protein VITISV_005909                     192   5e-55    
ref|XP_006414166.1|  hypothetical protein EUTSA_v10027064mg             189   6e-55    
ref|XP_009598687.1|  PREDICTED: uncharacterized protein LOC104094...    195   6e-55    
ref|XP_008225989.1|  PREDICTED: protein BEARSKIN1                       191   6e-55    
ref|XP_008381390.1|  PREDICTED: uncharacterized protein LOC103444...    197   6e-55    
gb|KHG28573.1|  NAC domain-containing 74                                190   6e-55    
ref|XP_010037008.1|  PREDICTED: NAC domain-containing protein 74        187   6e-55    
ref|XP_009790485.1|  PREDICTED: NAC domain-containing protein 74 ...    187   6e-55    
emb|CDX78816.1|  BnaA01g08830D                                          189   6e-55    
ref|NP_001173241.1|  Os03g0119966                                       197   7e-55    
ref|XP_008343142.1|  PREDICTED: uncharacterized protein LOC103405...    197   7e-55    
ref|XP_009390804.1|  PREDICTED: NAC transcription factor 29-like        191   7e-55    
ref|XP_006846447.1|  hypothetical protein AMTR_s00018p00074980          197   7e-55    
ref|XP_007141968.1|  hypothetical protein PHAVU_008G241200g             197   8e-55    
gb|KJB26959.1|  hypothetical protein B456_004G268400                    189   8e-55    
ref|XP_006290189.1|  hypothetical protein CARUB_v10003869mg             194   8e-55    
ref|NP_001288459.1|  uncharacterized LOC103630963                       196   8e-55    
ref|XP_009131217.1|  PREDICTED: NAC domain-containing protein 78-...    189   8e-55    
ref|XP_010270699.1|  PREDICTED: NAC domain-containing protein 45        187   8e-55    
ref|XP_010069496.1|  PREDICTED: NAC domain-containing protein 74-...    187   8e-55    
ref|XP_008371963.1|  PREDICTED: protein BEARSKIN1-like                  190   9e-55    
ref|XP_010316554.1|  PREDICTED: NAC domain-containing protein 86 ...    192   9e-55    
gb|KJB37103.1|  hypothetical protein B456_006G189600                    187   9e-55    
ref|XP_006430405.1|  hypothetical protein CICLE_v10011293mg             196   9e-55    
ref|XP_008373551.1|  PREDICTED: protein ATAF2-like                      191   9e-55    
ref|XP_006481957.1|  PREDICTED: protein FEZ-like                        196   9e-55    
ref|XP_003562178.1|  PREDICTED: uncharacterized protein LOC100843938    197   9e-55    
ref|XP_010551125.1|  PREDICTED: NAC domain-containing protein 86        187   1e-54    
ref|XP_002318332.2|  no apical meristem family protein                  187   1e-54    
ref|XP_009340546.1|  PREDICTED: NAC transcription factor 29-like        190   1e-54    
gb|KJB43218.1|  hypothetical protein B456_007G188800                    196   1e-54    
ref|XP_009145987.1|  PREDICTED: NAC domain-containing protein 78        187   1e-54    
ref|XP_009340131.1|  PREDICTED: NAC transcription factor 29-like        190   1e-54    
ref|XP_006661516.1|  PREDICTED: NAC domain-containing protein 74-...    187   1e-54    
emb|CDP01698.1|  unnamed protein product                                196   1e-54    
ref|XP_010053592.1|  PREDICTED: transcription factor JUNGBRUNNEN ...    190   1e-54    
ref|XP_006436533.1|  hypothetical protein CICLE_v10031606mg             192   1e-54    
ref|XP_007039543.1|  NAC domain protein, IPR003441                      189   1e-54    
ref|XP_010694967.1|  PREDICTED: NAC domain-containing protein 86-...    196   1e-54    
ref|XP_007152594.1|  hypothetical protein PHAVU_004G143100g             186   1e-54    
ref|XP_011000782.1|  PREDICTED: NAC domain-containing protein 86-...    187   1e-54    
tpg|DAA42981.1|  TPA: putative NAC domain transcription factor su...    196   1e-54    
ref|XP_010270698.1|  PREDICTED: NAC domain-containing protein 45 ...    196   1e-54    
ref|XP_003524716.1|  PREDICTED: NAC domain-containing protein 78-...    189   1e-54    
ref|XP_010270697.1|  PREDICTED: NAC domain-containing protein 45 ...    196   1e-54    
emb|CDX92153.1|  BnaA05g22540D                                          186   1e-54    
gb|AHJ79176.1|  NAC domain protein NAC35                                189   1e-54    
ref|XP_002460636.1|  hypothetical protein SORBIDRAFT_02g032230          186   2e-54    
ref|XP_009386284.1|  PREDICTED: NAC domain-containing protein 78-...    189   2e-54    
ref|XP_009363322.1|  PREDICTED: NAC domain-containing protein 19-...    189   2e-54    
ref|XP_009370573.1|  PREDICTED: uncharacterized protein LOC103959...    196   2e-54    
emb|CAN80540.1|  hypothetical protein VITISV_005910                     200   2e-54    
ref|XP_006282042.1|  hypothetical protein CARUB_v10028284mg             188   2e-54    
ref|XP_010529123.1|  PREDICTED: NAC domain-containing protein 86-...    187   2e-54    
ref|XP_003537430.2|  PREDICTED: uncharacterized protein LOC100808596    196   2e-54    
ref|XP_003544352.1|  PREDICTED: protein FEZ-like                        196   2e-54    
ref|XP_008439242.1|  PREDICTED: protein BEARSKIN1                       186   2e-54    
ref|XP_004137396.1|  PREDICTED: NAC domain-containing protein 74-...    186   2e-54    
ref|XP_011469065.1|  PREDICTED: NAC domain-containing protein 86 ...    196   2e-54    
ref|XP_004985948.1|  PREDICTED: uncharacterized protein LOC101753...    196   2e-54    
ref|XP_010663931.1|  PREDICTED: NAC domain-containing protein 86 ...    186   2e-54    
ref|XP_002468623.1|  hypothetical protein SORBIDRAFT_01g049240          196   2e-54    
gb|KFK39102.1|  hypothetical protein AALP_AA3G201200                    186   2e-54    
ref|NP_199471.1|  NAC domain containing protein 96                      187   2e-54    
gb|KHN24171.1|  NAC domain-containing protein 74                        196   2e-54    
emb|CDO98612.1|  unnamed protein product                                186   2e-54    
ref|XP_004157266.1|  PREDICTED: NAC transcription factor ONAC010-...    184   2e-54    
ref|XP_003549188.1|  PREDICTED: NAC domain-containing protein 74-...    186   2e-54    
gb|AES94428.2|  NAC transcription factor-like protein                   189   3e-54    
ref|XP_004985947.1|  PREDICTED: uncharacterized protein LOC101753...    195   3e-54    
ref|XP_007214075.1|  hypothetical protein PRUPE_ppa017765mg             189   3e-54    
ref|XP_004135638.1|  PREDICTED: NAC transcription factor ONAC010-...    184   3e-54    
ref|XP_011047783.1|  PREDICTED: NAC domain-containing protein 86 ...    186   3e-54    
ref|XP_004299481.1|  PREDICTED: NAC domain-containing protein 86        186   3e-54    
ref|XP_010544346.1|  PREDICTED: NAC domain-containing protein 86-...    189   3e-54    
ref|XP_010661536.1|  PREDICTED: uncharacterized protein LOC100855128    192   3e-54    
gb|EMT23614.1|  NAC domain-containing protein 78                        194   3e-54    
ref|XP_006847701.1|  hypothetical protein AMTR_s00149p00068500          189   3e-54    
ref|XP_003534099.1|  PREDICTED: NAC domain-containing protein 74-...    185   3e-54    
ref|XP_009413062.1|  PREDICTED: uncharacterized protein LOC103994...    194   3e-54    
ref|XP_010269977.1|  PREDICTED: NAC domain-containing protein 19-...    189   4e-54    
ref|XP_010449530.1|  PREDICTED: NAC domain-containing protein 86-...    187   4e-54    
ref|XP_007032209.1|  NAC domain protein, IPR003441, putative isof...    195   4e-54    
emb|CBI38738.3|  unnamed protein product                                197   4e-54    
ref|XP_009621552.1|  PREDICTED: NAC domain-containing protein 74 ...    185   4e-54    
gb|AIU39717.1|  NAC transcription factor 57                             185   4e-54    
ref|XP_010494839.1|  PREDICTED: NAC domain-containing protein 86-...    187   4e-54    
ref|XP_007209299.1|  hypothetical protein PRUPE_ppa007828mg             188   5e-54    
ref|XP_003576809.1|  PREDICTED: NAC domain-containing protein 86-...    186   5e-54    
emb|CDX95832.1|  BnaC05g35830D                                          184   5e-54    
ref|XP_004511779.1|  PREDICTED: NAC domain-containing protein 89-...    188   5e-54    
gb|KJB25341.1|  hypothetical protein B456_004G186700                    188   5e-54    
gb|KHN41028.1|  NAC domain-containing protein 74                        194   6e-54    
ref|XP_010481438.1|  PREDICTED: NAC domain-containing protein 86-...    186   6e-54    
ref|XP_002525485.1|  transcription factor, putative                     185   6e-54    
ref|XP_006361710.1|  PREDICTED: NAC domain-containing protein 78-...    192   6e-54    
ref|XP_008653037.1|  PREDICTED: NAC domain-containing protein 74-...    185   6e-54    
gb|AGL39701.1|  NAC transcription factor 045                            187   6e-54    
gb|AIB05550.1|  NAC transcription factor                                185   6e-54    
ref|XP_002526579.1|  hypothetical protein RCOM_1603380                  194   6e-54    
ref|XP_010919872.1|  PREDICTED: NAC domain-containing protein 72-...    189   6e-54    
ref|XP_004250028.1|  PREDICTED: NAC domain-containing protein 78        192   6e-54    
ref|XP_008238287.1|  PREDICTED: NAC domain-containing protein 72        188   6e-54    
gb|AHJ79162.1|  NAC domain protein NAC21                                187   6e-54    
ref|XP_010481437.1|  PREDICTED: NAC domain-containing protein 86-...    186   6e-54    
ref|XP_010420434.1|  PREDICTED: NAC domain-containing protein 86-...    192   6e-54    
gb|EAZ10016.1|  hypothetical protein OsI_32319                          188   7e-54    
ref|XP_007022771.1|  NAC domain containing protein 20                   187   7e-54    
ref|XP_010549797.1|  PREDICTED: NAC domain-containing protein 45 ...    191   7e-54    
ref|XP_010420435.1|  PREDICTED: NAC domain-containing protein 86-...    192   7e-54    
gb|KEH26851.1|  NAC transcription factor-like protein                   184   7e-54    
emb|CDX67739.1|  BnaA07g17790D                                          187   7e-54    
ref|XP_010549796.1|  PREDICTED: NAC domain-containing protein 45 ...    191   7e-54    
gb|KJB25342.1|  hypothetical protein B456_004G186700                    187   8e-54    
ref|XP_010055345.1|  PREDICTED: NAC domain-containing protein 78        187   8e-54    
ref|XP_006385632.1|  hypothetical protein POPTR_0003s08830g             187   8e-54    
gb|AHJ79196.1|  NAC domain protein NAC55                                187   8e-54    
ref|XP_006855594.1|  hypothetical protein AMTR_s00044p00058960          195   9e-54    
ref|XP_004490776.1|  PREDICTED: uncharacterized protein LOC101514...    193   9e-54    
emb|CDX77674.1|  BnaC07g19280D                                          186   9e-54    
ref|XP_007135341.1|  hypothetical protein PHAVU_010G121100g             191   1e-53    
ref|XP_011101544.1|  PREDICTED: NAC domain-containing protein 78-...    192   1e-53    
ref|XP_006364397.1|  PREDICTED: NAC domain-containing protein 74-...    184   1e-53    
gb|KFK37763.1|  hypothetical protein AALP_AA3G026600                    189   1e-53    
ref|XP_006441340.1|  hypothetical protein CICLE_v10024520mg             184   1e-53    
ref|XP_009101506.1|  PREDICTED: NAC transcription factor 29-like        186   1e-53    
ref|XP_002316156.1|  hypothetical protein POPTR_0010s18180g             187   1e-53    
ref|XP_006368425.1|  hypothetical protein POPTR_0001s02710g             188   1e-53    
ref|NP_001146336.1|  putative NAC domain transcription factor sup...    194   1e-53    
ref|XP_008653036.1|  PREDICTED: NAC domain-containing protein 74-...    183   1e-53    
ref|XP_010441567.1|  PREDICTED: NAC domain-containing protein 86-...    185   1e-53    
ref|XP_003616168.1|  NAC domain protein                                 193   1e-53    
ref|XP_009418670.1|  PREDICTED: NAC domain-containing protein 74-...    184   1e-53    
ref|XP_004300256.1|  PREDICTED: protein ATAF2-like                      187   1e-53    



>ref|XP_011070419.1| PREDICTED: NAC domain-containing protein 4-like [Sesamum indicum]
 ref|XP_011070420.1| PREDICTED: NAC domain-containing protein 4-like [Sesamum indicum]
Length=590

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 179/209 (86%), Gaps = 4/209 (2%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            + ++ALP GFRFRPTD+EL++HYLR KINGRHS V+VIPEVDVCKWEPWDLP+LSVIK+D
Sbjct  8    MKLEALPKGFRFRPTDEELVNHYLRLKINGRHSAVEVIPEVDVCKWEPWDLPALSVIKSD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP D+KYPNG+R NRAT AGYWKATGKDR IK+RKS+ S  +N  LIG+KKTL
Sbjct  68   DREWFFFCPRDKKYPNGHRSNRATEAGYWKATGKDRTIKSRKSSSSGWANPHLIGMKKTL  127

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFYKGRAPKGERTNWIMHEYRATE DLDGT PGQG +VLC LFHK+D++      DE E 
Sbjct  128  VFYKGRAPKGERTNWIMHEYRATEQDLDGTAPGQGDYVLCRLFHKADEKLYNSNYDEVER  187

Query  573  SGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
            SGS P+TNKSSPDD+SS+LF+E  +LD Q
Sbjct  188  SGSFPSTNKSSPDDISSDLFREPPMLDTQ  216



>emb|CDP12257.1| unnamed protein product [Coffea canephora]
Length=591

 Score =   327 bits (838),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 178/212 (84%), Gaps = 4/212 (2%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +S ++LPLGFRFRPTD+ELI+HYLR KINGRH EVQVIPEVDVCKWEPWDLP LSVI
Sbjct  1    MGVVSTESLPLGFRFRPTDEELINHYLRLKINGRHDEVQVIPEVDVCKWEPWDLPQLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+ +S+ S  S+T LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSHRSSPSSNSSTHLIGMK  120

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK----SDDRKCDE  563
            KTLVFY+GRAPKGERT+WIMHEYRATEPDLDGT   Q A+VLC LFHK    +D  K DE
Sbjct  121  KTLVFYRGRAPKGERTSWIMHEYRATEPDLDGTASDQAAYVLCRLFHKPDETADSSKYDE  180

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
             EPSGSSP T KSSPDD SS+LFQE  +LD Q
Sbjct  181  VEPSGSSPNTVKSSPDDASSDLFQERLVLDMQ  212



>ref|XP_007039299.1| NAC domain-containing protein 78, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23800.1| NAC domain-containing protein 78, putative isoform 1 [Theobroma 
cacao]
Length=655

 Score =   324 bits (830),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 173/215 (80%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L+M+ LPLGFRFRPTD+ELI+HYL+ KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MAVLTMETLPLGFRFRPTDEELINHYLKLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DDPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKG+RTNWIMHEYRAT  DLDGT PGQGAFVLC LFHK ++R    K +E
Sbjct  112  KTLVFYKGRAPKGQRTNWIMHEYRATAKDLDGTGPGQGAFVLCRLFHKLEERNDTVKYEE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SP   KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPTMTKSSPDDTSSDLLQDTVSSDTQAQK  206



>ref|XP_007210371.1| hypothetical protein PRUPE_ppa001291mg [Prunus persica]
 gb|EMJ11570.1| hypothetical protein PRUPE_ppa001291mg [Prunus persica]
Length=862

 Score =   325 bits (832),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 178/215 (83%), Gaps = 5/215 (2%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSMD+LPLGFRFRPTD+ELI+HYL+ KINGR+SEVQVIPE+DVCKWEPWDLP LSVI
Sbjct  1    MAVLSMDSLPLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+R+   +  S T  +G+K
Sbjct  61   KSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNS-TGQVGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAP+GERT+WIMHEYRAT+ DLDGT PGQGAFVLC LFHK +++    K DE
Sbjct  120  KTLVFYRGRAPRGERTSWIMHEYRATQKDLDGTAPGQGAFVLCRLFHKPEEKADVLKYDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SP T KSSPD+ SS++ QE A  D Q +K
Sbjct  180  VEQTGLSPTTTKSSPDETSSDVVQETATSDMQGEK  214



>gb|KHG02383.1| NAC domain-containing 74 [Gossypium arboreum]
Length=876

 Score =   323 bits (827),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 170/215 (79%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L+M+ LPLGFRFRPTD+ELI+HYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MEVLTMETLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DDPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDPEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERTNWIMHEYR T  +LDGT PGQ AFVLC LFHK + R    K DE
Sbjct  112  KTLVFYKGRAPKGERTNWIMHEYRPTTRELDGTAPGQSAFVLCRLFHKVEGRNDIVKYDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SPA  KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPAMIKSSPDDTSSDLLQDTVSSDTQAQK  206



>ref|XP_011081340.1| PREDICTED: uncharacterized protein LOC105164394 isoform X2 [Sesamum 
indicum]
Length=588

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            + ++ALP GFRFRPTD+EL+SHYLR KING HS VQVIPE+DVCKWEPWDLP+LSVIK+D
Sbjct  1    MKLEALPKGFRFRPTDEELVSHYLRLKINGHHSSVQVIPEIDVCKWEPWDLPALSVIKSD  60

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS  S +SNT LIG+KKTL
Sbjct  61   DQEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSLPSGRSNTQLIGMKKTL  120

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFYKGRAPKGERTNWIMHEYRATEPDLDG+ PGQG +VLC LFHK+D++    K DE EP
Sbjct  121  VFYKGRAPKGERTNWIMHEYRATEPDLDGSSPGQGDYVLCRLFHKADEKLDHSKYDEVEP  180

Query  573  SGSSPATNKSSPDDV-SSNLFQEAALL  650
            +GSSP+T+KSSPD+  SS+LF E A L
Sbjct  181  TGSSPSTSKSSPDEASSSDLFTEPAGL  207



>ref|XP_011081339.1| PREDICTED: uncharacterized protein LOC105164394 isoform X1 [Sesamum 
indicum]
Length=593

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 179/207 (86%), Gaps = 5/207 (2%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            + ++ALP GFRFRPTD+EL+SHYLR KING HS VQVIPE+DVCKWEPWDLP+LSVIK+D
Sbjct  1    MKLEALPKGFRFRPTDEELVSHYLRLKINGHHSSVQVIPEIDVCKWEPWDLPALSVIKSD  60

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS  S +SNT LIG+KKTL
Sbjct  61   DQEWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSLPSGRSNTQLIGMKKTL  120

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFYKGRAPKGERTNWIMHEYRATEPDLDG+ PGQG +VLC LFHK+D++    K DE EP
Sbjct  121  VFYKGRAPKGERTNWIMHEYRATEPDLDGSSPGQGDYVLCRLFHKADEKLDHSKYDEVEP  180

Query  573  SGSSPATNKSSPDDV-SSNLFQEAALL  650
            +GSSP+T+KSSPD+  SS+LF E A L
Sbjct  181  TGSSPSTSKSSPDEASSSDLFTEPAGL  207



>gb|KJB52429.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=782

 Score =   319 bits (818),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L+M  LPLGFRFRPTD+ELI+HYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MEVLTMGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDLEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERTNWIMHEYR T  +LDGT PGQ AFVLC LFHK + R    K DE
Sbjct  112  KTLVFYKGRAPKGERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRNDIVKYDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SPA  KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPAMIKSSPDDTSSDLLQDTVSSDTQAQK  206



>ref|XP_002317040.2| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|EEE97652.2| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=667

 Score =   316 bits (810),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 178/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CKWEPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP G+RTNW+MHEYR TE DLDGT PGQGAFVL  LF K ++R    K DE E + 
Sbjct  123  YRGRAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPEERPSIVKYDEIEQTA  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             S    KSSPDD SS+L QE A  +    +QP+          N+TS  ++P+
Sbjct  183  YSTTAAKSSPDDASSDLVQETATSEMSSGKQPEDIKMWSTESDNMTSNAVVPI  235



>ref|XP_008245853.1| PREDICTED: uncharacterized protein LOC103344010, partial [Prunus 
mume]
Length=826

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 177/215 (82%), Gaps = 5/215 (2%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSMD+LPLGFRFRPTD+ELI+HYL+ KINGR+SEVQVIPE+DVCKWEPWDLP LSVI
Sbjct  1    MAVLSMDSLPLGFRFRPTDEELINHYLKLKINGRNSEVQVIPEIDVCKWEPWDLPKLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+R+   +  S T  +G+K
Sbjct  61   KSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNS-TGQVGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVF++GRAP+GERT+WIMHEYRAT+ DLDGT PGQGAFVLC LFHK +++    K DE
Sbjct  120  KTLVFHRGRAPRGERTSWIMHEYRATQKDLDGTAPGQGAFVLCRLFHKPEEKADVLKYDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SP T K SPD+ SS++ QE A  D Q +K
Sbjct  180  VEQTGLSPTTTKYSPDETSSDVVQETATPDMQGEK  214



>ref|XP_002300524.2| hypothetical protein POPTR_0001s45700g [Populus trichocarpa]
 gb|EEE85329.2| hypothetical protein POPTR_0001s45700g [Populus trichocarpa]
Length=636

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 169/212 (80%), Gaps = 8/212 (4%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            +SMD+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+DVCKWEPWDLP  SVIKTD
Sbjct  2    VSMDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDVCKWEPWDLPGQSVIKTD  61

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTL
Sbjct  62   DPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTL  117

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAPKG+RTNWIMHEYR TE DLDGT PGQ AFVL  LF K ++R    K DE E 
Sbjct  118  VFYRGRAPKGKRTNWIMHEYRPTEEDLDGTGPGQVAFVLFRLFRKPEERTNGVKYDEIEQ  177

Query  573  SGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             G SP   KSSPD+ SS+L QE A  D    K
Sbjct  178  IGYSPTAAKSSPDNASSDLVQETATSDMHSGK  209



>gb|KJB52425.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=654

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L+M  LPLGFRFRPTD+ELI+HYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MEVLTMGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDLEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERTNWIMHEYR T  +LDGT PGQ AFVLC LFHK + R    K DE
Sbjct  112  KTLVFYKGRAPKGERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRNDIVKYDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SPA  KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPAMIKSSPDDTSSDLLQDTVSSDTQAQK  206



>gb|AIA57515.1| NAC domain-containing protein [Boehmeria nivea]
Length=644

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 170/210 (81%), Gaps = 5/210 (2%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +++++LPLGFRFRPTD+ELI+HYLR K+NGRH++V VIPE+DVCKWEPWDLPSLSVI
Sbjct  1    MGTVTLESLPLGFRFRPTDEELINHYLRLKVNGRHADVHVIPEIDVCKWEPWDLPSLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR I++R       +N  LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRSRAYRSPSNTNG-LIGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERT+WIMHEYR T  DLDGT PGQ AFVLC LF KS+++    K DE
Sbjct  120  KTLVFYRGRAPKGERTHWIMHEYRPTLKDLDGTGPGQEAFVLCRLFRKSEEKAESPKYDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLD  653
               +GSSP T KSSPDD SS++ QE A  D
Sbjct  180  VNQTGSSPTTTKSSPDDTSSDMLQETATSD  209



>ref|XP_011004356.1| PREDICTED: uncharacterized protein LOC105110869 isoform X6 [Populus 
euphratica]
Length=669

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>ref|XP_006377880.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55677.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=697

 Score =   316 bits (809),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 178/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CKWEPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP G+RTNW+MHEYR TE DLDGT PGQGAFVL  LF K ++R    K DE E + 
Sbjct  123  YRGRAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPEERPSIVKYDEIEQTA  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             S    KSSPDD SS+L QE A  +    +QP+          N+TS  ++P+
Sbjct  183  YSTTAAKSSPDDASSDLVQETATSEMSSGKQPEDIKMWSTESDNMTSNAVVPI  235



>ref|XP_011004351.1| PREDICTED: uncharacterized protein LOC105110869 isoform X2 [Populus 
euphratica]
Length=678

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>gb|KJB52426.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=721

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L+M  LPLGFRFRPTD+ELI+HYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MEVLTMGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDLEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERTNWIMHEYR T  +LDGT PGQ AFVLC LFHK + R    K DE
Sbjct  112  KTLVFYKGRAPKGERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRNDIVKYDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SPA  KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPAMIKSSPDDTSSDLLQDTVSSDTQAQK  206



>gb|KCW72635.1| hypothetical protein EUGRSUZ_E01095 [Eucalyptus grandis]
Length=628

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 8/212 (4%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L M+ALPLGFRFRPTD+ELISHYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MGVLEMEALPLGFRFRPTDEELISHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G+      LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSGGAAAG---LIGMK  117

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERT+WIMHEYRATE DLDGT PGQ A+VLC LF K++++    K DE
Sbjct  118  KTLVFYRGRAPKGERTHWIMHEYRATEQDLDGTGPGQAAYVLCRLFRKAEEKPEVVKYDE  177

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
             E +G SP T KSSPD+  S++  E  + + Q
Sbjct  178  VEQTGLSP-TAKSSPDEALSDVVPETPVSNVQ  208



>ref|XP_007039300.1| NAC domain-containing protein 78, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23801.1| NAC domain-containing protein 78, putative isoform 2 [Theobroma 
cacao]
Length=658

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 166/206 (81%), Gaps = 13/206 (6%)
 Frame = +3

Query  63   PLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWFF  242
            PLGFRFRPTD+ELI+HYL+ KINGRHSEV+VIPE+DVCKWEPWDLP LSVIK+DDPEWFF
Sbjct  13   PLGFRFRPTDEELINHYLKLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVIKSDDPEWFF  72

Query  243  FCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKGR  422
            FCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+KKTLVFYKGR
Sbjct  73   FCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMKKTLVFYKGR  123

Query  423  APKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSGSSPA  590
            APKG+RTNWIMHEYRAT  DLDGT PGQGAFVLC LFHK ++R    K +E E +G SP 
Sbjct  124  APKGQRTNWIMHEYRATAKDLDGTGPGQGAFVLCRLFHKLEERNDTVKYEEVEQTGYSPT  183

Query  591  TNKSSPDDVSSNLFQEAALLDRQPQK  668
              KSSPDD SS+L Q+    D Q QK
Sbjct  184  MTKSSPDDTSSDLLQDTVSSDTQAQK  209



>ref|XP_006377879.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55676.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=672

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 178/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CKWEPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP G+RTNW+MHEYR TE DLDGT PGQGAFVL  LF K ++R    K DE E + 
Sbjct  123  YRGRAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPEERPSIVKYDEIEQTA  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             S    KSSPDD SS+L QE A  +    +QP+          N+TS  ++P+
Sbjct  183  YSTTAAKSSPDDASSDLVQETATSEMSSGKQPEDIKMWSTESDNMTSNAVVPI  235



>gb|KJB52427.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=790

 Score =   318 bits (814),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L+M  LPLGFRFRPTD+ELI+HYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MEVLTMGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDLEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERTNWIMHEYR T  +LDGT PGQ AFVLC LFHK + R    K DE
Sbjct  112  KTLVFYKGRAPKGERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRNDIVKYDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SPA  KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPAMIKSSPDDTSSDLLQDTVSSDTQAQK  206



>ref|XP_010533527.1| PREDICTED: uncharacterized protein LOC104809290 [Tarenaya hassleriana]
Length=644

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 172/210 (82%), Gaps = 13/210 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+ELI+HYL  KINGRHS+VQVIPEVDVCKWEPWDLPSLSVI
Sbjct  20   MGAMSMESLPLGFRFRPTDEELINHYLCLKINGRHSDVQVIPEVDVCKWEPWDLPSLSVI  79

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR IK++K+         LIG+K
Sbjct  80   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRTIKSKKT---------LIGMK  130

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T+ +LDG+ PGQ  FVLC LFHK +DR    K DE
Sbjct  131  KTLVFYRGRAPKGERTNWIMHEYRPTQKELDGSAPGQSPFVLCRLFHKPEDRVNGVKSDE  190

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLD  653
             E  GS+P+T+KS PD+ SS+L QE A  D
Sbjct  191  TERIGSTPSTSKSLPDEASSDLVQETATSD  220



>ref|XP_006377878.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
 gb|ERP55675.1| hypothetical protein POPTR_0011s15230g [Populus trichocarpa]
Length=647

 Score =   314 bits (804),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/233 (67%), Positives = 178/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CKWEPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKWEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATEAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP G+RTNW+MHEYR TE DLDGT PGQGAFVL  LF K ++R    K DE E + 
Sbjct  123  YRGRAPNGKRTNWVMHEYRPTEKDLDGTGPGQGAFVLFRLFRKPEERPSIVKYDEIEQTA  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             S    KSSPDD SS+L QE A  +    +QP+          N+TS  ++P+
Sbjct  183  YSTTAAKSSPDDASSDLVQETATSEMSSGKQPEDIKMWSTESDNMTSNAVVPI  235



>gb|KJB52428.1| hypothetical protein B456_008G261400 [Gossypium raimondii]
Length=859

 Score =   319 bits (817),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 168/215 (78%), Gaps = 13/215 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L+M  LPLGFRFRPTD+ELI+HYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MEVLTMGTLPLGFRFRPTDEELINHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDLEWFFFCPRDRKYPNGHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERTNWIMHEYR T  +LDGT PGQ AFVLC LFHK + R    K DE
Sbjct  112  KTLVFYKGRAPKGERTNWIMHEYRPTTKELDGTAPGQSAFVLCRLFHKVEGRNDIVKYDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SPA  KSSPDD SS+L Q+    D Q QK
Sbjct  172  VEQTGYSPAMIKSSPDDTSSDLLQDTVSSDTQAQK  206



>ref|XP_011004350.1| PREDICTED: uncharacterized protein LOC105110869 isoform X1 [Populus 
euphratica]
Length=699

 Score =   315 bits (806),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>ref|XP_011004354.1| PREDICTED: uncharacterized protein LOC105110869 isoform X4 [Populus 
euphratica]
Length=674

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>ref|XP_011004355.1| PREDICTED: uncharacterized protein LOC105110869 isoform X5 [Populus 
euphratica]
Length=672

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>ref|XP_011004357.1| PREDICTED: uncharacterized protein LOC105110869 isoform X7 [Populus 
euphratica]
Length=647

 Score =   313 bits (802),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>gb|AGL39711.1| NAC transcription factor 055 [Jatropha curcas]
 gb|KDP25178.1| hypothetical protein JCGZ_20334 [Jatropha curcas]
Length=605

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 169/207 (82%), Gaps = 8/207 (4%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSM++LPLGFRFRPTD+EL++HYLR KINGR+SEV+VIPEVD+CKWEPWDLP LSVI
Sbjct  1    MAVLSMESLPLGFRFRPTDEELVNHYLRLKINGRNSEVEVIPEVDICKWEPWDLPELSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR IK+RKS     SN   IG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIKSRKSG----SNPISIGMK  116

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLF----HKSDDRKCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDG+ PGQ AFVL  LF     K+D  K DE
Sbjct  117  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGSAPGQSAFVLFRLFRKPEEKTDTVKYDE  176

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAA  644
             E +G SP T+KSSPDD SS+L QE A
Sbjct  177  VEQTGYSPTTSKSSPDDTSSDLVQETA  203



>ref|XP_011004352.1| PREDICTED: uncharacterized protein LOC105110869 isoform X3 [Populus 
euphratica]
Length=674

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 177/233 (76%), Gaps = 20/233 (9%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+D+CK EPWDLP LSVIKTDDP
Sbjct  7    VDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDICKLEPWDLPGLSVIKTDDP  66

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTLVF
Sbjct  67   EWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTLVF  122

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAPKGERTNWIMHEYR TE DL+GT PGQGAFVL  LF K ++R    K DE E   
Sbjct  123  YRGRAPKGERTNWIMHEYRPTEKDLNGTGPGQGAFVLFRLFRKPEERPSIVKYDEMEQIE  182

Query  579  SSPATNKSSPDDVSSNLFQEAALLD----RQPQKA--------NVTSIVMLPV  701
             SP   KSSPDD SS+L QE A  +    RQP+          N TS  ++P+
Sbjct  183  YSPTAAKSSPDDASSDLVQETATSEMSSGRQPEDIKMWSAESDNTTSNAVVPI  235



>ref|XP_010056056.1| PREDICTED: uncharacterized protein LOC104444143 [Eucalyptus grandis]
 gb|KCW72636.1| hypothetical protein EUGRSUZ_E01095 [Eucalyptus grandis]
Length=656

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 8/212 (4%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L M+ALPLGFRFRPTD+ELISHYLR KINGRHSEV+VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MGVLEMEALPLGFRFRPTDEELISHYLRLKINGRHSEVEVIPEIDVCKWEPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G+      LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRKSGGAAAG---LIGMK  117

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERT+WIMHEYRATE DLDGT PGQ A+VLC LF K++++    K DE
Sbjct  118  KTLVFYRGRAPKGERTHWIMHEYRATEQDLDGTGPGQAAYVLCRLFRKAEEKPEVVKYDE  177

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
             E +G SP T KSSPD+  S++  E  + + Q
Sbjct  178  VEQTGLSP-TAKSSPDEALSDVVPETPVSNVQ  208



>ref|XP_011038026.1| PREDICTED: uncharacterized protein LOC105135051 [Populus euphratica]
Length=639

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 172/222 (77%), Gaps = 8/222 (4%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            +S+D+LPLGFRFRPTD+ELISHYLR KINGR SEV+VIPE+DVCK EPWDLP LSVIKTD
Sbjct  5    VSIDSLPLGFRFRPTDEELISHYLRLKINGRDSEVEVIPEIDVCKREPWDLPGLSVIKTD  64

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+RKS G    NT LIG+KKTL
Sbjct  65   DPEWFFFCPRDRKYPNGHRSNRATNAGYWKATGKDRTIKSRKSAG----NTTLIGMKKTL  120

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAPKGERTNWIMHEYR TE DLDGT PGQ AFVL  LF K ++R    K DE E 
Sbjct  121  VFYRGRAPKGERTNWIMHEYRPTEKDLDGTGPGQVAFVLFRLFRKPEERTNGVKYDEIEQ  180

Query  573  SGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLP  698
             G SPA  KS PD+  S+L QE A  D    K +    + LP
Sbjct  181  IGYSPAAAKSPPDNAPSDLVQETATSDMHSGKQSEDIKMWLP  222



>ref|XP_002867065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43324.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 170/215 (79%), Gaps = 17/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  +VLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKLDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
            A P+      NK SPDD SS+L QE    D   +K
Sbjct  172  AAPT----TCNKYSPDDTSSDLVQETPSSDAAVEK  202



>ref|NP_001119122.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
 emb|CAA20028.1| NAM / CUC2 -like protein [Arabidopsis thaliana]
 emb|CAB80274.1| NAM / CUC2-like protein [Arabidopsis thaliana]
 gb|AEE86534.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=534

 Score =   305 bits (781),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 171/215 (80%), Gaps = 17/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  +VLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
            A    +  A+NK SPDD SS+L QE    D   +K
Sbjct  172  A----AFTASNKYSPDDTSSDLVQETPSSDAAVEK  202



>ref|NP_001190927.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
 gb|AEE86535.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=533

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 171/215 (80%), Gaps = 17/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  +VLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
            A    +  A+NK SPDD SS+L QE    D   +K
Sbjct  172  A----AFTASNKYSPDDTSSDLVQETPSSDAAVEK  202



>ref|NP_567986.3| NAC transcription factor-like 9 [Arabidopsis thaliana]
 gb|AEE86533.1| NAC transcription factor-like 9 [Arabidopsis thaliana]
Length=512

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 171/215 (80%), Gaps = 17/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  +VLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTSPGQSPYVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
            A    +  A+NK SPDD SS+L QE    D   +K
Sbjct  172  A----AFTASNKYSPDDTSSDLVQETPSSDAAVEK  202



>ref|XP_008360722.1| PREDICTED: uncharacterized protein LOC103424418 [Malus domestica]
Length=859

 Score =   311 bits (798),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 175/215 (81%), Gaps = 6/215 (3%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSM++LPLGFRFRPTD+ELI+HYLR KING  SEVQVIPE+DVC+WEPWDLP LSVI
Sbjct  1    MAELSMESLPLGFRFRPTDEELINHYLRLKINGHDSEVQVIPEIDVCRWEPWDLPKLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+R+   +  SN   +G+K
Sbjct  61   KSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKFATNSNGQ-VGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFH----KSDDRKCDE  563
            KTLVFY+GRAPKGERT+WIMHEYRAT+ +LDGT P QGAFVLC LFH    K+D+ K DE
Sbjct  120  KTLVFYRGRAPKGERTSWIMHEYRATQKELDGTAPSQGAFVLCRLFHKPEEKADEPKHDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             E +G SP T KSSPD+ SS++ QE A  + Q +K
Sbjct  180  VEQTGLSPTTTKSSPDE-SSDIVQETATSEMQGEK  213



>ref|NP_001280864.1| uncharacterized LOC103438687 [Malus domestica]
 gb|ADL36810.1| NAC domain class transcription factor [Malus domestica]
Length=850

 Score =   311 bits (797),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 175/212 (83%), Gaps = 6/212 (3%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSM++LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVC+WEPWDLP LSVI
Sbjct  1    MAELSMESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPKLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+R+   +  SN   +G+K
Sbjct  61   KSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSNGQ-VGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERT+WIMHEYRAT+ +LDGT PGQGAFVLC LFHK +++    K DE
Sbjct  120  KTLVFYRGRAPKGERTSWIMHEYRATQKELDGTGPGQGAFVLCRLFHKPEEKADVPKYDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
             E +G SP T KSSPD+ SS++ QE A  + Q
Sbjct  180  VEQTGLSPTTTKSSPDE-SSDIIQETATSEIQ  210



>ref|XP_010446907.1| PREDICTED: NAC domain-containing protein 86-like [Camelina sativa]
Length=522

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 169/215 (79%), Gaps = 18/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  FVLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTGPGQNPFVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
                  +P + K SPDD SS+L QE    D   +K
Sbjct  172  P-----APTSCKDSPDDTSSDLVQETPSSDAAVEK  201



>ref|XP_010437454.1| PREDICTED: uncharacterized protein LOC104721220 [Camelina sativa]
Length=526

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 169/215 (79%), Gaps = 18/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  FVLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTGPGQSPFVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
                  +P + K SPDD SS+L QE    D   +K
Sbjct  172  P-----APTSCKYSPDDTSSDLVQETPSSDAAVEK  201



>ref|XP_010432259.1| PREDICTED: NAC domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=537

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 169/215 (79%), Gaps = 18/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGVVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  FVLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTGPGQSPFVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
              PS     + K SPDD SS+L QE    D   +K
Sbjct  172  PAPS-----SCKYSPDDTSSDLVQETPSSDTAVEK  201



>gb|KFK45050.1| hypothetical protein AALP_AA1G337500 [Arabis alpina]
Length=650

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 161/200 (81%), Gaps = 10/200 (5%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  6    LSMETLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  65

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  66   DPEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  116

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSS  584
            VFY+GRAP+GERTNWIMHEYRAT+ DLDGT PGQ  +VLC LFHK  D  CDE E   S+
Sbjct  117  VFYRGRAPRGERTNWIMHEYRATDNDLDGTGPGQNPYVLCRLFHKPSD-NCDEIENVTST  175

Query  585  PATNKSSPDDVSSNLFQEAA  644
            P T + SPDD SS + QE A
Sbjct  176  PNTARCSPDDTSSEMVQETA  195



>ref|XP_006286077.1| hypothetical protein CARUB_v10007613mg [Capsella rubella]
 gb|EOA18975.1| hypothetical protein CARUB_v10007613mg [Capsella rubella]
Length=526

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 171/220 (78%), Gaps = 18/220 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGAVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  FVLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTAPGQSPFVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTS  683
                  +P   K SPDD SS+L QE    D   +K + +S
Sbjct  172  P-----APIPCKYSPDDTSSDLVQETPSSDAAVEKPSDSS  206



>ref|XP_010432258.1| PREDICTED: NAC domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=522

 Score =   300 bits (767),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 169/215 (79%), Gaps = 18/215 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+EL++HYLR KINGRHS+V+VIP++DVCKWEPWDLP+LSVI
Sbjct  1    MGVVSMESLPLGFRFRPTDEELVNHYLRLKINGRHSDVRVIPDIDVCKWEPWDLPALSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG+R NRAT +GYWKATGKDR+IK++K+         LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGHRSNRATDSGYWKATGKDRSIKSKKT---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ  FVLC LFHK DDR    K DE
Sbjct  112  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTGPGQSPFVLCRLFHKPDDRVNGVKSDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
              PS     + K SPDD SS+L QE    D   +K
Sbjct  172  PAPS-----SCKYSPDDTSSDLVQETPSSDTAVEK  201



>gb|KFK45049.1| hypothetical protein AALP_AA1G337500 [Arabis alpina]
Length=649

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 161/200 (81%), Gaps = 10/200 (5%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  6    LSMETLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  65

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  66   DPEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  116

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSS  584
            VFY+GRAP+GERTNWIMHEYRAT+ DLDGT PGQ  +VLC LFHK  D  CDE E   S+
Sbjct  117  VFYRGRAPRGERTNWIMHEYRATDNDLDGTGPGQNPYVLCRLFHKPSD-NCDEIENVTST  175

Query  585  PATNKSSPDDVSSNLFQEAA  644
            P T + SPDD SS + QE A
Sbjct  176  PNTARCSPDDTSSEMVQETA  195



>ref|XP_009360232.1| PREDICTED: uncharacterized protein LOC103950728 [Pyrus x bretschneideri]
Length=854

 Score =   308 bits (788),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 174/212 (82%), Gaps = 6/212 (3%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSM++LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVC+WEPWDLP LSVI
Sbjct  1    MAELSMESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPKLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+R+   +  SN   +G+K
Sbjct  61   KSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRQCKSASNSNGQ-VGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAPKGERT+WIMHEYRAT+ +LDGT PGQGAFVLC LFHK +++    K DE
Sbjct  120  KTLVFYRGRAPKGERTSWIMHEYRATQKELDGTGPGQGAFVLCRLFHKPEEKADVPKYDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
             E +G SP   KSSPD+ SS++ QE A  + Q
Sbjct  180  VEQTGLSPTPTKSSPDE-SSDIIQETATSEIQ  210



>gb|KJB18878.1| hypothetical protein B456_003G073300 [Gossypium raimondii]
Length=547

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 169/220 (77%), Gaps = 14/220 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L+M+ LPLGFRFRPTD+ELI+HYLR KINGRHSEV VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MAVLTMETLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DDPEWFFFCPLDRKYPN +R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKG+RT WIMHEYR T  DLDGT PGQ AFVLC LFHK +++    K DE
Sbjct  112  KTLVFYKGRAPKGQRTYWIMHEYRPTTEDLDGTAPGQSAFVLCRLFHKPEEKNDIVKYDE  171

Query  564  AEPSGSSPATNKSSP-DDVSSNLFQEAALLDRQPQKANVT  680
             E +  S A  KS+P DD SS+L Q+    + Q Q  + +
Sbjct  172  VEQTVCSAAMTKSAPDDDTSSDLLQDTISSETQAQNPDTS  211



>ref|XP_010104895.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXC02131.1| NAC domain-containing protein 78 [Morus notabilis]
Length=744

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +S+++LPLGFRFRPTD+ELI+HYLR KINGR+++V VIPE+DVCK EPWDLP  SVI
Sbjct  1    MGTVSLESLPLGFRFRPTDEELINHYLRLKINGRNADVHVIPEIDVCKREPWDLPRQSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR I++R    +  +N  LIG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRSRSYRSASNTNG-LIGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLF----HKSDDRKCDE  563
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDGT PGQ AFVLC LF     KSD  K DE
Sbjct  120  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGTGPGQEAFVLCRLFRKPEEKSDALKHDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLD  653
               +GSSP   KSSPDD SS+L QE A  D
Sbjct  180  VNQTGSSPTITKSSPDDTSSDLLQETAPSD  209



>gb|KJB18876.1| hypothetical protein B456_003G073300 [Gossypium raimondii]
Length=635

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 169/220 (77%), Gaps = 14/220 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L+M+ LPLGFRFRPTD+ELI+HYLR KINGRHSEV VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MAVLTMETLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DDPEWFFFCPLDRKYPN +R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKG+RT WIMHEYR T  DLDGT PGQ AFVLC LFHK +++    K DE
Sbjct  112  KTLVFYKGRAPKGQRTYWIMHEYRPTTEDLDGTAPGQSAFVLCRLFHKPEEKNDIVKYDE  171

Query  564  AEPSGSSPATNKSSP-DDVSSNLFQEAALLDRQPQKANVT  680
             E +  S A  KS+P DD SS+L Q+    + Q Q  + +
Sbjct  172  VEQTVCSAAMTKSAPDDDTSSDLLQDTISSETQAQNPDTS  211



>ref|XP_010499853.1| PREDICTED: NAC domain-containing protein 86-like isoform X2 [Camelina 
sativa]
Length=667

 Score =   301 bits (772),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      CDE E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHKPSDSCDTANCDEIEN  178

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              ++P T + SPDD SS + QE A
Sbjct  179  VNTTPTTTRCSPDDTSSEMVQETA  202



>ref|XP_010499852.1| PREDICTED: NAC domain-containing protein 86-like isoform X1 [Camelina 
sativa]
Length=668

 Score =   301 bits (772),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      CDE E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHKPSDSCDTANCDEIEN  178

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              ++P T + SPDD SS + QE A
Sbjct  179  VNTTPTTTRCSPDDTSSEMVQETA  202



>ref|XP_010499854.1| PREDICTED: NAC domain-containing protein 86-like isoform X3 [Camelina 
sativa]
Length=664

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 161/204 (79%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      CDE E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHKPSDSCDTANCDEIEN  178

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              ++P T + SPDD SS + QE A
Sbjct  179  VNTTPTTTRCSPDDTSSEMVQETA  202



>gb|KHF99264.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=635

 Score =   300 bits (768),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 169/220 (77%), Gaps = 14/220 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L+M+ LPLGFRFRPTD+ELI+HYLR KINGRHSEV VIPE+DVCKWEPWDLP LSVI
Sbjct  1    MAVLTMETLPLGFRFRPTDEELINHYLRLKINGRHSEVGVIPEIDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DDPEWFFFCPLDRKYPN +R NRAT  GYWKATGKDR IK++KS         LIG+K
Sbjct  61   KSDDPEWFFFCPLDRKYPNSHRSNRATDKGYWKATGKDRTIKSKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKG+RT WIMHEYR T  DLDGT PGQ AFVLC LFHK +++    K DE
Sbjct  112  KTLVFYKGRAPKGQRTYWIMHEYRPTTKDLDGTAPGQSAFVLCRLFHKPEEKNDIVKYDE  171

Query  564  AEPSGSSPATNKSSP-DDVSSNLFQEAALLDRQPQKANVT  680
             E +  S A  KS+P DD SS+L Q+    + Q Q  + +
Sbjct  172  VEQTVCSAAMTKSAPDDDTSSDLLQDTISSETQAQNPDTS  211



>ref|XP_006415127.1| hypothetical protein EUTSA_v10007021mg [Eutrema salsugineum]
 gb|ESQ33480.1| hypothetical protein EUTSA_v10007021mg [Eutrema salsugineum]
Length=654

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 162/206 (79%), Gaps = 13/206 (6%)
 Frame = +3

Query  39   SGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIK  218
            + LSM++LPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIK
Sbjct  8    AALSMESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIK  67

Query  219  TDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKK  398
            TDD EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KK
Sbjct  68   TDDQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKK  118

Query  399  TLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEA  566
            TLVFY+GRAP+GERTNWIMHEYRAT+ DLDGT PGQ  +VLC LFHK +D      CDE 
Sbjct  119  TLVFYRGRAPRGERTNWIMHEYRATDKDLDGTGPGQNPYVLCRLFHKPNDSCDVANCDEV  178

Query  567  EPSGSSPATNKSSPDDVSSNLFQEAA  644
            E   S+P   + SPDD SS++ QE A
Sbjct  179  ENVNSTPTATRCSPDDTSSDMVQETA  204



>ref|XP_004309509.1| PREDICTED: uncharacterized protein LOC101295292 [Fragaria vesca 
subsp. vesca]
Length=713

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 173/215 (80%), Gaps = 8/215 (4%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LSM++LPLGFRFRPTD+ELI+HYLR KINGRHSEVQVIP++DVCKWEPWDLP LS+I
Sbjct  1    MAVLSMESLPLGFRFRPTDEELINHYLRLKINGRHSEVQVIPDIDVCKWEPWDLPKLSMI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+DD EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK+R+   +  S T L+G+K
Sbjct  61   KSDDQEWFFFCPRDRKYPNGHRSNRATDAGYWKATGKDRTIKSRRFKSAANS-TGLVGMK  119

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKGERT+WIMHEYR T+ +LDGT PGQ A+VLC LFHK +++    K DE
Sbjct  120  KTLVFYKGRAPKGERTSWIMHEYRPTQKELDGTAPGQCAYVLCRLFHKPEEKAEVLKYDE  179

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
             +  G SP T   SPD+ SS++ QE+   D +  K
Sbjct  180  VDQPGLSPTT---SPDETSSDVVQESPTPDMKGGK  211



>ref|XP_010529684.1| PREDICTED: NAC domain-containing protein 86 [Tarenaya hassleriana]
Length=637

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 162/212 (76%), Gaps = 13/212 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS++ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPEVDVCKWEPWDLP LSVIKTD
Sbjct  6    LSVEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEVDVCKWEPWDLPGLSVIKTD  65

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K           +G+KKTL
Sbjct  66   DQEWFFFCPRDRKYPSGHRSNRATDTGYWKATGKDRTIKSKKMA---------VGMKKTL  116

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ DLDG  PGQ  +VLC LFHK  D      CDE E 
Sbjct  117  VFYRGRAPRGERTNWIMHEYRATDKDLDGNGPGQNPYVLCRLFHKPSDSCGTANCDELEN  176

Query  573  SGSSPATNKSSPDDVSSNLFQEAALLDRQPQK  668
            + S+P + KS PDD SS + QE A    Q  K
Sbjct  177  AKSTPTSTKSIPDDTSSEMVQETATSRSQASK  208



>gb|EYU35608.1| hypothetical protein MIMGU_mgv1a022295mg, partial [Erythranthe 
guttata]
Length=447

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 167/212 (79%), Gaps = 18/212 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQV-IPEVDVCKWEPWDLPSLSVIKT  221
            + +++LP GFRFRPTD+EL++HYLR KINGRHS+V V IPEVDVCKWEPWDLP+LSVIK+
Sbjct  1    MKLESLPKGFRFRPTDEELVNHYLRLKINGRHSDVDVVIPEVDVCKWEPWDLPALSVIKS  60

Query  222  DDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKT  401
             D EWFFFCP DRKYPNGNR NRAT AGYWKATGKDR IK+ KS+   +S + LIG+KKT
Sbjct  61   GDQEWFFFCPRDRKYPNGNRSNRATEAGYWKATGKDRTIKSHKSSSLGRSTSQLIGMKKT  120

Query  402  LVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAE  569
            LVF++GRAPKGERTNWIMHEYRAT PDLDGT PGQG +VLC LF K+D++    K DE E
Sbjct  121  LVFHRGRAPKGERTNWIMHEYRATGPDLDGTGPGQGDYVLCRLFDKADEKLDYLKTDEVE  180

Query  570  PSGSSPATNKSSPDDVSSNLFQEAALLDRQPQ  665
             +              SS+LFQE+A+LD + Q
Sbjct  181  HAS-------------SSHLFQESAMLDVRMQ  199



>ref|XP_006306957.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39855.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=655

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT  GQ  +VLC LFHK  D      CD  E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTGAGQNPYVLCRLFHKPSDSCDIANCDGIEN  178

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              ++P T + SPDD SS + QE A
Sbjct  179  VNTTPTTTRCSPDDTSSEMVQETA  202



>ref|XP_006306958.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39856.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=657

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT  GQ  +VLC LFHK  D      CD  E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTGAGQNPYVLCRLFHKPSDSCDIANCDGIEN  178

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              ++P T + SPDD SS + QE A
Sbjct  179  VNTTPTTTRCSPDDTSSEMVQETA  202



>ref|XP_006306959.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
 gb|EOA39857.1| hypothetical protein CARUB_v10008529mg [Capsella rubella]
Length=658

 Score =   296 bits (757),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 159/204 (78%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT  GQ  +VLC LFHK  D      CD  E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTGAGQNPYVLCRLFHKPSDSCDIANCDGIEN  178

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              ++P T + SPDD SS + QE A
Sbjct  179  VNTTPTTTRCSPDDTSSEMVQETA  202



>ref|XP_002893753.1| ANAC014 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70012.1| ANAC014 [Arabidopsis lyrata subsp. lyrata]
Length=647

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  19   LSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  78

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  79   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKK---------LIIGMKKTL  129

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      C+E E 
Sbjct  130  VFYRGRAPRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHKPSDSCDPSNCEEIEN  189

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              S+P T + SPDD SS + QE +
Sbjct  190  VNSTPTTTRCSPDDTSSEMVQETS  213



>gb|AIU39715.1| NAC transcription factor 14 [Brassica napus]
Length=635

 Score =   294 bits (753),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 160/201 (80%), Gaps = 10/201 (5%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM++LPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  9    LSMESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  68

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  69   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK-SDDRKCDEAEPSGS  581
            VFY+GRAP+GERTNWIMHEYRAT+ DLDGT PGQ  +VLC LFHK SD   CDE E   +
Sbjct  120  VFYRGRAPRGERTNWIMHEYRATDKDLDGTGPGQSPYVLCRLFHKPSDVANCDEVENVNA  179

Query  582  SPATNKSSPDDVSSNLFQEAA  644
            +P T + S +D SS + QE A
Sbjct  180  TPTTTRCSREDNSSEMVQETA  200



>ref|XP_010478725.1| PREDICTED: uncharacterized protein LOC104757674 isoform X1 [Camelina 
sativa]
Length=660

 Score =   295 bits (755),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 13/202 (6%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            M+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTDD 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTLVF
Sbjct  61   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTLVF  111

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP+G RTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK +D      CDE E   
Sbjct  112  YRGRAPRGGRTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHKPNDSCDTANCDEIENVN  171

Query  579  SSPATNKSSPDDVSSNLFQEAA  644
            ++P T + SPDD SS + QE A
Sbjct  172  TTPTTTRCSPDDTSSEMVQETA  193



>emb|CDY66161.1| BnaCnng49700D [Brassica napus]
Length=635

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 160/201 (80%), Gaps = 10/201 (5%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM++LPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  9    LSMESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  68

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  69   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK-SDDRKCDEAEPSGS  581
            VFY+GRAP+GERTNWIMHEYRAT+ DLDGT PGQ  +VLC LFHK SD   CDE E   +
Sbjct  120  VFYRGRAPRGERTNWIMHEYRATDKDLDGTGPGQSPYVLCRLFHKPSDVANCDEVENVNA  179

Query  582  SPATNKSSPDDVSSNLFQEAA  644
            +P T + S +D SS + QE A
Sbjct  180  TPTTTRCSREDNSSEMVQETA  200



>ref|XP_010478726.1| PREDICTED: uncharacterized protein LOC104757674 isoform X2 [Camelina 
sativa]
Length=659

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 159/202 (79%), Gaps = 13/202 (6%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            M+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTDD 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTLVF
Sbjct  61   EWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTLVF  111

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP+G RTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK +D      CDE E   
Sbjct  112  YRGRAPRGGRTNWIMHEYRATDKELDGTAPGQNPYVLCRLFHKPNDSCDTANCDEIENVN  171

Query  579  SSPATNKSSPDDVSSNLFQEAA  644
            ++P T + SPDD SS + QE A
Sbjct  172  TTPTTTRCSPDDTSSEMVQETA  193



>ref|XP_009151462.1| PREDICTED: uncharacterized protein LOC103874777 [Brassica rapa]
 emb|CDY26922.1| BnaA05g17900D [Brassica napus]
Length=636

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 160/201 (80%), Gaps = 10/201 (5%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM++LPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  9    LSMESLPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  68

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  69   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK-SDDRKCDEAEPSGS  581
            VFY+GRAP+GERTNWIMHEYRAT+ DLDGT PGQ  +VLC LFHK +D   CDE E   +
Sbjct  120  VFYRGRAPRGERTNWIMHEYRATDKDLDGTGPGQSPYVLCRLFHKPTDVANCDEVENVNA  179

Query  582  SPATNKSSPDDVSSNLFQEAA  644
            +P T + S +D SS + QE A
Sbjct  180  TPTTTRCSREDNSSEMVQETA  200



>gb|KDO76787.1| hypothetical protein CISIN_1g009388mg [Citrus sinensis]
Length=536

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 171/228 (75%), Gaps = 18/228 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +SM++LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCK EPWDLP LSVI
Sbjct  1    MAVISMESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT+DPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR I++RK+          IG+K
Sbjct  61   KTEDPEWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKA-----GTNACIGMK  115

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDL--DGTRPGQGAFVLCHLFHKSDDR----KC  557
            KTLVFY+GRAPKGERTNWIMHEYR T  DL    T+P Q AFVLC LF K +++    K 
Sbjct  116  KTLVFYRGRAPKGERTNWIMHEYRPTREDLLDSSTKPSQAAFVLCRLFRKPEEKVDVLKY  175

Query  558  DEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            DE E +  SP TNKSS DD SS+L QE A+ +       VT   +LPV
Sbjct  176  DEVEQT-ESPDTNKSSLDDTSSDLVQETAMSNY------VTPNAVLPV  216



>ref|XP_006476249.1| PREDICTED: uncharacterized protein LOC102621962 [Citrus sinensis]
Length=632

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 171/228 (75%), Gaps = 18/228 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +SM++LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCK EPWDLP LSVI
Sbjct  1    MAVISMESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT+DPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR I++RK+          IG+K
Sbjct  61   KTEDPEWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKA-----GTNACIGMK  115

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDL--DGTRPGQGAFVLCHLFHKSDDR----KC  557
            KTLVFY+GRAPKGERTNWIMHEYR T  DL    T+P Q AFVLC LF K +++    K 
Sbjct  116  KTLVFYRGRAPKGERTNWIMHEYRPTREDLLDSSTKPSQAAFVLCRLFRKPEEKVDVLKY  175

Query  558  DEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            DE E +  SP TNKSS DD SS+L QE A+ D       VT   +LPV
Sbjct  176  DEVEQT-ESPDTNKSSLDDTSSDLVQETAMSDY------VTPNAVLPV  216



>gb|AAF31292.1|AC006424_21 CDS [Arabidopsis thaliana]
Length=577

 Score =   290 bits (742),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 159/205 (78%), Gaps = 14/205 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  8    LSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  68   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  118

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      C+E E 
Sbjct  119  VFYRGRAPRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHKPSDSCDPAHCEEIEK  178

Query  573  SGSSP-ATNKSSPDDVSSNLFQEAA  644
               +P  T + SPDD SS + QE A
Sbjct  179  VNFTPTTTTRCSPDDTSSEMVQETA  203



>ref|XP_010461128.1| PREDICTED: NAC domain-containing protein 86 [Camelina sativa]
Length=658

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 158/202 (78%), Gaps = 13/202 (6%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            M+ALPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCKWEPWDLP LSVIKTDD 
Sbjct  1    MEALPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCKWEPWDLPGLSVIKTDDQ  60

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP  RKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTLVF
Sbjct  61   EWFFFCPRYRKYPSGHRSNRATDIGYWKATGKDRTIKSKKV---------IIGMKKTLVF  111

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSG  578
            Y+GRAP+GERT+WIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      CDE E   
Sbjct  112  YRGRAPRGERTDWIMHEYRATDKELDGTAPGQNPYVLCRLFHKPSDSCDTANCDEIENVN  171

Query  579  SSPATNKSSPDDVSSNLFQEAA  644
            ++P T + SPDD SS + QE A
Sbjct  172  TTPTTTRCSPDDTSSEMVQETA  193



>ref|XP_006439176.1| hypothetical protein CICLE_v10019282mg [Citrus clementina]
 gb|ESR52416.1| hypothetical protein CICLE_v10019282mg [Citrus clementina]
Length=632

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 171/228 (75%), Gaps = 18/228 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +SM++LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVCK EPWDLP LSVI
Sbjct  1    MAVISMESLPLGFRFRPTDEELINHYLRLKINGRDSEVEVIPEIDVCKLEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT+DPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR I++RK+          IG+K
Sbjct  61   KTEDPEWFFFCPRDRKYPNGLRSNRATEAGYWKATGKDRTIRSRKA-----GTNACIGMK  115

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDL--DGTRPGQGAFVLCHLFHKSDDR----KC  557
            KTLVFY+GRAPKGERTNWIMHEYR T  DL    T+P Q AFVLC LF K +++    K 
Sbjct  116  KTLVFYRGRAPKGERTNWIMHEYRPTREDLLDSSTKPSQAAFVLCRLFRKPEEKVDVLKY  175

Query  558  DEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            DE E +  SP TNKSS DD SS+L QE A+ +       VT   +LPV
Sbjct  176  DEVEQT-ESPDTNKSSLDDTSSDLVQETAMSNY------VTPNAVLPV  216



>ref|NP_174582.3| protein NAC 014 [Arabidopsis thaliana]
 gb|AEE31558.1| protein NAC 014 [Arabidopsis thaliana]
Length=648

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 159/205 (78%), Gaps = 14/205 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  19   LSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  78

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  79   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  129

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      C+E E 
Sbjct  130  VFYRGRAPRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHKPSDSCDPAHCEEIEK  189

Query  573  SGSSP-ATNKSSPDDVSSNLFQEAA  644
               +P  T + SPDD SS + QE A
Sbjct  190  VNFTPTTTTRCSPDDTSSEMVQETA  214



>ref|NP_973954.1| protein NAC 014 [Arabidopsis thaliana]
 gb|ACI49788.1| At1g33060 [Arabidopsis thaliana]
 gb|AEE31559.1| protein NAC 014 [Arabidopsis thaliana]
Length=652

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 159/205 (78%), Gaps = 14/205 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSM+ALPLGFRFRPTD+ELI+HYLR KINGR  EV+VIPE+DVCKWEPWDLP LSVIKTD
Sbjct  19   LSMEALPLGFRFRPTDEELINHYLRLKINGRDLEVRVIPEIDVCKWEPWDLPGLSVIKTD  78

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT  GYWKATGKDR IK++K          +IG+KKTL
Sbjct  79   DQEWFFFCPRDRKYPSGHRSNRATDIGYWKATGKDRTIKSKKM---------IIGMKKTL  129

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY+GRAP+GERTNWIMHEYRAT+ +LDGT PGQ  +VLC LFHK  D      C+E E 
Sbjct  130  VFYRGRAPRGERTNWIMHEYRATDKELDGTGPGQNPYVLCRLFHKPSDSCDPAHCEEIEK  189

Query  573  SGSSP-ATNKSSPDDVSSNLFQEAA  644
               +P  T + SPDD SS + QE A
Sbjct  190  VNFTPTTTTRCSPDDTSSEMVQETA  214



>ref|XP_010241066.1| PREDICTED: uncharacterized protein LOC104585779 isoform X2 [Nelumbo 
nucifera]
Length=608

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 156/196 (80%), Gaps = 11/196 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ ALPLGFRFRPTD+ELI+HYLR KING+  +V+VIPEVDVCKWEPWDLP LSVI
Sbjct  5    MGVLSLGALPLGFRFRPTDEELINHYLRCKINGKEDKVRVIPEVDVCKWEPWDLPELSVI  64

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K  DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK R       S   LIG+K
Sbjct  65   KNGDPEWFFFSPRDRKYPNGHRSNRATEAGYWKATGKDRTIKART------SGMHLIGMK  118

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAP G+RTNWIMHEYRATE +LDGT PGQGAFVLC LF KSD R     CDE
Sbjct  119  KTLVFYRGRAPNGQRTNWIMHEYRATEEELDGTHPGQGAFVLCRLFKKSDVRIEHSNCDE  178

Query  564  AEPSGSSPATNKSSPD  611
             + +GSSP T +SSP+
Sbjct  179  IDRTGSSP-TARSSPE  193



>ref|XP_010241065.1| PREDICTED: uncharacterized protein LOC104585779 isoform X1 [Nelumbo 
nucifera]
Length=609

 Score =   289 bits (740),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 156/196 (80%), Gaps = 11/196 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ ALPLGFRFRPTD+ELI+HYLR KING+  +V+VIPEVDVCKWEPWDLP LSVI
Sbjct  5    MGVLSLGALPLGFRFRPTDEELINHYLRCKINGKEDKVRVIPEVDVCKWEPWDLPELSVI  64

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K  DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK R       S   LIG+K
Sbjct  65   KNGDPEWFFFSPRDRKYPNGHRSNRATEAGYWKATGKDRTIKART------SGMHLIGMK  118

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY+GRAP G+RTNWIMHEYRATE +LDGT PGQGAFVLC LF KSD R     CDE
Sbjct  119  KTLVFYRGRAPNGQRTNWIMHEYRATEEELDGTHPGQGAFVLCRLFKKSDVRIEHSNCDE  178

Query  564  AEPSGSSPATNKSSPD  611
             + +GSSP T +SSP+
Sbjct  179  IDRTGSSP-TARSSPE  193



>ref|XP_010660382.1| PREDICTED: uncharacterized protein LOC104877280 [Vitis vinifera]
 emb|CBI34627.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 162/210 (77%), Gaps = 14/210 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+ELI+HYL+ KI GRHSEV+VI E+DVCKWEPWDLP LS+I
Sbjct  1    MGAVSMESLPLGFRFRPTDEELINHYLKLKIEGRHSEVEVIRELDVCKWEPWDLPGLSMI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K DDPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR IK+RKS+ S       IG+K
Sbjct  61   KADDPEWFFFCPRDRKYPNGRRSNRATDAGYWKATGKDRTIKSRKSSAS-------IGMK  113

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFYKGRAPKG+RTNWI HEYR  +   D +   QGA+VL  LF+K ++R    K DE
Sbjct  114  KTLVFYKGRAPKGQRTNWIFHEYRVIDSASDSS---QGAYVLFRLFYKPNERIDNPKYDE  170

Query  564  AEPSGSSPATNKSSPDDVSSNLFQEAALLD  653
             EP+G SP T KSSP D SS+L QE  + D
Sbjct  171  VEPTGLSPVTTKSSPGDTSSDLVQETEMSD  200



>ref|XP_010542182.1| PREDICTED: uncharacterized protein LOC104815470 [Tarenaya hassleriana]
Length=668

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 160/204 (78%), Gaps = 13/204 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS+++LPLGFRFRPTD+ELI+HYLR KINGR SEV+VIPE+DVC+WEPWDLP LSVIKTD
Sbjct  16   LSIESLPLGFRFRPTDEELINHYLRLKINGRDSEVRVIPEIDVCRWEPWDLPGLSVIKTD  75

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EWFFFCP DRKYP+G+R NRAT +GYWKATGKDR I+++K+          +G+KKTL
Sbjct  76   DQEWFFFCPRDRKYPSGHRSNRATDSGYWKATGKDRTIRSKKTA---------VGMKKTL  126

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY+GRAP+ ERT+WIMHEYRAT+ DLDG  PGQ  +VLC LFHK  D      CDE E 
Sbjct  127  VFYRGRAPRAERTSWIMHEYRATDKDLDGYGPGQNPYVLCRLFHKPSDCCGTANCDELEN  186

Query  573  SGSSPATNKSSPDDVSSNLFQEAA  644
              S+PA+ KS PDD S  + QE A
Sbjct  187  DKSTPASPKSIPDDTSPEMVQETA  210



>ref|XP_009351898.1| PREDICTED: uncharacterized protein LOC103943342 [Pyrus x bretschneideri]
Length=546

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 153/203 (75%), Gaps = 13/203 (6%)
 Frame = +3

Query  30   AGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLS  209
            A M  LSMD+LPLGFRFRPTD+ELI +YLR KING H +V VI E+DVCKWEPWDLP LS
Sbjct  4    ADMETLSMDSLPLGFRFRPTDEELIDYYLRSKINGNHGQVAVIREIDVCKWEPWDLPGLS  63

Query  210  VIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIG  389
            VI+T DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK+ K          LIG
Sbjct  64   VIQTTDPEWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDKI---------LIG  114

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKC  557
            +KKTLVF+ GRAPKG+RTNW+MHEYR T+ +LDGT PGQ +FVLC LF K D    D   
Sbjct  115  MKKTLVFHTGRAPKGKRTNWVMHEYRTTQKELDGTNPGQSSFVLCRLFKKQDETIEDSNF  174

Query  558  DEAEPSGSSPATNKSSPDDVSSN  626
            DEAEP+ SS     SSP DV S+
Sbjct  175  DEAEPTVSSSTAALSSPQDVQSD  197



>ref|XP_008381552.1| PREDICTED: uncharacterized protein LOC103444404 [Malus domestica]
Length=554

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 153/203 (75%), Gaps = 13/203 (6%)
 Frame = +3

Query  30   AGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLS  209
            A M  LSMD+LPLGFRFRPTD+ELI +YLR KING H +V VI E+DVCKWEPWDLP LS
Sbjct  4    ADMETLSMDSLPLGFRFRPTDEELIDYYLRSKINGNHGQVAVIREIDVCKWEPWDLPDLS  63

Query  210  VIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIG  389
            VI+T DP+WFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK+ K          LIG
Sbjct  64   VIQTTDPQWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDKI---------LIG  114

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKC  557
            +KKTLVF+ GRAPKG+RTNW+MHEYR T+ +LDGT PGQ +FVLC LF K D    D   
Sbjct  115  MKKTLVFHTGRAPKGKRTNWVMHEYRTTQKELDGTNPGQSSFVLCRLFKKQDETIEDLNF  174

Query  558  DEAEPSGSSPATNKSSPDDVSSN  626
            DEAEP+ SS     SSP DV S+
Sbjct  175  DEAEPTVSSSTAALSSPQDVQSD  197



>ref|XP_002317831.2| hypothetical protein POPTR_0012s00760g [Populus trichocarpa]
 gb|EEE96051.2| hypothetical protein POPTR_0012s00760g [Populus trichocarpa]
Length=608

 Score =   281 bits (718),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 166/223 (74%), Gaps = 18/223 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            L++++LPLGFRFRP+D+EL+++YLR KING+  +V+VI E+DVCKWEPWDLP LS+I+  
Sbjct  6    LNLNSLPLGFRFRPSDEELVNYYLRHKINGKDDKVRVIREIDVCKWEPWDLPGLSIIENK  65

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCPLDRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+KKTL
Sbjct  66   DPEWFFFCPLDRKYPNGSRQNRATNAGYWKATGKDRKIK---------SGNRLIGMKKTL  116

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY GRAPKG+RTNW++HEYRATE +LDGT+PGQ AFVLC LF K D+      CDEAE 
Sbjct  117  VFYTGRAPKGKRTNWVVHEYRATEEELDGTKPGQSAFVLCRLFKKQDESIESPNCDEAEA  176

Query  573  SGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            + SSP T +SSP+   S    +  L +  P     TS V+ PV
Sbjct  177  TISSPTTAQSSPEVTQS----DQPLTEASPANT-TTSEVVAPV  214



>ref|XP_006404132.1| hypothetical protein EUTSA_v10010340mg [Eutrema salsugineum]
 gb|ESQ45585.1| hypothetical protein EUTSA_v10010340mg [Eutrema salsugineum]
Length=470

 Score =   277 bits (708),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 160/222 (72%), Gaps = 14/222 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS+D+LP+G RFRPTDQEL+  YLRRKING  ++V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSLDSLPVGLRFRPTDQELVRFYLRRKINGHDNDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR I+      SD+ N  +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIR------SDKDN--IIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD------DRKCDEA  566
            VF+ GRAPKG RTNWI+HEYRATE DL GT PGQ  FV+C LF K D      D K DEA
Sbjct  120  VFHSGRAPKGTRTNWIIHEYRATEKDLSGTNPGQSPFVICKLFKKQDLSLAEEDSKLDEA  179

Query  567  EPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVM  692
            EP+ SSPA   SSPDD  S +   A   D +      +S+V+
Sbjct  180  EPAVSSPAVAASSPDDTKSEVSMVAKTEDVKRCDIAESSLVI  221



>ref|XP_004156529.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
 gb|KGN53626.1| hypothetical protein Csa_4G091920 [Cucumis sativus]
Length=606

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 152/195 (78%), Gaps = 13/195 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L++++LPLGFRFRPTD+ELI +YLR KING H +V VI EVDVCKWEPWDLP LS+I
Sbjct  1    MAVLTLNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSII  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT DPEWFFFCP DRKYPNG+R  RAT AGYWKATGKDR IK         S T LIG+K
Sbjct  61   KTKDPEWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIK---------SGTKLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFYKGRAPKG+RTNW++HEYRAT  +LDGT PGQ AFVLC LF K D+       DE
Sbjct  112  KTLVFYKGRAPKGKRTNWVVHEYRATLKELDGTNPGQSAFVLCRLFKKQDESIEGSNGDE  171

Query  564  AEPSGSSPATNKSSP  608
            AE + SSP T +SSP
Sbjct  172  AEAAISSPTTAESSP  186



>ref|XP_004137298.1| PREDICTED: NAC domain-containing protein 74-like [Cucumis sativus]
Length=596

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 152/195 (78%), Gaps = 13/195 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L++++LPLGFRFRPTD+ELI +YLR KING H +V VI EVDVCKWEPWDLP LS+I
Sbjct  1    MAVLTLNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSII  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT DPEWFFFCP DRKYPNG+R  RAT AGYWKATGKDR IK         S T LIG+K
Sbjct  61   KTKDPEWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIK---------SGTKLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFYKGRAPKG+RTNW++HEYRAT  +LDGT PGQ AFVLC LF K D+       DE
Sbjct  112  KTLVFYKGRAPKGKRTNWVVHEYRATLKELDGTNPGQSAFVLCRLFKKQDESIEGSNGDE  171

Query  564  AEPSGSSPATNKSSP  608
            AE + SSP T +SSP
Sbjct  172  AEAAISSPTTAESSP  186



>ref|XP_008462914.1| PREDICTED: NAC domain-containing protein 74 [Cucumis melo]
Length=597

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 151/195 (77%), Gaps = 13/195 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L++++LPLGFRFRPTD+ELI +YLR KING H +V VI EVDVCKWEPWDLP LS+I
Sbjct  1    MAVLTLNSLPLGFRFRPTDEELIDYYLRSKINGNHEDVSVIREVDVCKWEPWDLPDLSII  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT DPEWFFFCP DRKYPNG+R  RAT AGYWKATGKDR IK         S T LIG+K
Sbjct  61   KTKDPEWFFFCPQDRKYPNGHRLKRATVAGYWKATGKDRKIK---------SGTKLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFYKGRAPKG+RTNW++HEYR T  +LDGT PGQ AFVLC LF K D+       DE
Sbjct  112  KTLVFYKGRAPKGKRTNWVVHEYRTTLKELDGTNPGQSAFVLCRLFKKQDESIEGSNGDE  171

Query  564  AEPSGSSPATNKSSP  608
            AE + SSP T +SSP
Sbjct  172  AEAAISSPTTAESSP  186



>ref|XP_011043746.1| PREDICTED: uncharacterized protein LOC105139114 [Populus euphratica]
Length=608

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 154/193 (80%), Gaps = 13/193 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            L++++LPLGFRFRP+D+EL+++YLR KING+  +V+VI  +DVCKWEPWDLP LS+IK  
Sbjct  6    LNLNSLPLGFRFRPSDEELVNYYLRHKINGKDDKVKVIRGIDVCKWEPWDLPVLSIIKNK  65

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCPLDRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+KKTL
Sbjct  66   DPEWFFFCPLDRKYPNGSRQNRATDAGYWKATGKDRKIK---------SGNRLIGMKKTL  116

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEP  572
            VFY GRAPKG+RTNW+MHEYRATE +LDGT+PGQ AFVLC LF K D+      C+EAE 
Sbjct  117  VFYTGRAPKGKRTNWVMHEYRATEEELDGTKPGQSAFVLCRLFKKQDESIESPNCNEAEA  176

Query  573  SGSSPATNKSSPD  611
            + SSP T +SSP+
Sbjct  177  TVSSPTTAQSSPE  189



>ref|XP_002518952.1| transcription factor, putative [Ricinus communis]
 gb|EEF43485.1| transcription factor, putative [Ricinus communis]
Length=615

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 157/218 (72%), Gaps = 27/218 (12%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L M++LPLGFRFRPTD+ELI+HYLR KINGR SEV VI EVDVCKWEPWDLP LSVI
Sbjct  1    MAVLHMESLPLGFRFRPTDEELINHYLRLKINGRDSEVDVISEVDVCKWEPWDLPGLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KTDDPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR I+ RKS     SN   IG+K
Sbjct  61   KTDDPEWFFFCPRDRKYPNGQRSNRATDAGYWKATGKDRTIRARKSG----SNPICIGMK  116

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            KTLVFY+GRAPKGERTNWIMHEYR T  DLDG+ PGQ                      +
Sbjct  117  KTLVFYRGRAPKGERTNWIMHEYRPTLKDLDGSAPGQ---------------------QT  155

Query  576  GSSPATNKSSPDDVSSNLFQ--EAALLDRQPQKANVTS  683
            G SP T+KSSPDD SS++ Q  E +++    Q   +TS
Sbjct  156  GYSPTTSKSSPDDTSSDIVQETETSVMQVGKQSEGITS  193



>ref|XP_010525539.1| PREDICTED: NAC domain-containing protein 67-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010525540.1| PREDICTED: NAC domain-containing protein 67-like isoform X2 [Tarenaya 
hassleriana]
Length=464

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 162/226 (72%), Gaps = 14/226 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  L +D+LP+G RFRPTD+EL+ +YLR KING   +V++I EVD+CKWEPWDLP LSV+
Sbjct  1    MEDLLLDSLPVGLRFRPTDEELVRYYLRLKINGHDDDVRIIREVDICKWEPWDLPDLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR +K+ K++        +IG+K
Sbjct  61   KTKDSEWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRNVKSVKNS--------IIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD------DRKC  557
            +TLVFY GRAPKG RT W+MHEYRATE DLDG +PGQ  FV+C LF K D      D K 
Sbjct  113  RTLVFYTGRAPKGTRTCWVMHEYRATEKDLDGMKPGQSPFVICKLFKKQDENPTAEDSKS  172

Query  558  DEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVML  695
            DE E   SSPA  KSS D+  S+  +     +R+P + + +S+V +
Sbjct  173  DEVETLVSSPAIAKSSADESKSDESRALETCERKPFEVSESSLVAI  218



>ref|XP_002321956.2| hypothetical protein POPTR_0015s00640g [Populus trichocarpa]
 gb|EEF06083.2| hypothetical protein POPTR_0015s00640g [Populus trichocarpa]
Length=588

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 164/228 (72%), Gaps = 21/228 (9%)
 Frame = +3

Query  36   MSGLSMD--ALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLS  209
            M+ LSM+  +LPLGFRFRP+D+EL+ +YLR KING    V+VI E+DVCKWEPWDLP LS
Sbjct  1    MAVLSMNFNSLPLGFRFRPSDKELVDYYLRLKINGDDDGVKVIREIDVCKWEPWDLPDLS  60

Query  210  VIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIG  389
            +IK  DPEWFFFCPLDRKYPNG+R NRAT AGYWKATG DR IK         S   LIG
Sbjct  61   IIKNKDPEWFFFCPLDRKYPNGSRQNRATNAGYWKATGNDRKIK---------SGNNLIG  111

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KC  557
            +KKTLVFY GRAPKG+RTNW+MHEYRATE +LDGT+PGQ +FVL  LF K D+      C
Sbjct  112  MKKTLVFYTGRAPKGKRTNWVMHEYRATEEELDGTKPGQSSFVLSRLFKKQDESIESLNC  171

Query  558  DEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            DEAE + SSP   +SSP+   S    +  L++  P  AN TS V  PV
Sbjct  172  DEAEATVSSPTMVQSSPEVTQS----DQPLIEASP--ANTTSEVGAPV  213



>ref|XP_010519577.1| PREDICTED: NAC domain-containing protein 67-like [Tarenaya hassleriana]
Length=488

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 159/221 (72%), Gaps = 20/221 (9%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+G RFRPTD+EL+ +YLR KING   +V++I EVD+CKWEPWDLP +SV+
Sbjct  1    MEVLSLDSLPVGLRFRPTDEELVRYYLRMKINGHDDDVRIIREVDICKWEPWDLPDMSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK+         N  +IG+K
Sbjct  61   KTKDSEWLFFCPLDRKYPNGSRMNRATVAGYWKATGKDRKIKS--------VNKNIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK-------SDDRK  554
            +TLVFY GRAPKG RT W+MHEYRATE DL GT PGQ  FV+C LF K       ++D K
Sbjct  113  RTLVFYTGRAPKGARTCWVMHEYRATEKDLAGTNPGQNPFVICKLFKKQQDENATAEDSK  172

Query  555  CDEAEPSGSSPATNKSSPDDV-SSNLFQEAAL----LDRQP  662
             DE EP+ SSP   KSS D++ S N   E +L    LDR+P
Sbjct  173  SDEVEPAISSPTFAKSSADELKSENELSEVSLAPETLDRKP  213



>gb|AIA57510.1| NAC domain-containing protein [Boehmeria nivea]
Length=502

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 149/202 (74%), Gaps = 14/202 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            MS LS+++LPLGFRFRPTD+EL+ +YLR KING   +V VI E+DVCKWEPWDLP LS I
Sbjct  6    MSVLSLNSLPLGFRFRPTDEELVDYYLRFKINGVDEQVSVIREIDVCKWEPWDLPDLSYI  65

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
             T D EWFFFCP DRKYPNGNR NRAT  GYWKATGKDR IK         S T  IG+K
Sbjct  66   PTRDHEWFFFCPQDRKYPNGNRLNRATSKGYWKATGKDRKIK---------SGTREIGMK  116

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY GRAPKG RT W+MHEYRAT  +L GT PGQ  FVLC LF K DD      CDE
Sbjct  117  KTLVFYTGRAPKGTRTYWVMHEYRATLKELSGTNPGQSPFVLCRLFKKHDDTVEALNCDE  176

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
             EP+ SSP T+KSSP+D  S+L
Sbjct  177  VEPTVSSP-TSKSSPEDAESDL  197



>ref|XP_011470170.1| PREDICTED: NAC domain-containing protein 86 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 150/200 (75%), Gaps = 13/200 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +S+ +LPLGFRFRPTD+ELI  YLR KINGR  EV VI E+DVC+WEPWDLP LSVI
Sbjct  5    MGVVSLSSLPLGFRFRPTDEELIEFYLRSKINGRDKEVSVIREIDVCRWEPWDLPDLSVI  64

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T DPEWFFFCP D+KYPNG R NRAT AGYWKATGKDR IK         S   L+G+K
Sbjct  65   QTQDPEWFFFCPQDKKYPNGFRLNRATIAGYWKATGKDRRIK---------SGANLVGMK  115

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVF+KGRAPKG+RTNW+MHEYRAT+ +LDGT PGQ  FVLC LF K D+      CDE
Sbjct  116  KTLVFHKGRAPKGKRTNWVMHEYRATQKELDGTNPGQSPFVLCRLFKKQDESIEISNCDE  175

Query  564  AEPSGSSPATNKSSPDDVSS  623
             EP+ SSP+  KS  +D  S
Sbjct  176  TEPAVSSPSIVKSPLEDTQS  195



>ref|XP_008234624.1| PREDICTED: NAC domain-containing protein 7-like [Prunus mume]
Length=548

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 148/201 (74%), Gaps = 13/201 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS + LPLGFRFRPTD+ELI +YLR KING H +V VI E+DVCKWEPWDLP LSVI
Sbjct  6    MTVLSTNTLPLGFRFRPTDEELIDYYLRSKINGNHKQVTVIREIDVCKWEPWDLPDLSVI  65

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S T LIG+K
Sbjct  66   RTTDPEWFFFCPQDRKYPNGHRLNRATGRGYWKATGKDRQIK---------SATILIGMK  116

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCDE  563
            KTLVF+ GRAPKG+RTNW+MHEYR T+ +LDGT PGQ  FVLC LF K D    D    E
Sbjct  117  KTLVFHTGRAPKGKRTNWVMHEYRTTQKELDGTNPGQNPFVLCRLFKKQDETIEDSNLAE  176

Query  564  AEPSGSSPATNKSSPDDVSSN  626
             EP+ SSP    SSP D  S+
Sbjct  177  VEPTVSSPTAAISSPQDTQSD  197



>ref|XP_006441278.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54518.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=510

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>gb|ACU23644.1| unknown [Glycine max]
Length=603

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 151/199 (76%), Gaps = 13/199 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            +S+D+LPLGFRFRPTD+EL+++YLR+KING   EV VI E+DVCKWEPWD+P LSV++T 
Sbjct  17   VSLDSLPLGFRFRPTDEELVNYYLRQKINGNGREVWVIREIDVCKWEPWDMPGLSVVQTK  76

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S T LIG+KKTL
Sbjct  77   DPEWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRKIK---------SGTILIGMKKTL  127

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+      CDEAEP
Sbjct  128  VFYTGRAPKGNRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLEVSHCDEAEP  187

Query  573  SGSSPATNKSSPDDVSSNL  629
            + S+P     S +++ S+L
Sbjct  188  TASTPVAAYYSTEEIQSDL  206



>ref|XP_006441281.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54521.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=509

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|NP_001276211.1| uncharacterized LOC100777071 [Glycine max]
 gb|AGO14649.1| NAC transcription factor [Glycine max]
Length=604

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 151/199 (76%), Gaps = 13/199 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            +S+D+LPLGFRFRPTD+EL+++YLR+KING   EV VI E+DVCKWEPWD+P LSV++T 
Sbjct  17   VSLDSLPLGFRFRPTDEELVNYYLRQKINGNGREVWVIREIDVCKWEPWDMPGLSVVQTK  76

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S T LIG+KKTL
Sbjct  77   DPEWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRKIK---------SGTILIGMKKTL  127

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+      CDEAEP
Sbjct  128  VFYTGRAPKGNRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLEVSHCDEAEP  187

Query  573  SGSSPATNKSSPDDVSSNL  629
            + S+P     S +++ S+L
Sbjct  188  TASTPVAAYYSTEEIQSDL  206



>ref|NP_001280863.1| uncharacterized LOC103439966 [Malus domestica]
 gb|ADL36794.1| NAC domain class transcription factor [Malus domestica]
Length=541

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 152/202 (75%), Gaps = 13/202 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LSM++LPLGFRFRPTD ELI +YLR KING H +V VI E+DVCK EPWDLP LSVI
Sbjct  1    MEVLSMNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK+ K          LIG+K
Sbjct  61   QTTDPEWFFFCPQDRKYPNGHRLNRATIRGYWKATGKDRQIKSDKI---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCDE  563
            KTLVF+ GRAPKG+RTNW+MHEYRAT+ +LDGT PGQ +FVLC LF K D    D   DE
Sbjct  112  KTLVFHIGRAPKGKRTNWVMHEYRATQKELDGTNPGQSSFVLCRLFKKQDETIEDSNFDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AEP+ SS     SSP DV S+L
Sbjct  172  AEPTASSSIAVVSSPQDVQSDL  193



>gb|KDO44488.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=604

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|XP_006441280.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54520.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=604

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>gb|KDO44489.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=605

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|XP_006441279.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
 gb|ESR54519.1| hypothetical protein CICLE_v10019368mg [Citrus clementina]
Length=605

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATADDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|XP_006478082.1| PREDICTED: NAC domain-containing protein 69-like isoform X3 [Citrus 
sinensis]
Length=604

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|XP_006478081.1| PREDICTED: NAC domain-containing protein 69-like isoform X2 [Citrus 
sinensis]
Length=605

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|XP_006478080.1| PREDICTED: NAC domain-containing protein 69-like isoform X1 [Citrus 
sinensis]
Length=610

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 147/191 (77%), Gaps = 11/191 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+K
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGKDRKIK---------SGNHLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
            KTLVF+ GRAPKG+RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  112  KTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  171

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  172  PSESSPTSARS  182



>ref|XP_004502779.1| PREDICTED: uncharacterized protein LOC101492664 [Cicer arietinum]
Length=612

 Score =   270 bits (691),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 152/202 (75%), Gaps = 13/202 (6%)
 Frame = +3

Query  33   GMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSV  212
            GM+ LS+++LPLGFRFRPTD+ELI +YLR+KING   EV VI E+DVCKWEPWD+P LSV
Sbjct  14   GMAVLSLNSLPLGFRFRPTDEELIDYYLRQKINGNGDEVWVIREIDVCKWEPWDMPDLSV  73

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+  DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S T LIG+
Sbjct  74   IRNKDPEWFFFCPQDRKYPNGHRLNRATTHGYWKATGKDRKIK---------SGTILIGM  124

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ A+VLC LF K+D+      C 
Sbjct  125  KKTLVFYSGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNAYVLCRLFKKNDESLEVSNCG  184

Query  561  EAEPSGSSPATNKSSPDDVSSN  626
            E E + S+P     SP+++ S+
Sbjct  185  EVEQTTSAPMAANYSPEEIQSD  206



>ref|XP_007136363.1| hypothetical protein PHAVU_009G039000g [Phaseolus vulgaris]
 gb|ESW08357.1| hypothetical protein PHAVU_009G039000g [Phaseolus vulgaris]
Length=587

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 13/202 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            ++ +S+D+LPLGFRFRPTD+ELI +YLR+KING  +EV VI E+DVCKWEPWD+P LSV+
Sbjct  14   VAAVSLDSLPLGFRFRPTDEELIDYYLRQKINGNGAEVWVIREIDVCKWEPWDMPDLSVV  73

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +  DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  74   RNKDPEWFFFCPQDRKYPNGHRLNRATTHGYWKATGKDRRIK---------SGMMLIGMK  124

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ A+VLC LF K D+      CDE
Sbjct  125  KTLVFYTGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNAYVLCRLFKKHDESLEVSHCDE  184

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AE + S+P     S +++ S L
Sbjct  185  AEQTASTPIAANYSTEEIQSGL  206



>ref|XP_009361256.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Pyrus 
x bretschneideri]
Length=541

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 150/202 (74%), Gaps = 13/202 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LSM++LPLGFRFRPTD ELI +YLR KING H +V VI E+DVCK EPWDLP LSVI
Sbjct  1    MEVLSMNSLPLGFRFRPTDAELIDYYLRSKINGNHRQVAVIREIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK+ K          LIG+K
Sbjct  61   QTTDPEWFFFCPQDRKYPNGHRLNRATIKGYWKATGKDRQIKSDKI---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCDE  563
            KTLVF+ GRAPKG+RTNW+MHEYR T+ +LDGT PGQ +FVLC LF K D    D   DE
Sbjct  112  KTLVFHTGRAPKGKRTNWVMHEYRTTQKELDGTNPGQSSFVLCRLFKKQDETIEDSNFDE  171

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AEP+ SS     SSP DV S L
Sbjct  172  AEPTVSSSIAVASSPLDVQSGL  193



>ref|XP_006291082.1| hypothetical protein CARUB_v10017199mg [Capsella rubella]
 gb|EOA23980.1| hypothetical protein CARUB_v10017199mg [Capsella rubella]
Length=460

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 144/192 (75%), Gaps = 14/192 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSMD+LP+G RFRPTD+ELI +YLR+KING   +V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSMDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IKT K        T +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKTSK--------TNIIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS------DDRKCDEA  566
            VF+ GRAPKG RTNW++HEYRATE DL GT PGQ  FV+C LF K       +D K DEA
Sbjct  120  VFHAGRAPKGTRTNWVIHEYRATENDLSGTNPGQSPFVICKLFKKQELNLAEEDSKSDEA  179

Query  567  EPSGSSPATNKS  602
            EP+ SSP    S
Sbjct  180  EPAVSSPTVEVS  191



>gb|AIS36140.1| NAC transcription factor 91-2 [Brassica napus]
Length=456

 Score =   265 bits (676),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 153/215 (71%), Gaps = 25/215 (12%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+GFRF PTD+EL+ +YLR+KINGR  EV+VI EVD+CK EPWDLP LSV+
Sbjct  1    MEVLSLDSLPVGFRFSPTDEELVHYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCP+DRKYP+G R NRAT AGYWKATGKDR +KT K          +IG+K
Sbjct  61   KTTDSEWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKK---------IIGVK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-----DRKCD  560
            +TLVFYKGRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     D K  
Sbjct  112  RTLVFYKGRAPKGTRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDVVHPEDLKSC  171

Query  561  EAEPSGSSPA-----------TNKSSPDDVSSNLF  632
            E EP+ SSP            T ++ P DV+ + F
Sbjct  172  EMEPAVSSPTDVSEVSLAFPKTEETKPSDVAESSF  206



>ref|XP_007039234.1| NAC domain class transcription factor, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23735.1| NAC domain class transcription factor, putative isoform 2 [Theobroma 
cacao]
Length=496

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 162/223 (73%), Gaps = 22/223 (10%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++LP+GFRFRPTD+ELI  YLR KING R  EV VI E+DVCKWEPWDLP LS 
Sbjct  1    MAALSLNSLPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I T DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IATRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSSLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C LF K D    D   D
Sbjct  112  KKTLVFYTGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRLFKKDDETIEDINGD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLF--QEAALLDRQPQKANVTS  683
            E +P+  +PA      +D+ S L   Q++ +++ + +K  V+S
Sbjct  172  EVDPALLTPA------EDMQSELVVPQDSPVVEGEAEKLPVSS  208



>emb|CDX80455.1| BnaC07g29890D [Brassica napus]
Length=456

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 153/215 (71%), Gaps = 25/215 (12%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+GFRF PTD+EL+ +YLR+KINGR  EV+VI EVD+CK EPWDLP LSV+
Sbjct  1    MEVLSLDSLPVGFRFSPTDEELVHYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCP+DRKYP+G R NRAT AGYWKATGKDR +KT K          +IG+K
Sbjct  61   KTTDSEWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKK---------IIGVK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-----DRKCD  560
            +TLVFYKGRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     D K  
Sbjct  112  RTLVFYKGRAPKGTRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDVVHPEDLKSC  171

Query  561  EAEPSGSSPA-----------TNKSSPDDVSSNLF  632
            E EP+ SSP            T ++ P DV+ + F
Sbjct  172  EMEPAVSSPTDVSEVSLAFPKTEETKPSDVAESSF  206



>ref|XP_007039233.1| NAC domain class transcription factor, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23734.1| NAC domain class transcription factor, putative isoform 1 [Theobroma 
cacao]
Length=576

 Score =   267 bits (683),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 162/223 (73%), Gaps = 22/223 (10%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++LP+GFRFRPTD+ELI  YLR KING R  EV VI E+DVCKWEPWDLP LS 
Sbjct  1    MAALSLNSLPVGFRFRPTDEELIDFYLRSKINGNRTDEVGVIREIDVCKWEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I T DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IATRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSSLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C LF K D    D   D
Sbjct  112  KKTLVFYTGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRLFKKDDETIEDINGD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLF--QEAALLDRQPQKANVTS  683
            E +P+  +PA      +D+ S L   Q++ +++ + +K  V+S
Sbjct  172  EVDPALLTPA------EDMQSELVVPQDSPVVEGEAEKLPVSS  208



>ref|XP_010503613.1| PREDICTED: NAC domain-containing protein 19-like [Camelina sativa]
Length=455

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 152/211 (72%), Gaps = 17/211 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSMD+LP+G RFRPTD+ELI +YLR+KING   +V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSMDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK  K        T +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGK--------TKIIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS------DDRKCDEA  566
            VF+ GRAPKG RTNW++HEYRATE DL GT PGQ  FV+C LF K       +D K DEA
Sbjct  120  VFHAGRAPKGTRTNWVIHEYRATENDLSGTNPGQSPFVICKLFKKQELNLAEEDSKSDEA  179

Query  567  EPSGSSP---ATNKSSPDDVSSNLFQEAALL  650
            EP+ SSP    +  S  +DV      E++L+
Sbjct  180  EPAVSSPTVEVSEVSKTEDVKPYDIAESSLV  210



>emb|CDY05939.1| BnaC08g21160D [Brassica napus]
Length=463

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 150/202 (74%), Gaps = 15/202 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            L++D+LP+G RFRPTD+EL+S YL+RKING   +V  I E+D+CKWEPWDLP  SVIKT+
Sbjct  11   LTLDSLPVGLRFRPTDEELVSFYLQRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTN  70

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK+ KS+        +IG+K+TL
Sbjct  71   DSEWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKSS--------IIGLKRTL  122

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK------SDDRKCDE-  563
            VF+ GRAPKG RTNWIMHEYRATE DL GT PGQ  FV+C LF K       +D K DE 
Sbjct  123  VFHSGRAPKGTRTNWIMHEYRATEDDLSGTNPGQSPFVICKLFKKPELGLADEDSKLDEA  182

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            A+    SPA   SSPD+  S++
Sbjct  183  ADQDVLSPAGATSSPDETRSHV  204



>ref|XP_003615518.1| NAC domain protein [Medicago truncatula]
Length=392

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            ++ LS++ LPLGFRFRPTD+EL+  YLR KING   EV VI EVDVCK+EPWDLP LS++
Sbjct  17   LAVLSLNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIV  76

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +  DPEWFFFCP+DRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  77   RNKDPEWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIK---------SGATLIGMK  127

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFY GRAPKG+RT+WIMHEYR T  +LDGT PGQ  +VLC LF K D+      C E
Sbjct  128  KTLVFYAGRAPKGQRTHWIMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLASSNCGE  187

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AE + S+P T   SP+++ S+L
Sbjct  188  AEQTTSTPTTANYSPEEIQSDL  209



>ref|XP_010426468.1| PREDICTED: NAC domain-containing protein 74 [Camelina sativa]
Length=453

 Score =   263 bits (671),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 143/192 (74%), Gaps = 14/192 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSMD+LP+G RFRPTD+ELI +YLR+KING   +V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSMDSLPVGLRFRPTDEELIRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK  K        T +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGK--------TKIIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS------DDRKCDEA  566
            VF+ GRAPKG RTNW++HEYRATE DL GT PGQ  FV+C LF K       +D K DEA
Sbjct  120  VFHAGRAPKGTRTNWVIHEYRATENDLSGTNPGQSPFVVCKLFKKQELNLAEEDSKSDEA  179

Query  567  EPSGSSPATNKS  602
            EP+ SSP    S
Sbjct  180  EPAVSSPTVEVS  191



>gb|AES72662.2| M20/M25/M40 family peptidase [Medicago truncatula]
Length=312

 Score =   258 bits (660),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 146/204 (72%), Gaps = 13/204 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LPLGFRFRPTD+ELI +YLR KING   EVQVI E+DVCKWEPWD+P LSVI
Sbjct  100  MVTLSLISLPLGFRFRPTDEELIDYYLRLKINGNGDEVQVIREIDVCKWEPWDMPDLSVI  159

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K +DPEWFFFCP DR+YPNGNR NR T  GYWKATGKDR IK         S T LIG+K
Sbjct  160  KDNDPEWFFFCPQDRQYPNGNRLNRETNHGYWKATGKDRKIK---------SGTILIGMK  210

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFY  RAP G R+NW+MHEYR T  +LDGT PGQ A+VLC LF K+D+      C E
Sbjct  211  KTLVFYISRAPNGRRSNWVMHEYRPTLEELDGTNPGQKAYVLCRLFKKNDESLEVSNCGE  270

Query  564  AEPSGSSPATNKSSPDDVSSNLFQ  635
             E + S+P   +S P  ++ +  Q
Sbjct  271  GEQTNSAPEELQSDPAPITVSTSQ  294



>gb|AGL39710.1| NAC transcription factor 054 [Jatropha curcas]
 gb|KDP37577.1| hypothetical protein JCGZ_08268 [Jatropha curcas]
Length=573

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 153/201 (76%), Gaps = 12/201 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +S+++LPLGFRFRPTD+EL+++YLR KING   EV+VI E+DVCKWEPWDLP LS I
Sbjct  1    MAVMSLNSLPLGFRFRPTDEELVNYYLRLKINGNDREVRVIRELDVCKWEPWDLPDLSNI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T+D EWFFFCPLDRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  61   QTNDQEWFFFCPLDRKYPNGHRLNRATSKGYWKATGKDRKIK---------SGNNLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR---KCDEA  566
            KTLVFY GRAP+G+RT+W++HEYRATE +LDGT+PGQ  FV+C LF K DD      +E 
Sbjct  112  KTLVFYTGRAPRGKRTHWVIHEYRATEDELDGTKPGQSPFVICRLFKKQDDTVDLNLEEP  171

Query  567  EPSGSSPATNKSSPDDVSSNL  629
            E + SSP   +SSP+   S L
Sbjct  172  EATLSSPTAVQSSPEVTESEL  192



>emb|CDX88115.1| BnaA06g27060D [Brassica napus]
Length=443

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 152/213 (71%), Gaps = 25/213 (12%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+GFRF PTD+EL+ +YLR+KINGR  EV+VI EVD+CK EPWDLP LSV+
Sbjct  1    MEVLSLDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCP+DRKYP+G R NRAT AGYWKATGKDR +KT K          +IG+K
Sbjct  61   KTTDAEWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKK---------IIGVK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-----DRKCD  560
            +TLVFYKGRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     D K  
Sbjct  112  RTLVFYKGRAPKGTRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDVVHPEDLKSC  171

Query  561  EAEPSGSSPA-----------TNKSSPDDVSSN  626
            E EP+ SSP            T ++ P DV+ +
Sbjct  172  EVEPAVSSPTEVSEVSLAFPKTEETKPSDVAES  204



>ref|XP_009150982.1| PREDICTED: protein ATAF2-like isoform X1 [Brassica rapa]
Length=456

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 152/213 (71%), Gaps = 25/213 (12%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+GFRF PTD+EL+ +YLR+KINGR  EV+VI EVD+CK EPWDLP LSV+
Sbjct  1    MEVLSLDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCP+DRKYP+G R NRAT AGYWKATGKDR +KT K          +IG+K
Sbjct  61   KTTDSEWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKK---------IIGVK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-----DRKCD  560
            +TLVFYKGRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     D K  
Sbjct  112  RTLVFYKGRAPKGTRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDVVHPEDLKSC  171

Query  561  EAEPSGSSPA-----------TNKSSPDDVSSN  626
            E EP+ SSP            T ++ P DV+ +
Sbjct  172  EVEPAVSSPTEVSEVSLAFPKTEETKPSDVAES  204



>ref|XP_009150983.1| PREDICTED: protein ATAF2-like isoform X2 [Brassica rapa]
Length=455

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 152/213 (71%), Gaps = 25/213 (12%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+GFRF PTD+EL+ +YLR+KINGR  EV+VI EVD+CK EPWDLP LSV+
Sbjct  1    MEVLSLDSLPVGFRFSPTDEELVRYYLRQKINGRDEEVRVIREVDICKSEPWDLPHLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCP+DRKYP+G R NRAT AGYWKATGKDR +KT K          +IG+K
Sbjct  61   KTTDSEWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRMVKTGKK---------IIGVK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-----DRKCD  560
            +TLVFYKGRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     D K  
Sbjct  112  RTLVFYKGRAPKGTRTCWIMHEYRATEQDLDGTKPGQNPFVICKLFKKQDVVHPEDLKSC  171

Query  561  EAEPSGSSPA-----------TNKSSPDDVSSN  626
            E EP+ SSP            T ++ P DV+ +
Sbjct  172  EVEPAVSSPTEVSEVSLAFPKTEETKPSDVAES  204



>ref|XP_011003273.1| PREDICTED: NAC domain-containing protein 45-like isoform X2 [Populus 
euphratica]
Length=588

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 155/215 (72%), Gaps = 19/215 (9%)
 Frame = +3

Query  69   GFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWFFFC  248
            GFRFRP+D+EL+ +YLR KING    V+VI E+DVCKWEPWDLP LS+IK  DPEWFFFC
Sbjct  14   GFRFRPSDEELVDYYLRLKINGDDDGVRVIREIDVCKWEPWDLPDLSIIKNKDPEWFFFC  73

Query  249  PLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKGRAP  428
            PLDRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+KKTLVFY GRAP
Sbjct  74   PLDRKYPNGSRQNRATNAGYWKATGKDRKIK---------SGNNLIGMKKTLVFYTGRAP  124

Query  429  KGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSGSSPATN  596
            KG+RTNW+MHEYRATE +LDGT+PGQ +FVL  LF K D+      CD+AE + SSP   
Sbjct  125  KGKRTNWVMHEYRATEEELDGTKPGQSSFVLSRLFKKQDESIESLNCDQAEATVSSPTMV  184

Query  597  KSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            +SSP+   S    +  L++  P  AN TS V  PV
Sbjct  185  QSSPEVTQS----DQPLIEASP--ANTTSEVGPPV  213



>gb|KJB37428.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=377

 Score =   259 bits (662),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 18/221 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRFRPTD+ELI  YLR KING R+ E+++I E+DVCK EPWDLP LS 
Sbjct  1    MGVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IKT DPEWFFFCPLDRKYP GNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IKTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIK---------SGSTLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C +F K D    D   D
Sbjct  112  KKTLVFYNGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKKQDETIEDINSD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTS  683
            E +PS  SP  + +S  +V     Q +  + ++ +KA  TS
Sbjct  172  EVDPSVLSPTEDMASELEVP----QASPTVKQEAEKACDTS  208



>ref|XP_010045303.1| PREDICTED: uncharacterized protein LOC104434047 [Eucalyptus grandis]
 gb|KCW88592.1| hypothetical protein EUGRSUZ_A00969 [Eucalyptus grandis]
Length=597

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 151/202 (75%), Gaps = 14/202 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L +++LPLGFRFRPTDQELI HYLR KINGR  EV+VI EVDVCK EPWDLP LS I
Sbjct  1    MAVLPLNSLPLGFRFRPTDQELIDHYLRLKINGRDREVRVIREVDVCKVEPWDLPDLSAI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            ++ DPEWFFFCP DRKYPNG+R NRAT AGYWKATGKDR IK     G D     LIG+K
Sbjct  61   ESRDPEWFFFCPRDRKYPNGHRLNRATTAGYWKATGKDRKIK----LGRD-----LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR-KC---DE  563
            KTLVFY GRAPKG+RT W+MHEYR T  +LDGT PGQGAFVLC LF K D+  +C   D+
Sbjct  112  KTLVFYTGRAPKGKRTYWVMHEYRTTLEELDGTHPGQGAFVLCRLFRKQDETLECPTRDD  171

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AE    SP  N S PDD  S L
Sbjct  172  AEVVVVSPTAN-SLPDDTESEL  192



>ref|XP_011003272.1| PREDICTED: NAC domain-containing protein 45-like isoform X1 [Populus 
euphratica]
Length=601

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 155/215 (72%), Gaps = 19/215 (9%)
 Frame = +3

Query  69   GFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWFFFC  248
            GFRFRP+D+EL+ +YLR KING    V+VI E+DVCKWEPWDLP LS+IK  DPEWFFFC
Sbjct  14   GFRFRPSDEELVDYYLRLKINGDDDGVRVIREIDVCKWEPWDLPDLSIIKNKDPEWFFFC  73

Query  249  PLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKGRAP  428
            PLDRKYPNG+R NRAT AGYWKATGKDR IK         S   LIG+KKTLVFY GRAP
Sbjct  74   PLDRKYPNGSRQNRATNAGYWKATGKDRKIK---------SGNNLIGMKKTLVFYTGRAP  124

Query  429  KGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPSGSSPATN  596
            KG+RTNW+MHEYRATE +LDGT+PGQ +FVL  LF K D+      CD+AE + SSP   
Sbjct  125  KGKRTNWVMHEYRATEEELDGTKPGQSSFVLSRLFKKQDESIESLNCDQAEATVSSPTMV  184

Query  597  KSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            +SSP+   S    +  L++  P  AN TS V  PV
Sbjct  185  QSSPEVTQS----DQPLIEASP--ANTTSEVGPPV  213



>ref|XP_011075874.1| PREDICTED: NAC domain-containing protein 45 [Sesamum indicum]
Length=623

 Score =   265 bits (677),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 147/204 (72%), Gaps = 16/204 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L + ALP+G+RFRPTD+ELI HYLR KINGRH EV VI E+DVCKWEPWDLP LSVI
Sbjct  1    MAVLPVKALPVGYRFRPTDEELIDHYLRLKINGRHKEVSVIREIDVCKWEPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            ++ D EWFFFCP DRKY NG R NRAT  GYWKATGKDR I +RK           IG+K
Sbjct  61   ESTDNEWFFFCPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGAK--------IGMK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRK-------  554
            KTLVFY GRAP G+RTNW++HEYRAT+  LDGT PGQGAFVLC LF K+D ++       
Sbjct  113  KTLVFYTGRAPDGKRTNWVIHEYRATDKSLDGTHPGQGAFVLCRLFKKTDLKQDEIAESS  172

Query  555  -CDEAEPSGSSPATNKSSPDDVSS  623
             C+E E   SSP   K S D+  S
Sbjct  173  NCNEVEEIVSSPTIVKPSADEEQS  196



>ref|XP_010515305.1| PREDICTED: NAC domain-containing protein 19-like [Camelina sativa]
Length=453

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSMD+LP+G RFRPTD+EL+ +YLR+KING   +V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSMDSLPVGLRFRPTDEELVRYYLRKKINGHDGDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK  K        T +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKNGK--------TKIIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS------DDRKCDEA  566
            VF+ GRAPKG RTNW++HEYRATE DL GT PGQ  FV+C LF K       +D K DE 
Sbjct  120  VFHAGRAPKGTRTNWVIHEYRATENDLSGTNPGQSPFVICKLFKKQELHLAEEDSKSDEV  179

Query  567  EPSGSSPATNKSS---PDDVSSNLFQEAALL  650
            EP+ SSP    S     +DV      E++L+
Sbjct  180  EPAVSSPTVEVSEVTKTEDVKPYDIAESSLV  210



>ref|XP_003615517.1| NAC domain protein [Medicago truncatula]
 gb|AES98475.1| NAC transcription factor-like protein [Medicago truncatula]
Length=630

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            ++ LS++ LPLGFRFRPTD+EL+  YLR KING   EV VI EVDVCK+EPWDLP LS++
Sbjct  17   LAVLSLNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIV  76

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +  DPEWFFFCP+DRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  77   RNKDPEWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIK---------SGATLIGMK  127

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFY GRAPKG+RT+WIMHEYR T  +LDGT PGQ  +VLC LF K D+      C E
Sbjct  128  KTLVFYAGRAPKGQRTHWIMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLASSNCGE  187

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AE + S+P T   SP+++ S+L
Sbjct  188  AEQTTSTPTTANYSPEEIQSDL  209



>gb|AFK41148.1| unknown [Medicago truncatula]
Length=642

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            ++ LS++ LPLGFRFRPTD+EL+  YLR KING   EV VI EVDVCK+EPWDLP LS++
Sbjct  17   LAVLSLNKLPLGFRFRPTDEELVDFYLRMKINGNGDEVWVIREVDVCKFEPWDLPDLSIV  76

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +  DPEWFFFCP+DRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  77   RNKDPEWFFFCPMDRKYPNGSRLNRATTNGYWKATGKDRKIK---------SGATLIGMK  127

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFY GRAPKG+RT+WIMHEYR T  +LDGT PGQ  +VLC LF K D+      C E
Sbjct  128  KTLVFYAGRAPKGQRTHWIMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLASSNCGE  187

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AE + S+P T   SP+++ S+L
Sbjct  188  AEQTTSTPTTANYSPEEIQSDL  209



>gb|KFK27735.1| hypothetical protein AALP_AA8G422400 [Arabis alpina]
Length=464

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 145/205 (71%), Gaps = 16/205 (8%)
 Frame = +3

Query  27   KAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSL  206
            K  M  LS+ +LP+GFRF PTD+EL+ +YLR KINGR  EV+VI EVD+CKWEPWDLP  
Sbjct  2    KDDMEVLSLASLPVGFRFSPTDEELVRYYLRLKINGRDDEVRVIREVDICKWEPWDLPDF  61

Query  207  SVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLI  386
            SV+KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR +K+         NT +I
Sbjct  62   SVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKS--------GNTKII  113

Query  387  GIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-------  545
            G+K+TLVFY GRAPKG RT WI+HEYRATE DLDGT+ GQ  FV+C LF K D       
Sbjct  114  GVKRTLVFYTGRAPKGTRTCWIIHEYRATEKDLDGTKSGQNPFVICKLFKKQDVVNDAAA  173

Query  546  -DRKCDEAEPSGSSPATNKSSPDDV  617
             D K  E EP+ SSP        DV
Sbjct  174  EDSKSCEVEPAVSSPTVVDGMKSDV  198



>ref|XP_006394714.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
 gb|ESQ32000.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
Length=483

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 142/194 (73%), Gaps = 16/194 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI EVD+CKWEPWDLP  SV+
Sbjct  1    MEVLSLASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR +K+         NT +IG+K
Sbjct  61   KTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKS--------GNTKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD--------DR  551
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D        D 
Sbjct  113  RTLVFYTGRAPKGSRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDVVNGAAPEDL  172

Query  552  KCDEAEPSGSSPAT  593
            K  E EP+ SSPA 
Sbjct  173  KSSEVEPAVSSPAV  186



>emb|CDY08139.1| BnaA06g15870D [Brassica napus]
Length=464

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 145/202 (72%), Gaps = 15/202 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            L++D+LP+G RFRPTD+EL+  YL RKING   +V  I E+D+CKWEPWDLP  SVIKT+
Sbjct  11   LTLDSLPVGLRFRPTDEELVRFYLHRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTN  70

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK+ K++        +IG+K+TL
Sbjct  71   DSEWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKNS--------IIGVKRTL  122

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD------DRKCDE-  563
            VF+ GRAPKG RTNWIMHEYRATE DL GT PGQ  FV+C LF K D      D K DE 
Sbjct  123  VFHSGRAPKGTRTNWIMHEYRATEDDLSGTNPGQSPFVICKLFKKQDLSLADEDSKLDEA  182

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            AE    SP    SSP +  S +
Sbjct  183  AEQDVLSPTAATSSPGETRSQV  204



>gb|KHN19577.1| NAC domain-containing protein 78 [Glycine soja]
Length=598

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 150/199 (75%), Gaps = 15/199 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            +S+D+LPLGFRFRPTD+EL+++YLR+KING   +V VI E+DVCKWEPWD+P LSV++T 
Sbjct  17   VSLDSLPLGFRFRPTDEELVNYYLRQKINGNGRQVWVIREIDVCKWEPWDMPGLSVVQTK  76

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK+ K          LIG+KKTL
Sbjct  77   DPEWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRRIKSGKD---------LIGMKKTL  127

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+      CDEAE 
Sbjct  128  VFYTGRAPKGNRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLEVSHCDEAEQ  187

Query  573  SGSSPATNKSSPDDVSSNL  629
            + S+P     S +++ S+L
Sbjct  188  TASTPVA--YSTEEIQSDL  204



>gb|KJB37424.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=472

 Score =   259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 18/221 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRFRPTD+ELI  YLR KING R+ E+++I E+DVCK EPWDLP LS 
Sbjct  1    MGVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IKT DPEWFFFCPLDRKYP GNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IKTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIK---------SGSTLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C +F K D    D   D
Sbjct  112  KKTLVFYNGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKKQDETIEDINSD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTS  683
            E +PS  SP  + +S  +V     Q +  + ++ +KA  TS
Sbjct  172  EVDPSVLSPTEDMASELEVP----QASPTVKQEAEKACDTS  208



>gb|KHG14091.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=559

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 159/225 (71%), Gaps = 18/225 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRFRPTDQELI  YLR KING R+ E+++I E+DVCK EPWDLP LS 
Sbjct  1    MGVLLLNSLPLGFRFRPTDQELIDFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IKT DPEWFFFCPLDRKYP GNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IKTQDPEWFFFCPLDRKYPTGNRLNRATDAGYWKATGKDRKIK---------SGSTLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C LF K D    D   D
Sbjct  112  KKTLVFYNGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRLFKKQDETIEDINGD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVML  695
            E +PS  SP  +  S  +V     Q++  + ++ +KA  TS   L
Sbjct  172  EVDPSVLSPTEDMVSELEVP----QDSPTVKQEAEKACDTSETCL  212



>ref|XP_003526771.1| PREDICTED: uncharacterized protein LOC100808469 [Glycine max]
Length=598

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 150/199 (75%), Gaps = 15/199 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            +S+D+LPLGFRFRPTD+EL+++YLR+KING   +V VI E+DVCKWEPWD+P LSV++T 
Sbjct  17   VSLDSLPLGFRFRPTDEELVNYYLRQKINGNGRQVWVIREIDVCKWEPWDMPGLSVVQTK  76

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK+ K          LIG+KKTL
Sbjct  77   DPEWFFFCPQDRKYPNGHRLNRATNNGYWKATGKDRRIKSGKD---------LIGMKKTL  127

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+      CDEAE 
Sbjct  128  VFYTGRAPKGNRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLEVSHCDEAEQ  187

Query  573  SGSSPATNKSSPDDVSSNL  629
            + S+P     S +++ S+L
Sbjct  188  TASTPVA--YSTEEIQSDL  204



>gb|KJB37426.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=482

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 18/221 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRFRPTD+ELI  YLR KING R+ E+++I E+DVCK EPWDLP LS 
Sbjct  1    MGVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IKT DPEWFFFCPLDRKYP GNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IKTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIK---------SGSTLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C +F K D    D   D
Sbjct  112  KKTLVFYNGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKKQDETIEDINSD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTS  683
            E +PS  SP  + +S  +V     Q +  + ++ +KA  TS
Sbjct  172  EVDPSVLSPTEDMASELEVP----QASPTVKQEAEKACDTS  208



>ref|XP_006394715.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
 gb|ESQ32001.1| hypothetical protein EUTSA_v10004105mg [Eutrema salsugineum]
Length=458

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 142/194 (73%), Gaps = 16/194 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI EVD+CKWEPWDLP  SV+
Sbjct  1    MEVLSLASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREVDICKWEPWDLPDFSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR +K+         NT +IG+K
Sbjct  61   KTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKS--------GNTKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD--------DR  551
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D        D 
Sbjct  113  RTLVFYTGRAPKGSRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDVVNGAAPEDL  172

Query  552  KCDEAEPSGSSPAT  593
            K  E EP+ SSPA 
Sbjct  173  KSSEVEPAVSSPAV  186



>ref|XP_003602412.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES72663.1| NAC transcription factor-like protein [Medicago truncatula]
Length=593

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +3

Query  33   GMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSV  212
            GM+ LS+++LPLGFRFRPTD+ELI +YLR KING   EV VI E+DVCKWEPWD+P LSV
Sbjct  13   GMAVLSLNSLPLGFRFRPTDEELIDYYLRSKINGNGDEVWVIREIDVCKWEPWDMPDLSV  72

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            ++  DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S T LIG+
Sbjct  73   VRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIK---------SGTILIGM  123

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ  +VLC LF K+D+        
Sbjct  124  KKTLVFYSGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKNDESVEVSNYG  183

Query  561  EAEPSGSSPATNKSSPDDVSSN  626
            E E + S+P     SP+++ S+
Sbjct  184  EVEQTTSAPLAANYSPEEIQSD  205



>ref|XP_003602411.1| IAA-amino acid hydrolase ILR1-like protein [Medicago truncatula]
Length=434

 Score =   258 bits (659),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 146/204 (72%), Gaps = 13/204 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LPLGFRFRPTD+ELI +YLR KING   EVQVI E+DVCKWEPWD+P LSVI
Sbjct  222  MVTLSLISLPLGFRFRPTDEELIDYYLRLKINGNGDEVQVIREIDVCKWEPWDMPDLSVI  281

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K +DPEWFFFCP DR+YPNGNR NR T  GYWKATGKDR IK         S T LIG+K
Sbjct  282  KDNDPEWFFFCPQDRQYPNGNRLNRETNHGYWKATGKDRKIK---------SGTILIGMK  332

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVFY  RAP G R+NW+MHEYR T  +LDGT PGQ A+VLC LF K+D+      C E
Sbjct  333  KTLVFYISRAPNGRRSNWVMHEYRPTLEELDGTNPGQKAYVLCRLFKKNDESLEVSNCGE  392

Query  564  AEPSGSSPATNKSSPDDVSSNLFQ  635
             E + S+P   +S P  ++ +  Q
Sbjct  393  GEQTNSAPEELQSDPAPITVSTSQ  416



>gb|KJB37423.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=520

 Score =   260 bits (665),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 18/221 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRFRPTD+ELI  YLR KING R+ E+++I E+DVCK EPWDLP LS 
Sbjct  1    MGVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IKT DPEWFFFCPLDRKYP GNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IKTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIK---------SGSTLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C +F K D    D   D
Sbjct  112  KKTLVFYNGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKKQDETIEDINSD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTS  683
            E +PS  SP  + +S  +V     Q +  + ++ +KA  TS
Sbjct  172  EVDPSVLSPTEDMASELEVP----QASPTVKQEAEKACDTS  208



>gb|AHJ79172.1| NAC domain protein NAC31 [Gossypium hirsutum]
 gb|KJB37427.1| hypothetical protein B456_006G203800 [Gossypium raimondii]
Length=541

 Score =   261 bits (666),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 158/221 (71%), Gaps = 18/221 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRFRPTD+ELI  YLR KING R+ E+++I E+DVCK EPWDLP LS 
Sbjct  1    MGVLLLNSLPLGFRFRPTDEELIHFYLRSKINGNRNDEIEIIREIDVCKCEPWDLPDLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IKT DPEWFFFCPLDRKYP GNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IKTQDPEWFFFCPLDRKYPTGNRLNRATEAGYWKATGKDRKIK---------SGSTLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ AFV+C +F K D    D   D
Sbjct  112  KKTLVFYNGRAPRGKRTNWVMHEYRTTLDELDGTKPGQNAFVICRIFKKQDETIEDINSD  171

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTS  683
            E +PS  SP  + +S  +V     Q +  + ++ +KA  TS
Sbjct  172  EVDPSVLSPTEDMASELEVP----QASPTVKQEAEKACDTS  208



>ref|XP_004514021.1| PREDICTED: uncharacterized protein LOC101501154 [Cicer arietinum]
Length=610

 Score =   262 bits (670),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 146/201 (73%), Gaps = 13/201 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS++ LPLGFRFRPTD+ELI  YLR KING   EV VI E+DVCKWEPWDLP LSV+
Sbjct  15   MAVLSLNKLPLGFRFRPTDEELIDFYLRLKINGNGDEVWVIREIDVCKWEPWDLPDLSVV  74

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +  DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  75   RNKDPEWFFFCPQDRKYPNGSRLNRATNHGYWKATGKDRKIK---------SGPTLIGMK  125

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDE  563
            KTLVF+ GRAPKG+RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+      C E
Sbjct  126  KTLVFHAGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESIESSNCGE  185

Query  564  AEPSGSSPATNKSSPDDVSSN  626
             E + S+P T   SP+++ S+
Sbjct  186  VEQTASTPMTANYSPEEIQSD  206



>gb|KFK34231.1| hypothetical protein AALP_AA5G118000 [Arabis alpina]
Length=458

 Score =   258 bits (659),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 143/195 (73%), Gaps = 16/195 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS+D+LP+G RFRPTD+EL+  YL RKING   +V+ I E+D+CKWEPWDLP LSVIKT 
Sbjct  8    LSLDSLPVGLRFRPTDEELVRFYLGRKINGHDDDVKAIREIDICKWEPWDLPDLSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYP G+R NRAT AGYWKATGKDR IK+ K          +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPTGSRQNRATIAGYWKATGKDRKIKSAKKN--------IIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS------DDRKCDEA  566
            VF+ GRAPKG RTNW+MHEYRATE DL GT PGQ  FV+C LF K       +D K DEA
Sbjct  120  VFHSGRAPKGTRTNWVMHEYRATENDLSGTNPGQSPFVICKLFKKQELNLAEEDSKSDEA  179

Query  567  --EPSGSSPATNKSS  605
              EP+GSSP    S+
Sbjct  180  EPEPAGSSPTLEVSA  194



>ref|XP_003602413.1| NAC domain-containing protein [Medicago truncatula]
 gb|AES72664.1| NAC transcription factor-like protein [Medicago truncatula]
Length=620

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 149/202 (74%), Gaps = 13/202 (6%)
 Frame = +3

Query  33   GMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSV  212
            GM+ LS+++LPLGFRFRPTD+ELI +YLR KING   EV VI E+DVCKWEPWD+P LSV
Sbjct  13   GMAVLSLNSLPLGFRFRPTDEELIDYYLRSKINGNGDEVWVIREIDVCKWEPWDMPDLSV  72

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            ++  DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S T LIG+
Sbjct  73   VRNKDPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIK---------SGTILIGM  123

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ  +VLC LF K+D+        
Sbjct  124  KKTLVFYSGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKNDESVEVSNYG  183

Query  561  EAEPSGSSPATNKSSPDDVSSN  626
            E E + S+P     SP+++ S+
Sbjct  184  EVEQTTSAPLAANYSPEEIQSD  205



>ref|XP_009149732.1| PREDICTED: NAC transcription factor 29 [Brassica rapa]
Length=463

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 145/202 (72%), Gaps = 15/202 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            L++D+LP+G RFRPTD+EL+  YL RKING   +V  I E+D+CKWEPWDLP  SVIKT+
Sbjct  11   LTLDSLPVGLRFRPTDEELVRFYLHRKINGHDDDVTAIREIDICKWEPWDLPGFSVIKTN  70

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK+ K++        +IG+K+TL
Sbjct  71   DSEWLFFCPLDRKYPNGSRQNRATIAGYWKATGKDRKIKSGKNS--------IIGVKRTL  122

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD------DRKCDE-  563
            VF+ GRAPKG RTNWIMHEYRATE DL GT PGQ  FV+C LF K D      D K DE 
Sbjct  123  VFHSGRAPKGTRTNWIMHEYRATEDDLSGTNPGQSPFVICKLFKKQDLSLADEDSKLDEA  182

Query  564  AEPSGSSPATNKSSPDDVSSNL  629
            A+    SP    SSP +  S +
Sbjct  183  ADQDVLSPTGATSSPGETRSQV  204



>ref|XP_010662939.1| PREDICTED: NAC domain-containing protein 77 [Vitis vinifera]
 emb|CBI23105.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 151/198 (76%), Gaps = 14/198 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS ++LPLGFRFRPTD+ELI+HYLR KI+G   EV+VI E+DVCKWEPWDLP LS I
Sbjct  1    MAVLSFNSLPLGFRFRPTDEELITHYLRLKISGNDEEVRVIREIDVCKWEPWDLPDLSEI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T+D EWFFFCP DRKYPNG+R NRAT AGYWKATG+DR IK++         T L+G+K
Sbjct  61   RTNDMEWFFFCPRDRKYPNGHRLNRATAAGYWKATGRDRQIKSK---------TRLVGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVF+ GRAP G+RT W+MHEYRAT  +LDGT PGQ AFVLC LF K D++      DE
Sbjct  112  KTLVFHTGRAPHGKRTVWVMHEYRATAKELDGTHPGQAAFVLCRLFKKQDEKAEGSNPDE  171

Query  564  AEPSGSSPATNKSSPDDV  617
             EP+  SP T  +SP++ 
Sbjct  172  IEPTVPSP-TPANSPEET  188



>gb|KHN46203.1| NAC domain-containing protein 78 [Glycine soja]
Length=588

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 147/200 (74%), Gaps = 13/200 (7%)
 Frame = +3

Query  39   SGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIK  218
            + LS++ LPLGFRFRPTD+ELI +YLR KING   +V VI E+DVCKWEPWDLP LSV++
Sbjct  13   TALSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVVR  72

Query  219  TDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKK  398
              DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S + LIG+KK
Sbjct  73   NKDPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIK---------SGSTLIGMKK  123

Query  399  TLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEA  566
            TLVFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+       D+ 
Sbjct  124  TLVFYTGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLEASNGDDV  183

Query  567  EPSGSSPATNKSSPDDVSSN  626
            + + S+P T   SPD++ S+
Sbjct  184  DRTASTPMTANYSPDEIQSD  203



>ref|NP_001276287.1| NAC domain protein [Glycine max]
 gb|AGO14647.1| NAC transcription factor [Glycine max]
Length=589

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 146/198 (74%), Gaps = 13/198 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS++ LPLGFRFRPTD+ELI +YLR KING   +V VI E+DVCKWEPWDLP LSV++  
Sbjct  16   LSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVVRNK  75

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S + LIG+KKTL
Sbjct  76   DPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIK---------SGSTLIGMKKTL  126

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+       D+ + 
Sbjct  127  VFYTGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKQDESLEASNGDDVDR  186

Query  573  SGSSPATNKSSPDDVSSN  626
            + S+P T   SPD++ S+
Sbjct  187  TASTPMTANYSPDEIQSD  204



>ref|XP_002521312.1| transcription factor, putative [Ricinus communis]
 gb|EEF41086.1| transcription factor, putative [Ricinus communis]
Length=597

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 151/203 (74%), Gaps = 14/203 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL++ YLR KING   +V+VI E+DVCKWEPWDLP +S+I
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVNFYLRLKINGNDKDVRVIRELDVCKWEPWDLPDMSII  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT+D EWFFFCPLDRKYPNG+R NRAT  GYWKATGKDR IK         S   LIG+K
Sbjct  61   KTNDQEWFFFCPLDRKYPNGHRLNRATSKGYWKATGKDRKIK---------SGNTLIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVFY GRAP+G RT+W++HEYRATE DLDGT+PGQ  FV+C LF K DD       DE
Sbjct  112  KTLVFYTGRAPRGTRTHWVIHEYRATEDDLDGTKPGQNPFVICRLFKKQDDTVENLNLDE  171

Query  564  AEPSG-SSPATNKSSPDDVSSNL  629
             E +   SP   +SS +   S+L
Sbjct  172  HEATTLLSPTAPQSSLEAAESDL  194



>gb|KHN40025.1| NAC domain-containing protein 78 [Glycine soja]
Length=590

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 146/198 (74%), Gaps = 13/198 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS++ LPLGFRFRPTD+ELI +YLR KING   +V VI E+DVCKWEPWDLP LSV++  
Sbjct  16   LSLNTLPLGFRFRPTDEELIDYYLRSKINGNSDDVWVIREIDVCKWEPWDLPDLSVVRNK  75

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S + LIG+KKTL
Sbjct  76   DPEWFFFCPQDRKYPNGHRLNRATSHGYWKATGKDRRIK---------SGSTLIGMKKTL  126

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG+RTNW+MHEYR T  +L+GT PGQ  +VLC LF K D+       D+ E 
Sbjct  127  VFYTGRAPKGKRTNWVMHEYRPTLKELEGTNPGQNPYVLCRLFKKQDESLEASNGDDVER  186

Query  573  SGSSPATNKSSPDDVSSN  626
            + S+P T   SPD++ S+
Sbjct  187  TASTPTTANYSPDEIQSD  204



>ref|XP_007141360.1| hypothetical protein PHAVU_008G189100g [Phaseolus vulgaris]
 gb|ESW13354.1| hypothetical protein PHAVU_008G189100g [Phaseolus vulgaris]
Length=569

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 145/197 (74%), Gaps = 12/197 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS++ LPLGFRFRPTD+ELI +YLR KING   +V VI E+DVCKWEPWDLP LSV++  
Sbjct  17   LSLNTLPLGFRFRPTDEELIDYYLRSKINGNGDDVWVIREIDVCKWEPWDLPDLSVVRNK  76

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S + LIG+KKTL
Sbjct  77   DPEWFFFCPQDRKYPNGHRLNRATSLGYWKATGKDRRIK---------SGSTLIGMKKTL  127

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR---KCDEAEPS  575
            VFY GRAPKG+RTNW+MHEYR T  +LDGT PGQ  +VLC LF K D+       E E +
Sbjct  128  VFYTGRAPKGKRTNWVMHEYRPTLKELDGTNPGQNPYVLCRLFKKHDESLEASNGEVERA  187

Query  576  GSSPATNKSSPDDVSSN  626
             S+P T   SPD++ S+
Sbjct  188  ASTPMTANHSPDEIQSD  204



>ref|XP_006287681.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
 gb|EOA20579.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
Length=414

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 142/197 (72%), Gaps = 16/197 (8%)
 Frame = +3

Query  27   KAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSL  206
            K  +  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI EVD+CKWEPWDLP  
Sbjct  2    KEDIDVLSLASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREVDICKWEPWDLPDF  61

Query  207  SVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLI  386
            SV+KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +I
Sbjct  62   SVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKII  113

Query  387  GIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-------  545
            G+K+TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D       
Sbjct  114  GVKRTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDIVEGDVP  173

Query  546  -DRKCDEAEPSGSSPAT  593
             D K  E EP+ SSP  
Sbjct  174  EDSKSCEVEPAVSSPTV  190



>ref|XP_002877683.1| ANAC062 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53942.1| ANAC062 [Arabidopsis lyrata subsp. lyrata]
Length=469

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 143/198 (72%), Gaps = 14/198 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSMD+LP+G RFRPTD+ELI +YLRRKING   +V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSMDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NRAT AGYWKATGKDR IK+ K        T +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRATVAGYWKATGKDRKIKSGK--------TNIIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK------SDDRKCDEA  566
            VF+ GRAP+G RTNW++HEYRATE DL G  PGQ  FV+C LF K       +D K DE 
Sbjct  120  VFHAGRAPRGTRTNWVIHEYRATEDDLSGINPGQSPFVICKLFKKQELNLAEEDSKSDEV  179

Query  567  EPSGSSPATNKSSPDDVS  620
            E    S  T + S  +VS
Sbjct  180  EEPAVSSPTVEVSKSEVS  197



>ref|XP_006287682.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
 gb|EOA20580.1| hypothetical protein CARUB_v10000892mg [Capsella rubella]
Length=466

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 142/197 (72%), Gaps = 16/197 (8%)
 Frame = +3

Query  27   KAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSL  206
            K  +  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI EVD+CKWEPWDLP  
Sbjct  2    KEDIDVLSLASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREVDICKWEPWDLPDF  61

Query  207  SVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLI  386
            SV+KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +I
Sbjct  62   SVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKII  113

Query  387  GIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-------  545
            G+K+TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D       
Sbjct  114  GVKRTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDIVEGDVP  173

Query  546  -DRKCDEAEPSGSSPAT  593
             D K  E EP+ SSP  
Sbjct  174  EDSKSCEVEPAVSSPTV  190



>ref|XP_002874210.1| tip [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50469.1| tip [Arabidopsis lyrata subsp. lyrata]
Length=461

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 142/197 (72%), Gaps = 16/197 (8%)
 Frame = +3

Query  27   KAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSL  206
            K  M  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI E+D+CKWEPWDLP  
Sbjct  2    KEDMEVLSLASLPVGFRFSPTDEELVRYYLRLKINGHDDDVRVIREIDICKWEPWDLPDF  61

Query  207  SVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLI  386
            SV+KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +I
Sbjct  62   SVVKTTDAEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKII  113

Query  387  GIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-------  545
            G+K+TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D       
Sbjct  114  GVKRTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVVCKLFKKQDIVNGAAL  173

Query  546  -DRKCDEAEPSGSSPAT  593
             + K  E EP+ SSP  
Sbjct  174  EESKSCEVEPAVSSPTV  190



>ref|XP_009111638.1| PREDICTED: NAC domain-containing protein 74 isoform X1 [Brassica 
rapa]
Length=446

 Score =   255 bits (652),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 146/195 (75%), Gaps = 13/195 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+DALP+GFRF PTD+EL+ +YLR+KINGR  +V+VI  VD+CK+EPWDLP LSV+
Sbjct  1    MEVLSLDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR +K+         +T +IG+K
Sbjct  61   RTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKS--------GSTKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     EA P 
Sbjct  113  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQD--VVSEASPE  170

Query  576  -GSSPATNKSSPDDV  617
             G  PA   SSP  V
Sbjct  171  CGVEPAV--SSPTVV  183



>ref|XP_009111639.1| PREDICTED: NAC domain-containing protein 2 isoform X2 [Brassica 
rapa]
 emb|CDY19828.1| BnaA09g04810D [Brassica napus]
Length=445

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 146/195 (75%), Gaps = 13/195 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+DALP+GFRF PTD+EL+ +YLR+KINGR  +V+VI  VD+CK+EPWDLP LSV+
Sbjct  1    MEVLSLDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR +K+         +T +IG+K
Sbjct  61   RTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKVKS--------GSTKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     EA P 
Sbjct  113  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQD--VVSEASPE  170

Query  576  -GSSPATNKSSPDDV  617
             G  PA   SSP  V
Sbjct  171  CGVEPAV--SSPTVV  183



>ref|XP_010493709.1| PREDICTED: NAC domain-containing protein 74 [Camelina sativa]
Length=466

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 141/194 (73%), Gaps = 16/194 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI E+D+CKWEPWDLP  SV+
Sbjct  1    MDVLSLASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +IG+K
Sbjct  61   KTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD--------DR  551
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D        D 
Sbjct  113  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDIVSGAAPEDS  172

Query  552  KCDEAEPSGSSPAT  593
            K  E EP+ SSP  
Sbjct  173  KSCEVEPAVSSPTV  186



>ref|NP_190522.1| transcription factor NTL6 [Arabidopsis thaliana]
 emb|CAB62457.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAL24091.1| putative NAC2 protein [Arabidopsis thaliana]
 gb|AAN41378.1| putative NAC2 protein [Arabidopsis thaliana]
 gb|AEE78553.1| NAC domain-containing protein 62 [Arabidopsis thaliana]
Length=469

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 142/190 (75%), Gaps = 15/190 (8%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LSMD+LP+G RFRPTD+ELI +YLRRKING   +V+ I E+D+CKWEPWDLP  SVIKT 
Sbjct  8    LSMDSLPVGLRFRPTDEELIRYYLRRKINGHDDDVKAIREIDICKWEPWDLPDFSVIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW +FCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +IG+K+TL
Sbjct  68   DSEWLYFCPLDRKYPSGSRQNRATVAGYWKATGKDRKIKSGK--------TNIIGVKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK------SDDRKCDEA  566
            VF+ GRAP+G RTNWI+HEYRATE DL GT PGQ  FV+C LF K       +D K DE 
Sbjct  120  VFHAGRAPRGTRTNWIIHEYRATEDDLSGTNPGQSPFVICKLFKKEELVLGEEDSKSDEV  179

Query  567  -EPSGSSPAT  593
             EP+ SSP  
Sbjct  180  EEPAVSSPTV  189



>ref|XP_006596412.1| PREDICTED: NAC domain-containing protein 12-like [Glycine max]
Length=590

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 145/198 (73%), Gaps = 13/198 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS++ LPLGFRFRPTD+ELI +YLR KING   +V VI E+DVCKWEPWDLP LSV++  
Sbjct  16   LSLNTLPLGFRFRPTDEELIDYYLRSKINGNSDDVWVIREIDVCKWEPWDLPDLSVVRNK  75

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP DRKYPNG+R NRAT  GYWKATGKDR IK         S + LIG+KKTL
Sbjct  76   DPEWFFFCPQDRKYPNGHRLNRATNHGYWKATGKDRKIK---------SGSTLIGMKKTL  126

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEP  572
            VFY GRAPKG+RTNW+MHEYR T  +L+GT PGQ  +VLC LF K D+       D+ E 
Sbjct  127  VFYTGRAPKGKRTNWVMHEYRPTLKELEGTNPGQNPYVLCRLFKKQDESLEASNGDDVER  186

Query  573  SGSSPATNKSSPDDVSSN  626
            + S+P T    PD++ S+
Sbjct  187  TASTPTTANYCPDEIQSD  204



>emb|CAN73792.1| hypothetical protein VITISV_034893 [Vitis vinifera]
Length=720

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 151/198 (76%), Gaps = 14/198 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS ++LPLGFRFRPTD+ELI+HYLR KI+G   EV+VI E+DVCKWEPWDLP LS I
Sbjct  76   MAVLSFNSLPLGFRFRPTDEELITHYLRLKISGNDEEVRVIREIDVCKWEPWDLPDLSEI  135

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T+D EWFFFCP DRKYPNG+R NRAT AGYWKATG+DR IK++         T L+G+K
Sbjct  136  RTNDMEWFFFCPRDRKYPNGHRLNRATAAGYWKATGRDRQIKSK---------TRLVGMK  186

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDE  563
            KTLVF+ GRAP G+RT W+MHEYRAT  +LDGT PGQ AFVLC LF K D++      DE
Sbjct  187  KTLVFHTGRAPHGKRTVWVMHEYRATAKELDGTHPGQAAFVLCRLFKKQDEKAEGSNPDE  246

Query  564  AEPSGSSPATNKSSPDDV  617
             EP+  SP T  +SP++ 
Sbjct  247  IEPTVPSP-TPANSPEET  263



>ref|XP_010421284.1| PREDICTED: NAC domain-containing protein 74-like isoform X1 [Camelina 
sativa]
 ref|XP_010421286.1| PREDICTED: NAC domain-containing protein 74-like isoform X3 [Camelina 
sativa]
Length=467

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 141/194 (73%), Gaps = 16/194 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI E+D+CKWEPWDLP  SV+
Sbjct  1    MDVLSLASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +IG+K
Sbjct  61   KTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD--------DR  551
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D        D 
Sbjct  113  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDIVNGAAPEDS  172

Query  552  KCDEAEPSGSSPAT  593
            K  E EP+ SSP  
Sbjct  173  KSCEVEPAVSSPTV  186



>ref|XP_010456676.1| PREDICTED: NAC domain-containing protein 2-like [Camelina sativa]
Length=521

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 141/194 (73%), Gaps = 16/194 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+ +LP+GFRF PTD+EL+ +YLR KING   +V+VI E+D+CKWEPWDLP  SV+
Sbjct  1    MDVLSLASLPVGFRFSPTDEELVKYYLRLKINGHDDDVRVIREIDICKWEPWDLPDFSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +IG+K
Sbjct  61   KTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD--------DR  551
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D        D 
Sbjct  113  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVICKLFKKQDIVNGAAPEDS  172

Query  552  KCDEAEPSGSSPAT  593
            K  E EP+ SSP  
Sbjct  173  KSCEVEPAVSSPTV  186



>ref|NP_197847.3| TCV-interacting protein [Arabidopsis thaliana]
 gb|AAF87300.1|AF281062_1 TIP [Arabidopsis thaliana]
 dbj|BAB11211.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAN72023.1| NAC2-like protein [Arabidopsis thaliana]
 gb|AAP81801.1| At5g24590 [Arabidopsis thaliana]
 gb|AED93330.1| TCV-interacting protein [Arabidopsis thaliana]
Length=451

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 143/198 (72%), Gaps = 17/198 (9%)
 Frame = +3

Query  27   KAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSL  206
            K  M  LS+ +LP+GFRF PTD+EL+ +YLR KING  ++V+VI E+D+CKWEPWDLP  
Sbjct  2    KEDMEVLSLASLPVGFRFSPTDEELVRYYLRLKINGHDNDVRVIREIDICKWEPWDLPDF  61

Query  207  SVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLI  386
            SV+KT D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR IK+ K        T +I
Sbjct  62   SVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIKSGK--------TKII  113

Query  387  GIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD-------  545
            G+K+TLVFY GRAPKG RT WIMHEYRATE DLDGT+ GQ  FV+C LF K D       
Sbjct  114  GVKRTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKSGQNPFVVCKLFKKQDIVNGAAE  173

Query  546  --DRKCDEAEPSGSSPAT  593
              + K  E EP+ SSP  
Sbjct  174  PEESKSCEVEPAVSSPTV  191



>gb|KJB24042.1| hypothetical protein B456_004G125900 [Gossypium raimondii]
Length=455

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 138/172 (80%), Gaps = 10/172 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++LP+GFRFRPTD+ELI  YLR KING R+ EV+VI E+DVCK EPWDLP +S 
Sbjct  1    MAVLSLNSLPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+T DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IQTRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSSLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD  548
            KK+LVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D+
Sbjct  112  KKSLVFYTGRAPRGKRTNWVMHEYRTTLIELDGTKPGQNPFVICRLFKKQDE  163



>gb|KJB24041.1| hypothetical protein B456_004G125900 [Gossypium raimondii]
Length=483

 Score =   254 bits (649),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 138/172 (80%), Gaps = 10/172 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++LP+GFRFRPTD+ELI  YLR KING R+ EV+VI E+DVCK EPWDLP +S 
Sbjct  1    MAVLSLNSLPIGFRFRPTDEELIHFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+T DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IQTRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSSLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD  548
            KK+LVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D+
Sbjct  112  KKSLVFYTGRAPRGKRTNWVMHEYRTTLIELDGTKPGQNPFVICRLFKKQDE  163



>gb|AIS36139.1| NAC transcription factor 91-1 [Brassica napus]
Length=445

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 145/195 (74%), Gaps = 13/195 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+D+LP+GFRF PTD+EL+ +YLR+KINGR  +V+VI  VD+CK+EPWDLP LSV+
Sbjct  1    MEVLSLDSLPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDICKYEPWDLPDLSVV  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T D EW FFCP+DRKYP+G R NRAT AGYWKATGKDR +K+         +T +IG+K
Sbjct  61   RTTDSEWLFFCPIDRKYPSGGRMNRATLAGYWKATGKDRKVKS--------GSTKIIGVK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     EA P 
Sbjct  113  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQD--VVSEASPE  170

Query  576  -GSSPATNKSSPDDV  617
             G  PA   SSP  V
Sbjct  171  CGVEPAV--SSPTVV  183



>ref|XP_010103069.1| NAC domain-containing protein 78 [Morus notabilis]
 gb|EXB94718.1| NAC domain-containing protein 78 [Morus notabilis]
Length=602

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 147/204 (72%), Gaps = 16/204 (8%)
 Frame = +3

Query  48   SMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDD  227
            S+++LPLGFRFRPTD+EL+ +YLR KING    V VI E+DVCK EPWDLP LS+I T D
Sbjct  11   SLNSLPLGFRFRPTDEELVDYYLRLKINGEVQLVSVIREIDVCKLEPWDLPDLSMIPTRD  70

Query  228  PEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLV  407
            PEWFFFCP DRKYPNG+R NRAT AGYWKATG+DR IK         S T  IG+KKTLV
Sbjct  71   PEWFFFCPQDRKYPNGHRLNRATKAGYWKATGRDRKIK---------SGTLQIGMKKTLV  121

Query  408  FYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAEPS  575
            FY GRAPKG+RTNW+MHEYR T  +LDGT PGQ  FVLC LF K D+      C+ AE +
Sbjct  122  FYTGRAPKGKRTNWVMHEYRPTLQELDGTNPGQSPFVLCRLFKKHDESIEGVNCEAAETT  181

Query  576  GSSPATNKSSPDDVSSNLFQEAAL  647
             SSP T KSSP D  S   QE  L
Sbjct  182  VSSPIT-KSSPVDTQSE--QEVTL  202



>emb|CDX86970.1| BnaC03g52400D [Brassica napus]
Length=316

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 142/193 (74%), Gaps = 14/193 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS+D+LP+G RFRPTD+EL+ +YLRRKING   +V+ I E+D+CK EPWDLP  S IKT 
Sbjct  8    LSLDSLPVGLRFRPTDEELVRYYLRRKINGHDDDVKAIREIDICKCEPWDLPDFSAIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FFCPLDRKYPNG+R NR+T AG+WKATGKDR IK+ K+         +IG+K+TL
Sbjct  68   DSEWLFFCPLDRKYPNGSRQNRSTIAGHWKATGKDRKIKSGKNN--------VIGLKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSS  584
            VF+ GRAPKG RTNW+MHEYRATE DL GT PGQ  FV+C LF K D    DEA    SS
Sbjct  120  VFHSGRAPKGTRTNWVMHEYRATEQDLSGTSPGQNPFVICKLFKKQDPSLVDEA---ASS  176

Query  585  PATNKSSPDDVSS  623
            P    SSPD+  +
Sbjct  177  PT---SSPDETKA  186



>gb|KHG07501.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=562

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 137/172 (80%), Gaps = 10/172 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++LP GFRFRPTD+ELI  YLR KING R+ EV+VI E+DVCK EPWDLP +S 
Sbjct  1    MAVLSLNSLPTGFRFRPTDEELIDFYLRAKINGKRNDEVEVIREIDVCKCEPWDLPHMSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+T DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   IETRDPEWFFFCPLDRKYPNGNRLNRATKAGYWKATGKDRKIK---------SGSSLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD  548
            KK+LVFY GRAP+G+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D+
Sbjct  112  KKSLVFYTGRAPRGKRTNWVMHEYRTTLIELDGTKPGQNPFVICRLFKKQDE  163



>gb|KJB39512.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
 gb|KJB39513.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
Length=397

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 140/188 (74%), Gaps = 14/188 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +S+++LP+G RFRPTD+ELI  YLR K+NG R  E+ VI EVDVCK EPWDLP LS 
Sbjct  1    MAVISLNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            +K  DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   VKGRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSCLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D    D   D
Sbjct  112  KKTLVFYTGRAPKGKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDVTIEDINAD  171

Query  561  EAEPSGSS  584
            + +P  SS
Sbjct  172  DVDPGASS  179



>emb|CDX87118.1| BnaC09g04330D [Brassica napus]
Length=832

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 150/202 (74%), Gaps = 16/202 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  LS+DALP+GFRF PTD+EL+ +YLR+KINGR  +V+VI  VD+CK+EPWDLP LSV+
Sbjct  378  MEVLSLDALPVGFRFSPTDEELVRYYLRQKINGRDDDVRVIRAVDMCKYEPWDLPDLSVV  437

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            +T D EW FFCPLDRKYP+G+R NRAT AGYWKATGKDR +K+         +T +IG+K
Sbjct  438  RTMDSEWLFFCPLDRKYPSGSRMNRATIAGYWKATGKDRKVKS--------GSTKIIGVK  489

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            +TLVFY GRAPKG RT WIMHEYRATE DLDGT+PGQ  FV+C LF K D     EA P 
Sbjct  490  RTLVFYTGRAPKGTRTCWIMHEYRATEKDLDGTKPGQNPFVICKLFKKQD--VVSEASPE  547

Query  576  -GSSPATNKSSP---DDVSSNL  629
             G  PA   SSP   D+V S +
Sbjct  548  CGVEPAV--SSPTVVDEVRSEV  567



>emb|CAN73478.1| hypothetical protein VITISV_037597 [Vitis vinifera]
Length=181

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 7/154 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M  +SM++LPLGFRFRPTD+ELI+HYL+ KI GRHSEV+VI E+DVCKWEPWDLP LS+I
Sbjct  1    MGAVSMESLPLGFRFRPTDEELINHYLKLKIEGRHSEVEVIRELDVCKWEPWDLPGLSMI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K DDPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR IK+RKS+ S       IG+K
Sbjct  61   KADDPEWFFFCPRDRKYPNGRRSNRATDAGYWKATGKDRTIKSRKSSAS-------IGMK  113

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTR  497
            KTLVFYKGRAPKG+RTNWI HEYR  +   D ++
Sbjct  114  KTLVFYKGRAPKGQRTNWIFHEYRVIDSASDSSQ  147



>gb|KJB39511.1| hypothetical protein B456_007G017500 [Gossypium raimondii]
Length=525

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 140/188 (74%), Gaps = 14/188 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +S+++LP+G RFRPTD+ELI  YLR K+NG R  E+ VI EVDVCK EPWDLP LS 
Sbjct  1    MAVISLNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            +K  DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   VKGRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSCLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D    D   D
Sbjct  112  KKTLVFYTGRAPKGKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDVTIEDINAD  171

Query  561  EAEPSGSS  584
            + +P  SS
Sbjct  172  DVDPGASS  179



>gb|KHG05224.1| NAC domain-containing 78 -like protein [Gossypium arboreum]
Length=533

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 140/188 (74%), Gaps = 14/188 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +S+++LP+G RFRPTD+ELI  YLR K+NG R  E+ VI EVDVCK EPWDLP LS 
Sbjct  1    MAVISLNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            +K  DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   VKARDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSCLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D    D   D
Sbjct  112  KKTLVFYTGRAPKGKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDETIEDINGD  171

Query  561  EAEPSGSS  584
            + +P  SS
Sbjct  172  DVDPGASS  179



>gb|AHJ79190.1| NAC domain protein NAC49 [Gossypium hirsutum]
Length=628

 Score =   251 bits (641),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 140/188 (74%), Gaps = 14/188 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKING-RHSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +S+++LP+G RFRPTD+ELI  YLR K+NG R  E+ VI EVDVCK EPWDLP LS 
Sbjct  1    MAVISLNSLPIGIRFRPTDEELIDFYLRAKVNGKRKDEIGVIREVDVCKCEPWDLPHLSA  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            +K  DPEWFFFCPLDRKYPNGNR NRAT AGYWKATGKDR IK         S + LIG+
Sbjct  61   VKGRDPEWFFFCPLDRKYPNGNRLNRATEAGYWKATGKDRKIK---------SGSCLIGM  111

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD----DRKCD  560
            KKTLVFY GRAPKG+RTNW+MHEYR T  +LDGT+PGQ  FV+C LF K D    D   D
Sbjct  112  KKTLVFYTGRAPKGKRTNWVMHEYRTTLDELDGTKPGQNPFVICRLFKKQDVTIEDINAD  171

Query  561  EAEPSGSS  584
            + +P  SS
Sbjct  172  DVDPGASS  179



>ref|XP_004241429.1| PREDICTED: uncharacterized protein LOC101257973 [Solanum lycopersicum]
Length=595

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 145/196 (74%), Gaps = 16/196 (8%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+ELI+HYL  KING H +V VI E+D+CK+EPWDLP LSV++++D 
Sbjct  16   LNTLPIGYRFRPTDEELINHYLCLKINGCHDQVGVIREIDICKFEPWDLPDLSVVESNDN  75

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWF+FCP+DRKY NG R NRAT  GYWKATGKDR I TRK           IG+KKTLV+
Sbjct  76   EWFYFCPIDRKYQNGQRLNRATERGYWKATGKDRNIATRKGAK--------IGMKKTLVY  127

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKC--------DEA  566
            Y GRAP+G+RTNW++HEYRAT+  LDG+RPGQGAFVLC LF K++ ++         DE 
Sbjct  128  YNGRAPEGKRTNWVIHEYRATDKSLDGSRPGQGAFVLCRLFKKNELKQAENVESSHFDEV  187

Query  567  EPSGSSPATNKSSPDD  614
            E   SSPA   S  DD
Sbjct  188  EHLVSSPAVGISPTDD  203



>gb|AGV29497.1| putative NAC domain class transcription factor, partial [Tamarix 
hispida]
Length=233

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 131/173 (76%), Gaps = 9/173 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +    LPLGFRF+PTD ELI HYLRRK+NG   +V VI EVDVCK EPWDLP+LS I
Sbjct  1    MAVMPFQNLPLGFRFKPTDVELIDHYLRRKVNGYEKDVSVIGEVDVCKVEPWDLPALSKI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            ++ D EWFFFC  DRKYPNG R NRAT  GYWKATGKDR I  +KS         LIG+K
Sbjct  61   ESPDHEWFFFCARDRKYPNGQRSNRATEKGYWKATGKDRRITKKKS---------LIGMK  111

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRK  554
            KTLVFY+GRAPKG+R+NW++HEYR T P+LDGT PGQGA+V+C L  K +D K
Sbjct  112  KTLVFYQGRAPKGKRSNWVIHEYRTTLPELDGTNPGQGAYVICRLMKKQEDVK  164



>ref|XP_004972796.1| PREDICTED: uncharacterized protein LOC101763561 [Setaria italica]
Length=671

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 159/226 (70%), Gaps = 11/226 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + + ALPLGFRF PTD+EL+ HYL+ KI G+ +SEV+VIPE+DVCK EPWDLP  S+
Sbjct  1    MTVMELKALPLGFRFHPTDEELVRHYLKGKITGQINSEVEVIPEIDVCKCEPWDLPDKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK++     D+    +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSK----GDKRKQHVIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ D     QG +VL  LF K +++      +
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFDSGE--QGGYVLYRLFRKQEEKPERASPE  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLP  698
            E + SG SP  ++SSPD++ +N      L    P+     S + LP
Sbjct  175  EVDRSGYSPTPSRSSPDNIEANEEANTPLNRESPESGLHESPIELP  220



>gb|AGT96630.1| NAC transcription factor [Suaeda liaotungensis]
Length=336

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 150/219 (68%), Gaps = 8/219 (4%)
 Frame = +3

Query  33   GMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSV  212
            G      + LPLGFRF+PTD ELI HYLR KING+  +V  I EVD+CK EPWDLP LS 
Sbjct  10   GALSTPFETLPLGFRFKPTDVELIDHYLRLKINGKEDDVACIKEVDICKVEPWDLPDLSA  69

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+T+D EWF+FCP DRKYPNG R NRAT AGYWKATGKDR IK+RK           IG+
Sbjct  70   IQTNDHEWFYFCPRDRKYPNGQRSNRATEAGYWKATGKDRTIKSRKLGE--------IGM  121

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEP  572
            KKTLVFY GRAPKG+RT+W++HEYR T  +LDG+ PGQGAFVLC LF K+DD K D+ + 
Sbjct  122  KKTLVFYTGRAPKGQRTHWVIHEYRTTLEELDGSHPGQGAFVLCRLFKKADDIKPDDNDD  181

Query  573  SGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIV  689
            +  S     + P    +N+ QE    +    +A+  S+V
Sbjct  182  ASHSDDVVTNVPSPNPTNISQEDIRSEHAVVQASPLSVV  220



>ref|XP_010671303.1| PREDICTED: NAC domain-containing protein 86-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=608

 Score =   247 bits (630),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 133/171 (78%), Gaps = 10/171 (6%)
 Frame = +3

Query  36   MSGLSM--DALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLS  209
            M  L+M  + LPLGFRF+PTD ELI HYLR KING+  EV  I EVD+C+ EPWDLP LS
Sbjct  12   MEALAMPFERLPLGFRFKPTDVELIDHYLRLKINGKDKEVACITEVDICRVEPWDLPGLS  71

Query  210  VIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIG  389
             IK+ D EWFFFCP DRKYPNG R NRAT AGYWKATGKDR+IK+RK          LIG
Sbjct  72   FIKSMDHEWFFFCPRDRKYPNGQRSNRATEAGYWKATGKDRSIKSRK--------MGLIG  123

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS  542
            +KKTLVFYKGRAPKG+RT+W++HEYR T  +LDG+ PGQGAFVLC LF K+
Sbjct  124  MKKTLVFYKGRAPKGQRTHWVIHEYRTTLQELDGSHPGQGAFVLCRLFKKA  174



>ref|XP_006347316.1| PREDICTED: uncharacterized protein LOC102605066 [Solanum tuberosum]
Length=630

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 145/196 (74%), Gaps = 16/196 (8%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+ELI+HYL  KING H++V VI E+D+CK+EPWDLP LSV++++D 
Sbjct  15   LNTLPIGYRFRPTDEELINHYLCLKINGCHNQVDVIREIDICKFEPWDLPDLSVVESNDN  74

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EW +FCP+DRKY NG R NRAT  GYWKATGKDR I TRK           IG+KKTLV+
Sbjct  75   EWLYFCPIDRKYQNGQRLNRATERGYWKATGKDRNIATRKGAK--------IGMKKTLVY  126

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRK--------CDEA  566
            Y GRAP+G+RTNW++HEYRAT+  LDG+ PGQGAFVLC LF K++ ++         DE 
Sbjct  127  YIGRAPEGKRTNWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNELKQDENVESSHFDEV  186

Query  567  EPSGSSPATNKSSPDD  614
            E   SSPA  KS  +D
Sbjct  187  EQLVSSPAVGKSPTND  202



>ref|XP_008788721.1| PREDICTED: uncharacterized protein LOC103706411 isoform X1 [Phoenix 
dactylifera]
Length=715

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 149/197 (76%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  +++ +LPLGFRF PTD+EL++HYL+RKINGR  +EV+VIPEVDVCK EPWDLP  S+
Sbjct  1    MMTIALGSLPLGFRFHPTDEELVTHYLKRKINGRIKTEVEVIPEVDVCKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKY NG+R NRAT AGYWKATGKDR I+++ ++        +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAASARHS----VIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +VL  LF K ++R    K D
Sbjct  117  KKTLVFHRGRAPKGIRTHWIMHEYRTTEPEFESG--DQGGYVLYRLFKKPEERGSNTKAD  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E SG SP   KSSPD
Sbjct  175  EMERSGFSPTPTKSSPD  191



>ref|XP_008788722.1| PREDICTED: uncharacterized protein LOC103706411 isoform X2 [Phoenix 
dactylifera]
Length=707

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 149/197 (76%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  +++ +LPLGFRF PTD+EL++HYL+RKINGR  +EV+VIPEVDVCK EPWDLP  S+
Sbjct  1    MMTIALGSLPLGFRFHPTDEELVTHYLKRKINGRIKTEVEVIPEVDVCKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKY NG+R NRAT AGYWKATGKDR I+++ ++        +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAASARHS----VIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +VL  LF K ++R    K D
Sbjct  117  KKTLVFHRGRAPKGIRTHWIMHEYRTTEPEFESG--DQGGYVLYRLFKKPEERGSNTKAD  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E SG SP   KSSPD
Sbjct  175  EMERSGFSPTPTKSSPD  191



>ref|XP_010671302.1| PREDICTED: uncharacterized protein LOC104888129 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=637

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 133/171 (78%), Gaps = 10/171 (6%)
 Frame = +3

Query  36   MSGLSM--DALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLS  209
            M  L+M  + LPLGFRF+PTD ELI HYLR KING+  EV  I EVD+C+ EPWDLP LS
Sbjct  12   MEALAMPFERLPLGFRFKPTDVELIDHYLRLKINGKDKEVACITEVDICRVEPWDLPGLS  71

Query  210  VIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIG  389
             IK+ D EWFFFCP DRKYPNG R NRAT AGYWKATGKDR+IK+RK          LIG
Sbjct  72   FIKSMDHEWFFFCPRDRKYPNGQRSNRATEAGYWKATGKDRSIKSRK--------MGLIG  123

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKS  542
            +KKTLVFYKGRAPKG+RT+W++HEYR T  +LDG+ PGQGAFVLC LF K+
Sbjct  124  MKKTLVFYKGRAPKGQRTHWVIHEYRTTLQELDGSHPGQGAFVLCRLFKKA  174



>ref|XP_008811393.1| PREDICTED: NAC domain-containing protein 74-like [Phoenix dactylifera]
Length=289

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +++  LPLGFRF PTD+EL++HYL+RKI+GR  SE +VIPE+DVCK EPWDLP  S+
Sbjct  1    MTAIALQLLPLGFRFHPTDEELVNHYLKRKISGRIKSEAEVIPEIDVCKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKY NG+R NRAT AGYWKATGKDR I+++ +         +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHN----VIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +VL  LF K +++    K D
Sbjct  117  KKTLVFHQGRAPKGIRTSWIMHEYRTTEPEFESGV--QGGYVLYRLFKKPEEKSPNSKTD  174

Query  561  EAEPSGSSPATNKSSPDDV  617
            E E +  SP   K SPD+ 
Sbjct  175  EMERNCISPTPAKLSPDET  193



>ref|XP_009150140.1| PREDICTED: NAC transcription factor 29-like [Brassica rapa]
 emb|CDY00208.1| BnaA06g21090D [Brassica napus]
Length=432

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 139/191 (73%), Gaps = 14/191 (7%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            LS+D+LP+G RFRPTD+EL+ +YLRRKING   +V+ I E+D+CK EPWDLP  S IKT 
Sbjct  8    LSLDSLPVGLRFRPTDEELVRYYLRRKINGHDDDVKAIREIDICKCEPWDLPDFSAIKTK  67

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            D EW FF PLDRKYP G+R NR+T AG+WKATGKDR IK+ K+         +IG+K+TL
Sbjct  68   DSEWLFFSPLDRKYPTGSRQNRSTIAGHWKATGKDRKIKSGKNN--------VIGLKRTL  119

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSS  584
            VF+ GRAPKG RTNW+MHEYRATE DL GT PGQ  FV+C LF K D    DEA    SS
Sbjct  120  VFHSGRAPKGTRTNWVMHEYRATEHDLSGTNPGQNPFVICKLFKKQDPSLVDEAV---SS  176

Query  585  PATNKSSPDDV  617
            P    SSPD+ 
Sbjct  177  PT---SSPDET  184



>ref|XP_009760821.1| PREDICTED: NAC domain-containing protein 74-like isoform X2 [Nicotiana 
sylvestris]
Length=418

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 152/216 (70%), Gaps = 17/216 (8%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING H +V VI EVD+CK+EP DLP LSV+++ D 
Sbjct  24   LNTLPVGYRFRPTDEELVNHYLRLKINGCHDKVAVIREVDICKFEPSDLPDLSVVESKDN  83

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            +WFFFCP+DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  84   DWFFFCPIDRKYQNGQRLNRATEQGYWKATGKDRNIVTKKGAK--------IGMKKTLVY  135

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRK--------CDEA  566
            Y GRAP+G+RTNW++HEYRAT+  LDG+  GQGAFVLC LF K++ ++         DE 
Sbjct  136  YIGRAPEGKRTNWVIHEYRATDKSLDGSHTGQGAFVLCRLFKKNELKQDENVESSHLDEV  195

Query  567  EPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKAN  674
            +   SSPA  K SPDD  S+    + +++    K N
Sbjct  196  QQLVSSPAVGK-SPDDEISDAVAPSPIMESDSDKRN  230



>ref|XP_009385839.1| PREDICTED: uncharacterized protein LOC103973093 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=717

 Score =   247 bits (630),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 15/211 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +++D+LPLGFRF+PTD+EL+++YL+ KI GR  S+++VIPE+DVCK EPWDLP  SV
Sbjct  1    MTLIALDSLPLGFRFQPTDEELVNYYLKPKITGRIRSQMEVIPEIDVCKCEPWDLPDKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IK+DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++ S G     + +IG+
Sbjct  61   IKSDDPEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRIIRSKSSAG----KSTIIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +V+  LF K + R    K D
Sbjct  117  KKTLVFHRGRAPKGARTHWIMHEYRTTEPEFESG--DQGGYVIYRLFRKLEQRISTSKAD  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLD  653
            E E +G SP+  KSSP D       EA ++D
Sbjct  175  EMETNGFSPSPIKSSPGDTQ----HEADVMD  201



>gb|EPS67213.1| hypothetical protein M569_07559 [Genlisea aurea]
Length=790

 Score =   248 bits (633),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/195 (63%), Positives = 143/195 (73%), Gaps = 16/195 (8%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWF  239
            +P+G+RFRPTD+ELI HYLR KING   EV VI E+DVCKWEPWDLP LSVI++ D EWF
Sbjct  11   MPVGYRFRPTDEELIDHYLRLKINGHEREVCVIREIDVCKWEPWDLPDLSVIESSDNEWF  70

Query  240  FFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKG  419
            FF P DRKY NG R NRAT  GYWKATGKDR I +RK +         IG+KKTLVFY G
Sbjct  71   FFSPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGSK--------IGMKKTLVFYTG  122

Query  420  RAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCD--------EAEPS  575
            RAP+G+RTNW++HEYRAT+  LDGT PGQGAFVLC LF K + +  D        EAE +
Sbjct  123  RAPEGKRTNWVIHEYRATDKSLDGTHPGQGAFVLCRLFKKMEIKLDDVLEVPNFPEAEEN  182

Query  576  GSSPATNKSSPDDVS  620
             SSPA NKS  +++S
Sbjct  183  VSSPAPNKSVDEELS  197



>ref|XP_009385838.1| PREDICTED: uncharacterized protein LOC103973093 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 157/211 (74%), Gaps = 15/211 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +++D+LPLGFRF+PTD+EL+++YL+ KI GR  S+++VIPE+DVCK EPWDLP  SV
Sbjct  1    MTLIALDSLPLGFRFQPTDEELVNYYLKPKITGRIRSQMEVIPEIDVCKCEPWDLPDKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            IK+DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++ S G     + +IG+
Sbjct  61   IKSDDPEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRIIRSKSSAG----KSTIIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +V+  LF K + R    K D
Sbjct  117  KKTLVFHRGRAPKGARTHWIMHEYRTTEPEFESG--DQGGYVIYRLFRKLEQRISTSKAD  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLD  653
            E E +G SP+  KSSP D       EA ++D
Sbjct  175  EMETNGFSPSPIKSSPGDTQ----HEADVMD  201



>gb|EYU45332.1| hypothetical protein MIMGU_mgv1a003123mg [Erythranthe guttata]
Length=606

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 136/185 (74%), Gaps = 8/185 (4%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L   ALP+G+RFRPTD+ELI HYLR KIN    +V VI E+DVCKWEPWDLP +SVI
Sbjct  1    MTVLPAKALPVGYRFRPTDEELIDHYLRLKINRHDKDVSVIREIDVCKWEPWDLPDMSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            ++ D EWFFFCP DRKY NG R NRAT  GYWKATGKDR I +RK           IG+K
Sbjct  61   ESFDNEWFFFCPKDRKYQNGQRLNRATEKGYWKATGKDRNITSRKGAK--------IGMK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            KTLVFY GRAP G+RTNW++HEYRAT+  LDGT PGQGAFVL  LF K++ ++ + AE S
Sbjct  113  KTLVFYTGRAPDGKRTNWVIHEYRATDKSLDGTHPGQGAFVLLRLFRKAELKQDEIAESS  172

Query  576  GSSPA  590
              + A
Sbjct  173  NINEA  177



>ref|XP_008783552.1| PREDICTED: uncharacterized protein LOC103702771 [Phoenix dactylifera]
Length=672

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 147/203 (72%), Gaps = 20/203 (10%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ L  ++LPLGFRFRPTD+EL++HYL+ KINGR +SEV VIPEVDVCK EPWDLP  S+
Sbjct  1    MTVLPPESLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPEVDVCKCEPWDLPDKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IKT+  + S      LIG+
Sbjct  61   IRSDDPEWFFFTPRDRKYPNGHRANRATEAGYWKATGKDRMIKTKPPSPS------LIGM  114

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD---------  545
            KKTLVFY+GRAP G R+NWIMHEYR +E + D     QG+FVLC LF K +         
Sbjct  115  KKTLVFYRGRAPNGVRSNWIMHEYRTSESEFDSGE--QGSFVLCRLFKKPEESSASSNVD  172

Query  546  --DRKCDEAEPSGSSPATNKSSP  608
              +R   + E SG SP   +SSP
Sbjct  173  GVERNVGKMESSGLSPTPIRSSP  195



>ref|NP_001274765.1| uncharacterized LOC102593794 [Solanum tuberosum]
 gb|AGY49284.1| putative membrane bound NAC transcription factor 1 [Solanum tuberosum]
Length=639

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 146/206 (71%), Gaps = 10/206 (5%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING  S+V VI EVD+CK EPWDLP LSV+++ D 
Sbjct  25   LNTLPVGYRFRPTDEELVNHYLRLKINGADSQVSVIREVDICKLEPWDLPDLSVVESHDN  84

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  85   EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAK--------IGMKKTLVY  136

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSSPA  590
            Y GRAP+G+RT+W++HEYRATE  LDG+ PGQGAFVLC LF K+D ++ +  E S     
Sbjct  137  YIGRAPEGKRTHWVIHEYRATEKSLDGSHPGQGAFVLCRLFRKNDLKQDEHVENSNLDAE  196

Query  591  TNKSSPDDVSSNLFQEAA--LLDRQP  662
             N S     + +   EAA  L+  QP
Sbjct  197  QNASVDKSPAEDELSEAATPLMVIQP  222



>ref|XP_009760820.1| PREDICTED: uncharacterized protein LOC104213101 isoform X1 [Nicotiana 
sylvestris]
Length=645

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 152/216 (70%), Gaps = 17/216 (8%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING H +V VI EVD+CK+EP DLP LSV+++ D 
Sbjct  24   LNTLPVGYRFRPTDEELVNHYLRLKINGCHDKVAVIREVDICKFEPSDLPDLSVVESKDN  83

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            +WFFFCP+DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  84   DWFFFCPIDRKYQNGQRLNRATEQGYWKATGKDRNIVTKKGAK--------IGMKKTLVY  135

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRK--------CDEA  566
            Y GRAP+G+RTNW++HEYRAT+  LDG+  GQGAFVLC LF K++ ++         DE 
Sbjct  136  YIGRAPEGKRTNWVIHEYRATDKSLDGSHTGQGAFVLCRLFKKNELKQDENVESSHLDEV  195

Query  567  EPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKAN  674
            +   SSPA  K SPDD  S+    + +++    K N
Sbjct  196  QQLVSSPAVGK-SPDDEISDAVAPSPIMESDSDKRN  230



>gb|AGY49286.1| putative membrane bound NAC transcription factor 1 [Nicotiana 
benthamiana]
Length=630

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING  SEV VI EVD+CK EPWDLP +SV++++D 
Sbjct  25   LNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEPWDLPDMSVVESNDN  84

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  85   EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIATKKGAK--------IGMKKTLVY  136

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            Y GRAP+G+RT+W++HEYRAT+  LDG+ PGQGAFVLC LF K+D ++ +  E S
Sbjct  137  YIGRAPEGKRTHWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNDLKQDEHVESS  191



>ref|XP_010318064.1| PREDICTED: uncharacterized protein LOC101253566 [Solanum lycopersicum]
Length=644

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 143/198 (72%), Gaps = 8/198 (4%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING  S+V VI EVD+CK EPWDLP LSV+++ D 
Sbjct  25   LNTLPVGYRFRPTDEELVNHYLRLKINGADSQVSVIREVDICKLEPWDLPDLSVVESHDN  84

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I T+K +         IG+KKTLV+
Sbjct  85   EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGSK--------IGMKKTLVY  136

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSSPA  590
            Y GRAP+G+RT+W++HEYRATE  LDG+ PGQGAFVLC LF K+D ++ +  + S     
Sbjct  137  YIGRAPEGKRTHWVIHEYRATEKSLDGSHPGQGAFVLCRLFRKNDLKQDEHVDNSNLDAE  196

Query  591  TNKSSPDDVSSNLFQEAA  644
             N S     + +   EAA
Sbjct  197  QNASVDKSPAEDELSEAA  214



>ref|XP_009759914.1| PREDICTED: uncharacterized protein LOC104212382 [Nicotiana sylvestris]
Length=640

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 8/175 (5%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING  SEV VI EVD+CK EPWDLP +SV+++ D 
Sbjct  25   LNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEPWDLPDMSVVESKDN  84

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  85   EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIATKKGAK--------IGMKKTLVY  136

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            Y GRAP+G+RT+W++HEYRAT+  LDG+ PGQGAFVLC LF K+D ++ +  E S
Sbjct  137  YIGRAPEGKRTHWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNDLKQDEHVESS  191



>ref|XP_009608176.1| PREDICTED: uncharacterized protein LOC104102223 [Nicotiana tomentosiformis]
Length=636

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING  SEV VI EVD+CK EPWDLP +SV++++D 
Sbjct  25   LNTLPVGYRFRPTDEELVNHYLRLKINGADSEVSVIREVDICKLEPWDLPDMSVVESNDN  84

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  85   EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAK--------IGMKKTLVY  136

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            Y GRAP+G+RT+W++HEYRAT+  LDG+ PGQGAFVLC LF K+D ++ +  E S
Sbjct  137  YIGRAPEGKRTHWVIHEYRATDKSLDGSHPGQGAFVLCRLFRKNDLKQDEHVESS  191



>gb|AAM47025.1| nam-like protein 1 [Petunia x hybrida]
Length=585

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 141/192 (73%), Gaps = 12/192 (6%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            +++LP+G+RFRPTD+EL++HYLR KING  +EV VI EVD+CK EPWDLP  SV++++D 
Sbjct  24   LNSLPVGYRFRPTDEELVNHYLRLKINGADNEVSVIREVDICKLEPWDLPIWSVVESNDN  83

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            EWFFFCP DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  84   EWFFFCPKDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAK--------IGMKKTLVY  135

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS----G  578
            Y GRAP+G+RT+W++HEYRAT+  LDGT PGQGAF+LC LF K+D ++ +  E S     
Sbjct  136  YIGRAPEGKRTHWVIHEYRATDKSLDGTHPGQGAFLLCRLFRKNDLKQDEHVESSNLDDA  195

Query  579  SSPATNKSSPDD  614
               AT   SP D
Sbjct  196  EQNATAAKSPTD  207



>gb|AGV29473.1| putative NAC domain class transcription factor [Tamarix hispida]
Length=547

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 135/183 (74%), Gaps = 9/183 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L    LPLGFRF+PTD ELI HYLR KI G H +V VI EVDVCK EPWDLP LS+I
Sbjct  1    MAVLPFQNLPLGFRFKPTDVELIDHYLRLKIKGNHRDVSVIREVDVCKVEPWDLPDLSMI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+ D EWFFFC  DRKYPNG R NRAT  GYWKATGKDR I +RK          LIG+K
Sbjct  61   KSPDHEWFFFCARDRKYPNGQRSNRATEKGYWKATGKDRRIVSRK--------MGLIGMK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPS  575
            KTLVFY+GRAPKG+RT+W++HEYR T  +LDGT PGQG++V+C LF K +D K  E E  
Sbjct  113  KTLVFYRGRAPKGKRTHWVIHEYRTTLDELDGTHPGQGSYVICRLFEKQEDCK-KEDEND  171

Query  576  GSS  584
            G+S
Sbjct  172  GAS  174



>emb|CDP04976.1| unnamed protein product [Coffea canephora]
Length=631

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 141/211 (67%), Gaps = 16/211 (8%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ L +  LP+G+RFRPTD+ELI HYLR KING   +V +I EVD+CK EPWDLP LS I
Sbjct  2    MTVLPVKQLPVGYRFRPTDEELIDHYLRLKINGLDKDVSIIREVDICKKEPWDLPDLSPI  61

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K+ D EWFFFCP DRKY NG R NRAT  GYWKATGKDR I+ RK T         IG+K
Sbjct  62   KSYDNEWFFFCPKDRKYQNGQRLNRATMKGYWKATGKDRNIRARKGTK--------IGMK  113

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHK--------SDDR  551
            KTLVFY GRAP G+RTNW++HEYRAT  +LDGT PGQG+FVLC LF K        +D  
Sbjct  114  KTLVFYIGRAPDGKRTNWVIHEYRATNKELDGTHPGQGSFVLCRLFKKHELKQDETADGS  173

Query  552  KCDEAEPSGSSPATNKSSPDDVSSNLFQEAA  644
               E E    SP T KS  +D +S      A
Sbjct  174  NLVEVETIVPSPTTEKSPLEDGNSEALTPVA  204



>ref|XP_002445085.1| hypothetical protein SORBIDRAFT_07g003900 [Sorghum bicolor]
 gb|EES14580.1| hypothetical protein SORBIDRAFT_07g003900 [Sorghum bicolor]
Length=663

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 152/219 (69%), Gaps = 11/219 (5%)
 Frame = +3

Query  30   AGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSL  206
            A  + + +  LPLGFRF PTD+EL++HYL+ KI G+ +SE +VIPE+DVCK EPWDLP  
Sbjct  2    AKTAVMELRTLPLGFRFHPTDEELVTHYLKGKITGQINSEAEVIPEIDVCKCEPWDLPDK  61

Query  207  SVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLI  386
            S+I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK++     D+     I
Sbjct  62   SIIQSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSK----GDKRKQHTI  117

Query  387  GIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----K  554
            G+KKTLVF++GRAPKGERT WIMHEYR TEP  D     QG +VL  LF K +++     
Sbjct  118  GMKKTLVFHRGRAPKGERTGWIMHEYRTTEPQFDSGE--QGGYVLYRLFRKQEEKTERPS  175

Query  555  CDEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKA  671
             +E + SG SP  ++SSPD++  N      L    P+ A
Sbjct  176  PEEMDRSGYSPTPSRSSPDNLEVNEEANTPLNKESPESA  214



>ref|XP_008808290.1| PREDICTED: uncharacterized protein LOC103720389 [Phoenix dactylifera]
Length=609

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 157/229 (69%), Gaps = 23/229 (10%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ L +++LP GFRF PTD+EL++HYL+ KINGR +SEV VIPEVDVCK EPWDLP  SV
Sbjct  1    MAVLPLESLPRGFRFHPTDEELVNHYLKGKINGRINSEVVVIPEVDVCKCEPWDLPDKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYP+G+R NRAT AGYWKATG+DR IKT K  GS      +IG+
Sbjct  61   IRSDDPEWFFFSPRDRKYPSGHRSNRATKAGYWKATGRDRMIKT-KPPGS-----TIIGM  114

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD---------  545
            KKTLVF++GRAPKG RTNWI+HEYR TE + D     QG+FVLC LF K +         
Sbjct  115  KKTLVFHRGRAPKGVRTNWIIHEYRTTEFEFDSGE--QGSFVLCRLFKKPEEKSPSSIVD  172

Query  546  --DRKCDEAEPSGSSPATNKSSPDDV---SSNLFQEAALLDRQPQKANV  677
              D   DE E  G SP   +  P +    +  L + AALL+ Q  + N+
Sbjct  173  GVDGNVDEMESGGLSPTPTRFLPGETQQGTDTLEEFAALLNFQDMQENL  221



>ref|XP_006659850.1| PREDICTED: uncharacterized protein LOC102700454 [Oryza brachyantha]
Length=698

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 148/202 (73%), Gaps = 11/202 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + +  LPLGFRF PTD+EL+ HYL+ KI G+  +E +VIPE+DVCK EPWDLP  S+
Sbjct  1    MTVMELKKLPLGFRFHPTDEELVRHYLKGKITGQIRAEAEVIPEIDVCKCEPWDLPDKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++     D+    +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSK----GDKKKQQVIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF K +++      D
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFRKQEEKIERPSPD  174

Query  561  EAEPSGSSPATNKSSPDDVSSN  626
            E + SG SP  ++S+PD++  N
Sbjct  175  EMDRSGYSPTPSRSTPDNIEPN  196



>ref|XP_009596681.1| PREDICTED: NAC domain-containing protein 74-like [Nicotiana tomentosiformis]
Length=638

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 145/198 (73%), Gaps = 16/198 (8%)
 Frame = +3

Query  51   MDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTDDP  230
            ++ LP+G+RFRPTD+EL++HYLR KING   +V VI EVD+CK+EP DLP LSV+++ D 
Sbjct  24   LNTLPVGYRFRPTDEELVNHYLRLKINGCDDKVGVIREVDICKFEPSDLPDLSVVESKDN  83

Query  231  EWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVF  410
            +WFFFCP+DRKY NG R NRAT  GYWKATGKDR I T+K           IG+KKTLV+
Sbjct  84   DWFFFCPIDRKYQNGQRLNRATERGYWKATGKDRNIVTKKGAK--------IGMKKTLVY  135

Query  411  YKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRK--------CDEA  566
            Y GRAP+G+RTNW++HEYRAT+  LDG+ PGQGAFVLC LF K++ ++         DE 
Sbjct  136  YIGRAPEGKRTNWVIHEYRATDKSLDGSHPGQGAFVLCRLFKKNELKQDENVESSHLDEV  195

Query  567  EPSGSSPATNKSSPDDVS  620
            +   SSPA  KS  +++S
Sbjct  196  QQLVSSPAVGKSPGNEIS  213



>gb|EEC82928.1| hypothetical protein OsI_27885 [Oryza sativa Indica Group]
Length=738

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 154/227 (68%), Gaps = 11/227 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + +  LPLGFRF PTD+EL+ HYL+ KI G+  SE  VIPE+DVCK EPWDLP  S+
Sbjct  1    MTVMELKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++     D+    +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSK----GDKKKQQVIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF K +++      D
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFRKQEEKIERPSPD  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            E + SG SP  ++S+PD++         L    P+ A   S + LP 
Sbjct  175  EVDRSGYSPTPSRSTPDNMEPIEDGNTPLNRESPESALHESPIDLPA  221



>ref|NP_001061034.1| Os08g0157900 [Oryza sativa Japonica Group]
 dbj|BAC99653.1| NAC2 protein-like [Oryza sativa Japonica Group]
 dbj|BAF22948.1| Os08g0157900 [Oryza sativa Japonica Group]
 gb|ACJ54898.1| NAC2 protein [Oryza sativa Japonica Group]
 gb|EEE68077.1| hypothetical protein OsJ_26109 [Oryza sativa Japonica Group]
Length=729

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/227 (53%), Positives = 154/227 (68%), Gaps = 11/227 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + +  LPLGFRF PTD+EL+ HYL+ KI G+  SE  VIPE+DVCK EPWDLP  S+
Sbjct  1    MTVMELKKLPLGFRFHPTDEELVRHYLKGKITGQIRSEADVIPEIDVCKCEPWDLPDKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++     D+    +IG+
Sbjct  61   IRSDDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIRSK----GDKKKQQVIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF K +++      D
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFRKQEEKIERPSPD  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQPQKANVTSIVMLPV  701
            E + SG SP  ++S+PD++         L    P+ A   S + LP 
Sbjct  175  EVDRSGYSPTPSRSTPDNMEPIEDGNTPLNRESPESALHESPIDLPA  221



>gb|EMS48745.1| NAC domain-containing protein 78 [Triticum urartu]
Length=722

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 154/210 (73%), Gaps = 13/210 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + + ALPLGFRF PTD+EL+ HYL+ KI G+  +EV+VIPE+DVCK EPWDLP  ++
Sbjct  1    MTVMELKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKAL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+++DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK++     ++    +IG+
Sbjct  61   IRSEDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSK----GEKKKQHMIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKC----D  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF K  ++      +
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQKQLEKTERSIPE  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALL  650
            E + SG SP  ++S+PD++ +N  +EA  L
Sbjct  175  EMDRSGYSPTPSRSTPDNMEAN--EEAITL  202



>ref|XP_010234378.1| PREDICTED: uncharacterized protein LOC100838012 [Brachypodium 
distachyon]
Length=800

 Score =   239 bits (611),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 161/220 (73%), Gaps = 14/220 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + +  LPLGFRF PTD+EL+ HYL+ KI G+ ++EV+VIPE+DVCK EPWDLP  S+
Sbjct  1    MTVMELKTLPLGFRFHPTDEELVRHYLKGKITGQINAEVEVIPEIDVCKCEPWDLPDKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+++DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK++     ++    +IG+
Sbjct  61   IRSEDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRIIKSK----GEKKKQHMIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFH----KSDDRKCD  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF     KS+    D
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQKQVEKSERSSPD  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEA-ALLDRQPQKANV  677
            E + SG SP  ++S+PD++ +N  +EA  LL+++  ++ V
Sbjct  175  EMDRSGYSPTPSRSTPDNMEAN--EEAITLLNKESPESGV  212



>gb|EMT07892.1| NAC domain-containing protein 78 [Aegilops tauschii]
Length=694

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 154/210 (73%), Gaps = 13/210 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + + ALPLGFRF PTD+EL+ HYL+ KI G+  +EV+VIPE+DVCK EPWDLP  ++
Sbjct  1    MTVMELKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKAL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+++DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK++     ++    +IG+
Sbjct  61   IRSEDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSK----GEKKKQHMIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKC----D  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF K  ++      +
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQKQLEKTERSIPE  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALL  650
            E + SG SP  ++S+PD++ +N  +EA  L
Sbjct  175  EMDRSGYSPTPSRSTPDNMEAN--EEAITL  202



>dbj|BAJ97142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=704

 Score =   238 bits (607),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 116/210 (55%), Positives = 154/210 (73%), Gaps = 13/210 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ + + ALPLGFRF PTD+EL+ HYL+ KI G+  +EV+VIPE+DVCK EPWDLP  ++
Sbjct  1    MTVMELKALPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPDKAL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+++DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR IK++     ++    +IG+
Sbjct  61   IRSEDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSK----GEKKKQHMIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKC----D  560
            KKTLVF++GRAPKGERT WIMHEYR TEP+ +     QG +VL  LF K  ++      +
Sbjct  117  KKTLVFHRGRAPKGERTGWIMHEYRTTEPEFESGE--QGGYVLYRLFQKQVEKTERSIPE  174

Query  561  EAEPSGSSPATNKSSPDDVSSNLFQEAALL  650
            E + SG SP  ++S+PD++ +N  +EA  L
Sbjct  175  EMDRSGYSPTPSRSTPDNMEAN--EEAITL  202



>ref|XP_010934041.1| PREDICTED: uncharacterized protein LOC105054253 isoform X2 [Elaeis 
guineensis]
Length=684

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 156/235 (66%), Gaps = 25/235 (11%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ L  ++LPLGFRFRPTD+EL++HYL+ KINGR +SEV VIP+VDVCK EPWDLP  SV
Sbjct  1    MAVLLPESLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPDVDVCKCEPWDLPDKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYP G+R NRAT AGYWKATG+DR IKT+           LIG+
Sbjct  61   IRSDDPEWFFFSPRDRKYPTGHRANRATEAGYWKATGRDRMIKTKP------PGAILIGM  114

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--------  548
            KKTLVFY+GRAP G RTNWIMHEYR +E + D     QG+FVLC LF K +D        
Sbjct  115  KKTLVFYRGRAPHGVRTNWIMHEYRTSESEFDSGE--QGSFVLCRLFKKPEDKSASSNVD  172

Query  549  ---RKCDEAEPSGSSPATNKSSPDDV--SSNLFQEAALLDRQPQ---KANVTSIV  689
               R   + E S  SP   + +P +    +   QE  L+   P+   + N+ ++V
Sbjct  173  GVERNVGKMESSCLSPTPVRPAPGETQHGTGTLQEFHLIQELPEPDMQENLQTLV  227



>ref|XP_010934040.1| PREDICTED: uncharacterized protein LOC105054253 isoform X1 [Elaeis 
guineensis]
Length=685

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 156/235 (66%), Gaps = 25/235 (11%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ L  ++LPLGFRFRPTD+EL++HYL+ KINGR +SEV VIP+VDVCK EPWDLP  SV
Sbjct  1    MAVLLPESLPLGFRFRPTDEELVNHYLKGKINGRINSEVVVIPDVDVCKCEPWDLPDKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYP G+R NRAT AGYWKATG+DR IKT+           LIG+
Sbjct  61   IRSDDPEWFFFSPRDRKYPTGHRANRATEAGYWKATGRDRMIKTKP------PGAILIGM  114

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--------  548
            KKTLVFY+GRAP G RTNWIMHEYR +E + D     QG+FVLC LF K +D        
Sbjct  115  KKTLVFYRGRAPHGVRTNWIMHEYRTSESEFDSGE--QGSFVLCRLFKKPEDKSASSNVD  172

Query  549  ---RKCDEAEPSGSSPATNKSSPDDV--SSNLFQEAALLDRQPQ---KANVTSIV  689
               R   + E S  SP   + +P +    +   QE  L+   P+   + N+ ++V
Sbjct  173  GVERNVGKMESSCLSPTPVRPAPGETQHGTGTLQEFHLIQELPEPDMQENLQTLV  227



>ref|XP_010941181.1| PREDICTED: uncharacterized protein LOC105059551 isoform X2 [Elaeis 
guineensis]
Length=730

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 147/199 (74%), Gaps = 11/199 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ ++++ LPLGFRF PTD+EL++HYL+RKI GR  S+V+VIPEVDVCK EPWDLP  S+
Sbjct  1    MTAIALELLPLGFRFHPTDEELVNHYLKRKITGRIKSDVEVIPEVDVCKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DD EWFFF P DRKY NG+R NRAT AGYWKATGKDR I+++ +         +IG+
Sbjct  61   IRSDDLEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHN----VIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +VL  LF KS+++    K D
Sbjct  117  KKTLVFHRGRAPKGIRTHWIMHEYRTTEPEFESGV--QGGYVLYRLFKKSEEKSSNAKAD  174

Query  561  EAEPSGSSPATNKSSPDDV  617
            E + S  SP   K SPDD 
Sbjct  175  EMDRSCFSPTPAKLSPDDT  193



>ref|XP_009397631.1| PREDICTED: uncharacterized protein LOC103982434 [Musa acuminata 
subsp. malaccensis]
Length=640

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/245 (52%), Positives = 162/245 (66%), Gaps = 32/245 (13%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPS-LS  209
            M  +S+++LPLGFRFRPTD EL++HYL+ KI GR  SE++VIPE+DVCK EPWD+P+  S
Sbjct  1    MDAVSVESLPLGFRFRPTDAELVNHYLKGKITGRIKSEIEVIPEIDVCKCEPWDVPADKS  60

Query  210  VIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIG  389
            +IK+ DPEWFFF P DRKYP+GNR NRAT AGYWKATGKDR IK+R S GS      ++G
Sbjct  61   LIKSIDPEWFFFSPKDRKYPSGNRSNRATEAGYWKATGKDRTIKSR-SPGS-----MILG  114

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD--------  545
            +KKTLVF++GRAPKG RTNWIMHEYR TEP+ +     QG +VLC LF K +        
Sbjct  115  MKKTLVFHRGRAPKGVRTNWIMHEYRTTEPEYESGE--QGGYVLCRLFRKPEEQTLVSEI  172

Query  546  ----DRKCDEAEPSGSSPATNKSSP----------DDVSSNLFQEAALLDRQPQKANVTS  683
                ++  DE E +G SP+    SP          ++V ++L Q    LD Q     +  
Sbjct  173  NDCMEKNVDEMESTGLSPSPTIVSPGETQHGSEAAEEVLTSLNQNLTGLDLQENLQPLPR  232

Query  684  IVMLP  698
            I  +P
Sbjct  233  IFEMP  237



>ref|XP_010941180.1| PREDICTED: uncharacterized protein LOC105059551 isoform X1 [Elaeis 
guineensis]
Length=733

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 147/199 (74%), Gaps = 11/199 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ ++++ LPLGFRF PTD+EL++HYL+RKI GR  S+V+VIPEVDVCK EPWDLP  S+
Sbjct  1    MTAIALELLPLGFRFHPTDEELVNHYLKRKITGRIKSDVEVIPEVDVCKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DD EWFFF P DRKY NG+R NRAT AGYWKATGKDR I+++ +         +IG+
Sbjct  61   IRSDDLEWFFFAPKDRKYANGHRSNRATEAGYWKATGKDRVIRSKAAAAGHN----VIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT+WIMHEYR TEP+ +     QG +VL  LF KS+++    K D
Sbjct  117  KKTLVFHRGRAPKGIRTHWIMHEYRTTEPEFESGV--QGGYVLYRLFKKSEEKSSNAKAD  174

Query  561  EAEPSGSSPATNKSSPDDV  617
            E + S  SP   K SPDD 
Sbjct  175  EMDRSCFSPTPAKLSPDDT  193



>ref|XP_009391051.1| PREDICTED: uncharacterized protein LOC103977297 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391052.1| PREDICTED: uncharacterized protein LOC103977297 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=723

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 145/197 (74%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +++ +LPLGFRF PTD+EL++HYL+RKI GR  SE+QVIPE+DVCK EPWDLP  S+
Sbjct  1    MAAIALASLPLGFRFHPTDEELVNHYLKRKITGRIKSEMQVIPEIDVCKCEPWDLPEKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+++DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++ S     + + +IG+
Sbjct  61   IRSNDPEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRVIRSKSSA----AKSTIIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAP G RTNWIMHEYR TE  L+     QG +VL  LF K ++R      +
Sbjct  117  KKTLVFHRGRAPHGVRTNWIMHEYRTTE--LEFESGDQGGYVLYRLFKKPEERISSTNAE  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E +G SP   +   D
Sbjct  175  EMEVNGFSPGDTQHDAD  191



>ref|XP_009391053.1| PREDICTED: uncharacterized protein LOC103977297 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=721

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 145/197 (74%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ +++ +LPLGFRF PTD+EL++HYL+RKI GR  SE+QVIPE+DVCK EPWDLP  S+
Sbjct  1    MAAIALASLPLGFRFHPTDEELVNHYLKRKITGRIKSEMQVIPEIDVCKCEPWDLPEKSL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I+++DPEWFFF P DRKYPNG+R NRAT AGYWKATGKDR I+++ S     + + +IG+
Sbjct  61   IRSNDPEWFFFAPKDRKYPNGHRSNRATEAGYWKATGKDRVIRSKSSA----AKSTIIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAP G RTNWIMHEYR TE  L+     QG +VL  LF K ++R      +
Sbjct  117  KKTLVFHRGRAPHGVRTNWIMHEYRTTE--LEFESGDQGGYVLYRLFKKPEERISSTNAE  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E +G SP   +   D
Sbjct  175  EMEVNGFSPGDTQHDAD  191



>ref|XP_006846446.1| hypothetical protein AMTR_s00018p00071850 [Amborella trichopoda]
 gb|ERN08121.1| hypothetical protein AMTR_s00018p00071850 [Amborella trichopoda]
Length=567

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 139/197 (71%), Gaps = 14/197 (7%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +S+++LP GFRFRP+D+EL+S+YL RKING    V VIPE+D+CK EPWDLP  S+I
Sbjct  1    MAAVSLESLPPGFRFRPSDEELVSYYLIRKING-GGGVDVIPEIDMCKCEPWDLPGKSII  59

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT+DPEWFFFCP DRKYPNG R NRAT AGYWKATGKDR IK++       S   LIG K
Sbjct  60   KTEDPEWFFFCPRDRKYPNGRRSNRATEAGYWKATGKDRTIKSK-------SRRSLIGTK  112

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLF------HKSDDRKC  557
            KTLVFY+GRAP G+RT+WIMHEYRA    L      Q A+VLC LF       K +D   
Sbjct  113  KTLVFYEGRAPHGKRTHWIMHEYRANGNALQDLNGSQDAYVLCRLFKKDGLNEKGNDPSY  172

Query  558  DEAEPSGSSPATNKSSP  608
            D  E S  SP  +KSSP
Sbjct  173  DVVERSDLSPDPSKSSP  189



>ref|XP_010919012.1| PREDICTED: uncharacterized protein LOC105043241 isoform X2 [Elaeis 
guineensis]
Length=573

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 149/220 (68%), Gaps = 24/220 (11%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRF PTD+EL+++YL+ KINGR +SEV VIPEVDVCK EPW+LP  SV
Sbjct  1    MVVLPLESLPLGFRFHPTDEELVNYYLKGKINGRINSEVVVIPEVDVCKSEPWELPGKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATG+DR IKTR         + +IG+
Sbjct  61   IRSDDPEWFFFSPRDRKYPNGHRSNRATDAGYWKATGRDRTIKTRP------PGSTIIGM  114

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD---------  545
            KKTLVF+ GRAPKG RT WIMHEYR TE + D     QG+FVLC LF K +         
Sbjct  115  KKTLVFHLGRAPKGVRTYWIMHEYRTTESEFDSGE--QGSFVLCRLFKKPEEKSPSSNVG  172

Query  546  --DRKCDEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
              D   DE E S  SP       D     L + AALL+++
Sbjct  173  AIDGNVDEMESSFLSPGETPQGTD----TLEEFAALLNQE  208



>ref|XP_010919011.1| PREDICTED: uncharacterized protein LOC105043241 isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/220 (56%), Positives = 149/220 (68%), Gaps = 24/220 (11%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  L +++LPLGFRF PTD+EL+++YL+ KINGR +SEV VIPEVDVCK EPW+LP  SV
Sbjct  1    MVVLPLESLPLGFRFHPTDEELVNYYLKGKINGRINSEVVVIPEVDVCKSEPWELPGKSV  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKYPNG+R NRAT AGYWKATG+DR IKTR         + +IG+
Sbjct  61   IRSDDPEWFFFSPRDRKYPNGHRSNRATDAGYWKATGRDRTIKTRP------PGSTIIGM  114

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSD---------  545
            KKTLVF+ GRAPKG RT WIMHEYR TE + D     QG+FVLC LF K +         
Sbjct  115  KKTLVFHLGRAPKGVRTYWIMHEYRTTESEFDSGE--QGSFVLCRLFKKPEEKSPSSNVG  172

Query  546  --DRKCDEAEPSGSSPATNKSSPDDVSSNLFQEAALLDRQ  659
              D   DE E S  SP       D     L + AALL+++
Sbjct  173  AIDGNVDEMESSFLSPGETPQGTD----TLEEFAALLNQE  208



>ref|XP_002268892.1| PREDICTED: NAC transcription factor NAM-B1-like isoform X3 [Vitis 
vinifera]
Length=560

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 128/175 (73%), Gaps = 11/175 (6%)
 Frame = +3

Query  24   SKAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPS  203
            S  GM G++ ++LP+GFRF PTD+EL+ HYL+ KI G +S V +IPEVDVCKWEPWDLP 
Sbjct  2    SGGGMIGMASESLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPV  61

Query  204  LSVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPL  383
            LSVI+T+DPEWFFFCP D KYP G R NRAT AGYWK TGKDR IK+R       +   L
Sbjct  62   LSVIQTNDPEWFFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSR-------ATKEL  114

Query  384  IGIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD  548
            +G KKTLVFY+GRAP+  RTNW+MHEYRA    L    P   A+VLC L  K+D+
Sbjct  115  LGTKKTLVFYRGRAPQSVRTNWVMHEYRAAIASL----PANKAYVLCRLKRKTDE  165



>ref|XP_010661534.1| PREDICTED: uncharacterized protein LOC100252386 isoform X1 [Vitis 
vinifera]
Length=584

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 128/175 (73%), Gaps = 11/175 (6%)
 Frame = +3

Query  24   SKAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPS  203
            S  GM G++ ++LP+GFRF PTD+EL+ HYL+ KI G +S V +IPEVDVCKWEPWDLP 
Sbjct  2    SGGGMIGMASESLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPV  61

Query  204  LSVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPL  383
            LSVI+T+DPEWFFFCP D KYP G R NRAT AGYWK TGKDR IK+R       +   L
Sbjct  62   LSVIQTNDPEWFFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSR-------ATKEL  114

Query  384  IGIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD  548
            +G KKTLVFY+GRAP+  RTNW+MHEYRA    L    P   A+VLC L  K+D+
Sbjct  115  LGTKKTLVFYRGRAPQSVRTNWVMHEYRAAIASL----PANKAYVLCRLKRKTDE  165



>ref|XP_010661535.1| PREDICTED: uncharacterized protein LOC100252386 isoform X2 [Vitis 
vinifera]
Length=573

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 128/175 (73%), Gaps = 11/175 (6%)
 Frame = +3

Query  24   SKAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPS  203
            S  GM G++ ++LP+GFRF PTD+EL+ HYL+ KI G +S V +IPEVDVCKWEPWDLP 
Sbjct  2    SGGGMIGMASESLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPV  61

Query  204  LSVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPL  383
            LSVI+T+DPEWFFFCP D KYP G R NRAT AGYWK TGKDR IK+R       +   L
Sbjct  62   LSVIQTNDPEWFFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSR-------ATKEL  114

Query  384  IGIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD  548
            +G KKTLVFY+GRAP+  RTNW+MHEYRA    L    P   A+VLC L  K+D+
Sbjct  115  LGTKKTLVFYRGRAPQSVRTNWVMHEYRAAIASL----PANKAYVLCRLKRKTDE  165



>emb|CBI38740.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 126/176 (72%), Gaps = 11/176 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVIKTD  224
            ++ ++LP+GFRF PTD+EL+ HYL+ KI G +S V +IPEVDVCKWEPWDLP LSVI+T+
Sbjct  1    MASESLPVGFRFHPTDEELVDHYLKLKILGMNSHVDIIPEVDVCKWEPWDLPVLSVIQTN  60

Query  225  DPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTL  404
            DPEWFFFCP D KYP G R NRAT AGYWK TGKDR IK+R       +   L+G KKTL
Sbjct  61   DPEWFFFCPPDYKYPTGRRSNRATEAGYWKPTGKDRNIKSR-------ATKELLGTKKTL  113

Query  405  VFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEP  572
            VFY+GRAP+  RTNW+MHEYRA    L    P   A+VLC L  K+D+    +  P
Sbjct  114  VFYRGRAPQSVRTNWVMHEYRAAIASL----PANKAYVLCRLKRKTDENTGPDIPP  165



>ref|XP_008662159.1| PREDICTED: putative NAC domain transcription factor superfamily 
protein isoform X1 [Zea mays]
Length=665

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKT  221
            +++ ALP+GFRF PTD+EL+SHYL+ KI G+ +SE +VIPE+D+CK EPWDLP  S+I++
Sbjct  1    MALWALPVGFRFHPTDEELVSHYLKGKITGQINSEAEVIPEIDICKCEPWDLPGKSLIRS  60

Query  222  DDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKT  401
            DDPEWFF  P DRKYPNG+R NRAT AGYWKATG DR IK++     D+S    IG KKT
Sbjct  61   DDPEWFFLAPKDRKYPNGSRSNRATVAGYWKATGPDRNIKSK----GDKSKQFTIGKKKT  116

Query  402  LVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAE  569
            LVF++GRAPKGERT WIMHEYR TEP  +  +  QG +VL  LF K +++       E +
Sbjct  117  LVFHRGRAPKGERTGWIMHEYRTTEPQFESGK--QGGYVLYRLFWKPEEKTERSSPKEMD  174

Query  570  PSGSSPATNKSSPDDVSSN  626
             SG+SP T +SS D+  +N
Sbjct  175  RSGNSPTTIRSSRDNQEAN  193



>ref|XP_008662161.1| PREDICTED: putative NAC domain transcription factor superfamily 
protein isoform X3 [Zea mays]
 gb|AIB05524.1| NAC transcription factor, partial [Zea mays]
Length=657

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKT  221
            +++ ALP+GFRF PTD+EL+SHYL+ KI G+ +SE +VIPE+D+CK EPWDLP  S+I++
Sbjct  1    MALWALPVGFRFHPTDEELVSHYLKGKITGQINSEAEVIPEIDICKCEPWDLPGKSLIRS  60

Query  222  DDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKT  401
            DDPEWFF  P DRKYPNG+R NRAT AGYWKATG DR IK++     D+S    IG KKT
Sbjct  61   DDPEWFFLAPKDRKYPNGSRSNRATVAGYWKATGPDRNIKSK----GDKSKQFTIGKKKT  116

Query  402  LVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAE  569
            LVF++GRAPKGERT WIMHEYR TEP  +  +  QG +VL  LF K +++       E +
Sbjct  117  LVFHRGRAPKGERTGWIMHEYRTTEPQFESGK--QGGYVLYRLFWKPEEKTERSSPKEMD  174

Query  570  PSGSSPATNKSSPDDVSSN  626
             SG+SP T +SS D+  +N
Sbjct  175  RSGNSPTTIRSSRDNQEAN  193



>ref|XP_008662160.1| PREDICTED: putative NAC domain transcription factor superfamily 
protein isoform X2 [Zea mays]
Length=658

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKT  221
            +++ ALP+GFRF PTD+EL+SHYL+ KI G+ +SE +VIPE+D+CK EPWDLP  S+I++
Sbjct  1    MALWALPVGFRFHPTDEELVSHYLKGKITGQINSEAEVIPEIDICKCEPWDLPGKSLIRS  60

Query  222  DDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKT  401
            DDPEWFF  P DRKYPNG+R NRAT AGYWKATG DR IK++     D+S    IG KKT
Sbjct  61   DDPEWFFLAPKDRKYPNGSRSNRATVAGYWKATGPDRNIKSK----GDKSKQFTIGKKKT  116

Query  402  LVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAE  569
            LVF++GRAPKGERT WIMHEYR TEP  +  +  QG +VL  LF K +++       E +
Sbjct  117  LVFHRGRAPKGERTGWIMHEYRTTEPQFESGK--QGGYVLYRLFWKPEEKTERSSPKEMD  174

Query  570  PSGSSPATNKSSPDDVSSN  626
             SG+SP T +SS D+  +N
Sbjct  175  RSGNSPTTIRSSRDNQEAN  193



>ref|NP_001169185.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|ACN31883.1| unknown [Zea mays]
 gb|AFW57276.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=664

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 146/199 (73%), Gaps = 11/199 (6%)
 Frame = +3

Query  45   LSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKT  221
            +++ ALP+GFRF PTD+EL+SHYL+ KI G+ +SE +VIPE+D+CK EPWDLP  S+I++
Sbjct  1    MALWALPVGFRFHPTDEELVSHYLKGKITGQINSEAEVIPEIDICKCEPWDLPGKSLIRS  60

Query  222  DDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKT  401
            DDPEWFF  P DRKYPNG+R NRAT AGYWKATG DR IK++     D+S    IG KKT
Sbjct  61   DDPEWFFLAPKDRKYPNGSRSNRATVAGYWKATGPDRNIKSK----GDKSKQFTIGKKKT  116

Query  402  LVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCDEAE  569
            LVF++GRAPKGERT WIMHEYR TEP  +  +  QG +VL  LF K +++       E +
Sbjct  117  LVFHRGRAPKGERTGWIMHEYRTTEPQFESGK--QGGYVLYRLFWKPEEKTERSSPKEMD  174

Query  570  PSGSSPATNKSSPDDVSSN  626
             SG+SP T +SS D+  +N
Sbjct  175  RSGNSPTTIRSSRDNQEAN  193



>ref|XP_010934906.1| PREDICTED: uncharacterized protein LOC105054944 isoform X3 [Elaeis 
guineensis]
Length=699

 Score =   227 bits (579),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 144/197 (73%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  +S  +LP+GFRF PTD+EL++ YL+RKI+GR  +++++IPE+D+ K EPWDLP  S+
Sbjct  1    MMTISPGSLPIGFRFHPTDEELVNVYLKRKISGRIRNDMEIIPEIDILKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKY NGNR NRAT AGYWKATG+DR I+++ + G       LIG+
Sbjct  61   IRSDDPEWFFFAPKDRKYANGNRSNRATEAGYWKATGRDRLIRSKAAPGRQN----LIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT WI+HEYR TE + +     QG +VL  LF K +++    K D
Sbjct  117  KKTLVFHRGRAPKGIRTRWIIHEYRTTEREFESG--DQGGYVLYRLFKKPEEKGSNSKAD  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E SG SP   KSSPD
Sbjct  175  EMEKSGFSPTPTKSSPD  191



>ref|XP_010934904.1| PREDICTED: uncharacterized protein LOC105054944 isoform X1 [Elaeis 
guineensis]
Length=730

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 144/197 (73%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  +S  +LP+GFRF PTD+EL++ YL+RKI+GR  +++++IPE+D+ K EPWDLP  S+
Sbjct  1    MMTISPGSLPIGFRFHPTDEELVNVYLKRKISGRIRNDMEIIPEIDILKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKY NGNR NRAT AGYWKATG+DR I+++ + G       LIG+
Sbjct  61   IRSDDPEWFFFAPKDRKYANGNRSNRATEAGYWKATGRDRLIRSKAAPGRQN----LIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT WI+HEYR TE + +     QG +VL  LF K +++    K D
Sbjct  117  KKTLVFHRGRAPKGIRTRWIIHEYRTTEREFESG--DQGGYVLYRLFKKPEEKGSNSKAD  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E SG SP   KSSPD
Sbjct  175  EMEKSGFSPTPTKSSPD  191



>ref|XP_010934905.1| PREDICTED: uncharacterized protein LOC105054944 isoform X2 [Elaeis 
guineensis]
Length=727

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 144/197 (73%), Gaps = 11/197 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M  +S  +LP+GFRF PTD+EL++ YL+RKI+GR  +++++IPE+D+ K EPWDLP  S+
Sbjct  1    MMTISPGSLPIGFRFHPTDEELVNVYLKRKISGRIRNDMEIIPEIDILKCEPWDLPDKSI  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGI  392
            I++DDPEWFFF P DRKY NGNR NRAT AGYWKATG+DR I+++ + G       LIG+
Sbjct  61   IRSDDPEWFFFAPKDRKYANGNRSNRATEAGYWKATGRDRLIRSKAAPGRQN----LIGM  116

Query  393  KKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR----KCD  560
            KKTLVF++GRAPKG RT WI+HEYR TE + +     QG +VL  LF K +++    K D
Sbjct  117  KKTLVFHRGRAPKGIRTRWIIHEYRTTEREFESG--DQGGYVLYRLFKKPEEKGSNSKAD  174

Query  561  EAEPSGSSPATNKSSPD  611
            E E SG SP   KSSPD
Sbjct  175  EMEKSGFSPTPTKSSPD  191



>gb|KDO44487.1| hypothetical protein CISIN_1g007393mg [Citrus sinensis]
Length=577

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 124/191 (65%), Gaps = 39/191 (20%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ LS+++LPLGFRFRPTD+EL+  YLR KING + EV VI E+DVCK EPWDLP LSVI
Sbjct  1    MAVLSLNSLPLGFRFRPTDEELVDFYLRMKINGHNDEVSVISEIDVCKREPWDLPDLSVI  60

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            KT D EWFFFCP DRKYPNG+R NRAT AGYWKATGK                       
Sbjct  61   KTKDREWFFFCPQDRKYPNGHRLNRATAAGYWKATGK-----------------------  97

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD--RKCDEAE  569
                          RTNW+MHEYRAT  DLDGT+PGQ AFVLC LF K D+    C E E
Sbjct  98   --------------RTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQDESVEICVEVE  143

Query  570  PSGSSPATNKS  602
            PS SSP + +S
Sbjct  144  PSESSPTSARS  154



>ref|XP_009389904.1| PREDICTED: uncharacterized protein LOC103976433 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=650

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 129/174 (74%), Gaps = 11/174 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++ PLGFRFRPTD EL++HYL+ KI GR  SE +VI E+D+CK EPWDLP +S+
Sbjct  6    MAVLSVESFPLGFRFRPTDVELVNHYLKGKITGRIKSEDEVISEIDICKCEPWDLPDISL  65

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTP-LIG  389
            IK+ D EWFFF P DRKYPNGNR NRAT AGYWKATGKDR I++        S  P +IG
Sbjct  66   IKSSDSEWFFFSPKDRKYPNGNRSNRATKAGYWKATGKDRMIRS-------ISRVPTIIG  118

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR  551
             KKTLVFY+GRAP G RT W+MHEYR TE + D     QG FVLC LF K +++
Sbjct  119  TKKTLVFYQGRAPSGVRTTWVMHEYRTTEKEFDSGE--QGGFVLCRLFKKPEEK  170



>ref|XP_009389911.1| PREDICTED: uncharacterized protein LOC103976433 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=645

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 129/174 (74%), Gaps = 11/174 (6%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSV  212
            M+ LS+++ PLGFRFRPTD EL++HYL+ KI GR  SE +VI E+D+CK EPWDLP +S+
Sbjct  1    MAVLSVESFPLGFRFRPTDVELVNHYLKGKITGRIKSEDEVISEIDICKCEPWDLPDISL  60

Query  213  IKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTP-LIG  389
            IK+ D EWFFF P DRKYPNGNR NRAT AGYWKATGKDR I++        S  P +IG
Sbjct  61   IKSSDSEWFFFSPKDRKYPNGNRSNRATKAGYWKATGKDRMIRS-------ISRVPTIIG  113

Query  390  IKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDR  551
             KKTLVFY+GRAP G RT W+MHEYR TE + D     QG FVLC LF K +++
Sbjct  114  TKKTLVFYQGRAPSGVRTTWVMHEYRTTEKEFDSGE--QGGFVLCRLFKKPEEK  165



>ref|XP_009389125.1| PREDICTED: NAC domain-containing protein 19-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 137/203 (67%), Gaps = 22/203 (11%)
 Frame = +3

Query  27   KAGMSGLSMDALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPS  203
            + GM  LS  +LPLGFRFRPTD EL++HYL+ KI+GR  SEV+VIPE+DVCK+EP DLP 
Sbjct  6    RGGMVVLSAKSLPLGFRFRPTDVELVNHYLKGKISGRIKSEVEVIPEIDVCKYEPCDLPD  65

Query  204  LSVIKTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPL  383
             S+ K+ D EWFFF P D+KYPN NR NRAT AGYWK TGKDR IK+  +  +      +
Sbjct  66   KSLTKSVDSEWFFFAPKDKKYPNSNRSNRATEAGYWKPTGKDRMIKSGSACPA------I  119

Query  384  IGIKKTLVFYKGRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD-----  548
            IG+KKTLVF+ GRAPKG RTNWIMHEYR  E   +     QG FVLC LF K ++     
Sbjct  120  IGMKKTLVFHLGRAPKGVRTNWIMHEYRTLES--ESVSGEQGGFVLCRLFRKPEEKTPIF  177

Query  549  -------RKCDEAEPSG-SSPAT  593
                   R  DE E SG  +PAT
Sbjct  178  DNDDFTQRNVDEMESSGLFAPAT  200



>ref|NP_001056531.1| Os06g0101800 [Oryza sativa Japonica Group]
 dbj|BAF18445.1| Os06g0101800 [Oryza sativa Japonica Group]
 dbj|BAG89027.1| unnamed protein product [Oryza sativa Japonica Group]
Length=359

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 12/166 (7%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRFRPTD+EL+ HYL+ KI GR H ++ +IP+VD+   EPWDLP++SVIK+DDPEW
Sbjct  18   LPVGFRFRPTDEELVRHYLKGKIAGRSHPDLLLIPDVDLSTCEPWDLPAMSVIKSDDPEW  77

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYP G+R NR+T AGYWKATGKDR I++R +        PLIGIKKTLVF++
Sbjct  78   FFFAPRDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPA-------GPLIGIKKTLVFHR  130

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLF--HKSDD  548
            GRAP+G RT WIMHEYR TEP     +   G+FVL  LF  H+ DD
Sbjct  131  GRAPRGLRTAWIMHEYRTTEPHFQSGK--NGSFVLYRLFNKHEQDD  174



>ref|XP_009382806.1| PREDICTED: uncharacterized protein LOC103970661 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=664

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 134/191 (70%), Gaps = 10/191 (5%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRF PTD+EL+SHYLR K  GR      VIPE+DVCK EPWDLP  S+I++DDPEW
Sbjct  7    LPVGFRFHPTDEELVSHYLRGKNTGRIKPHDDVIPEIDVCKCEPWDLPGKSLIESDDPEW  66

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYPNG R  RAT AGYWKATGKDR I+++ +  +  +    IG+KKTLVF++
Sbjct  67   FFFAPRDRKYPNGLRSKRATEAGYWKATGKDRVIRSKATAAAAAA---PIGMKKTLVFHR  123

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEPSGSS  584
            GRAP G RTNWIMHEYR TEP+ +     QG +VL  LF K ++       DE EP G S
Sbjct  124  GRAPNGVRTNWIMHEYRTTEPEFEAG--DQGGYVLYRLFKKPEESCSSSNIDEMEPGGFS  181

Query  585  PATNKSSPDDV  617
            P TNK S DD 
Sbjct  182  PTTNKYSRDDT  192



>ref|XP_009382805.1| PREDICTED: uncharacterized protein LOC103970661 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=671

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 134/191 (70%), Gaps = 10/191 (5%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRF PTD+EL+SHYLR K  GR      VIPE+DVCK EPWDLP  S+I++DDPEW
Sbjct  7    LPVGFRFHPTDEELVSHYLRGKNTGRIKPHDDVIPEIDVCKCEPWDLPGKSLIESDDPEW  66

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYPNG R  RAT AGYWKATGKDR I+++ +  +  +    IG+KKTLVF++
Sbjct  67   FFFAPRDRKYPNGLRSKRATEAGYWKATGKDRVIRSKATAAAAAAP---IGMKKTLVFHR  123

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEPSGSS  584
            GRAP G RTNWIMHEYR TEP+ +     QG +VL  LF K ++       DE EP G S
Sbjct  124  GRAPNGVRTNWIMHEYRTTEPEFEAG--DQGGYVLYRLFKKPEESCSSSNIDEMEPGGFS  181

Query  585  PATNKSSPDDV  617
            P TNK S DD 
Sbjct  182  PTTNKYSRDDT  192



>ref|XP_009382803.1| PREDICTED: uncharacterized protein LOC103970661 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=719

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 134/191 (70%), Gaps = 10/191 (5%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRF PTD+EL+SHYLR K  GR      VIPE+DVCK EPWDLP  S+I++DDPEW
Sbjct  7    LPVGFRFHPTDEELVSHYLRGKNTGRIKPHDDVIPEIDVCKCEPWDLPGKSLIESDDPEW  66

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYPNG R  RAT AGYWKATGKDR I+++ +  +  +    IG+KKTLVF++
Sbjct  67   FFFAPRDRKYPNGLRSKRATEAGYWKATGKDRVIRSKATAAAAAAP---IGMKKTLVFHR  123

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEPSGSS  584
            GRAP G RTNWIMHEYR TEP+ +     QG +VL  LF K ++       DE EP G S
Sbjct  124  GRAPNGVRTNWIMHEYRTTEPEFEAG--DQGGYVLYRLFKKPEESCSSSNIDEMEPGGFS  181

Query  585  PATNKSSPDDV  617
            P TNK S DD 
Sbjct  182  PTTNKYSRDDT  192



>ref|XP_009382804.1| PREDICTED: uncharacterized protein LOC103970661 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=712

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 134/191 (70%), Gaps = 10/191 (5%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRF PTD+EL+SHYLR K  GR      VIPE+DVCK EPWDLP  S+I++DDPEW
Sbjct  7    LPVGFRFHPTDEELVSHYLRGKNTGRIKPHDDVIPEIDVCKCEPWDLPGKSLIESDDPEW  66

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYPNG R  RAT AGYWKATGKDR I+++ +  +  +    IG+KKTLVF++
Sbjct  67   FFFAPRDRKYPNGLRSKRATEAGYWKATGKDRVIRSKATAAAAAAP---IGMKKTLVFHR  123

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDD----RKCDEAEPSGSS  584
            GRAP G RTNWIMHEYR TEP+ +     QG +VL  LF K ++       DE EP G S
Sbjct  124  GRAPNGVRTNWIMHEYRTTEPEFEAG--DQGGYVLYRLFKKPEESCSSSNIDEMEPGGFS  181

Query  585  PATNKSSPDDV  617
            P TNK S DD 
Sbjct  182  PTTNKYSRDDT  192



>ref|XP_006846443.1| hypothetical protein AMTR_s00018p00070180 [Amborella trichopoda]
 gb|ERN08118.1| hypothetical protein AMTR_s00018p00070180 [Amborella trichopoda]
Length=177

 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/157 (64%), Positives = 123/157 (78%), Gaps = 8/157 (5%)
 Frame = +3

Query  36   MSGLSMDALPLGFRFRPTDQELISHYLRRKINGRHSEVQVIPEVDVCKWEPWDLPSLSVI  215
            M+ +S+++LP GFRF PTD+EL+S+YLRRKING    VQVIPEVD+CK EPWDLP  S+I
Sbjct  1    MAVMSLESLPPGFRFGPTDEELVSYYLRRKINGGRG-VQVIPEVDMCKCEPWDLPGKSII  59

Query  216  KTDDPEWFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIK  395
            K  DPEWFFFCP DRKYPNG R NRAT AGYWKATG DR IK++    S  S + LIG K
Sbjct  60   KNQDPEWFFFCPRDRKYPNGRRSNRATKAGYWKATGNDRPIKSK----SHGSRSDLIGTK  115

Query  396  KTLVFYKGRAPKGERTNWIMHEYRATE---PDLDGTR  497
            KTLVF++GRAP G++T+WI+HEYRA      DL+G++
Sbjct  116  KTLVFHEGRAPHGKKTHWIVHEYRANGNAFQDLNGSQ  152



>gb|EEE64934.1| hypothetical protein OsJ_19800 [Oryza sativa Japonica Group]
Length=735

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 12/166 (7%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRFRPTD+EL+ HYL+ KI GR H ++ +IP+VD+   EPWDLP++SVIK+DDPEW
Sbjct  18   LPVGFRFRPTDEELVRHYLKGKIAGRSHPDLLLIPDVDLSTCEPWDLPAMSVIKSDDPEW  77

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYP G+R NR+T AGYWKATGKDR I++R +        PLIGIKKTLVF++
Sbjct  78   FFFAPRDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPA-------GPLIGIKKTLVFHR  130

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLF--HKSDD  548
            GRAP+G RT WIMHEYR TEP     +   G+FVL  LF  H+ DD
Sbjct  131  GRAPRGLRTAWIMHEYRTTEPHFQSGK--NGSFVLYRLFNKHEQDD  174



>gb|EAY99297.1| hypothetical protein OsI_21263 [Oryza sativa Indica Group]
Length=683

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 126/166 (76%), Gaps = 12/166 (7%)
 Frame = +3

Query  60   LPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEW  236
            LP+GFRFRPTD+EL+ HYL+ KI GR H ++ +IP+VD+   EPWDLP++SVIK+DDPEW
Sbjct  18   LPVGFRFRPTDEELVRHYLKGKIAGRSHPDLLLIPDVDLSTCEPWDLPAMSVIKSDDPEW  77

Query  237  FFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYK  416
            FFF P DRKYP G+R NR+T AGYWKATGKDR I++R +        PLIGIKKTLVF++
Sbjct  78   FFFAPRDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPA-------GPLIGIKKTLVFHR  130

Query  417  GRAPKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLF--HKSDD  548
            GRAP+G RT WIMHEYR TEP     +   G+FVL  LF  H+ DD
Sbjct  131  GRAPRGLRTAWIMHEYRTTEPHFQSGK--NGSFVLYRLFNKHEQDD  174



>ref|XP_002436309.1| hypothetical protein SORBIDRAFT_10g000101 [Sorghum bicolor]
 gb|EER87676.1| hypothetical protein SORBIDRAFT_10g000101 [Sorghum bicolor]
Length=352

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 142/198 (72%), Gaps = 18/198 (9%)
 Frame = +3

Query  66   LGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWFF  242
            +GFRFRPTD+EL+ HYL+ KI G  H+++ +IP+VD+   EPW+LP+ ++I++ DPEWFF
Sbjct  32   VGFRFRPTDEELVRHYLKPKIAGHAHADLLLIPDVDLSACEPWELPAKALIRSGDPEWFF  91

Query  243  FCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKGR  422
            F PLDRKYP G+R NR+T AGYWKATGKDR I++R++         LIG+KKTLVF++GR
Sbjct  92   FAPLDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRRAGT-------LIGVKKTLVFHRGR  144

Query  423  APKGERTNWIMHEYRATEPDLDGTRPGQ-GAFVLCHLFHKS--DDRKCDEAE-PSGSSPA  590
            AP+G RT WIMHEYR  EP L   + GQ G+FVL  LF+K+  +    D A+ PS SSPA
Sbjct  145  APRGHRTAWIMHEYRTAEPQL---QQGQNGSFVLYRLFNKNEGESEASDAADSPSTSSPA  201

Query  591  TNKSSPDDVSSNLFQEAA  644
                +P   + NL Q A+
Sbjct  202  I---APAVKAENLSQPAS  216



>ref|XP_008658885.1| PREDICTED: putative NAC domain transcription factor superfamily 
protein isoform X1 [Zea mays]
 gb|AFW86257.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|AIB04473.1| NAC transcription factor, partial [Zea mays]
Length=611

 Score =   209 bits (533),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 146/209 (70%), Gaps = 15/209 (7%)
 Frame = +3

Query  66   LGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWFF  242
            +GFRFRPTD+EL+ HYL+ KI GR H+++ +IP+VD+   EPW+LP+ ++I++DDPEWFF
Sbjct  13   VGFRFRPTDEELVLHYLKPKIAGRAHADLLLIPDVDLSACEPWELPAKALIRSDDPEWFF  72

Query  243  FCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKGR  422
            F PLDRKYP G+R NR+T AGYWKATGKDR I++R +         LIG+KKTLVF++GR
Sbjct  73   FAPLDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPA-------GTLIGVKKTLVFHRGR  125

Query  423  APKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSSPATNKS  602
            AP+G RT WIMHEYR  EP L   +   G+FVL  LF+K+++    EA  +  SP+T+  
Sbjct  126  APRGHRTAWIMHEYRTAEPQLPQGQ--NGSFVLYRLFNKNEEES--EASDAADSPSTSSP  181

Query  603  --SPDDVSSNLFQEAALLDRQPQKANVTS  683
              +P+  + NL Q  +     P  A V+S
Sbjct  182  PIAPEVKTENLSQPTS-AKMSPHIATVSS  209



>ref|NP_001169690.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
 gb|ACN34532.1| unknown [Zea mays]
 gb|AFW86256.1| putative NAC domain transcription factor superfamily protein 
[Zea mays]
Length=612

 Score =   209 bits (533),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 146/209 (70%), Gaps = 15/209 (7%)
 Frame = +3

Query  66   LGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPEWFF  242
            +GFRFRPTD+EL+ HYL+ KI GR H+++ +IP+VD+   EPW+LP+ ++I++DDPEWFF
Sbjct  13   VGFRFRPTDEELVLHYLKPKIAGRAHADLLLIPDVDLSACEPWELPAKALIRSDDPEWFF  72

Query  243  FCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFYKGR  422
            F PLDRKYP G+R NR+T AGYWKATGKDR I++R +         LIG+KKTLVF++GR
Sbjct  73   FAPLDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPA-------GTLIGVKKTLVFHRGR  125

Query  423  APKGERTNWIMHEYRATEPDLDGTRPGQGAFVLCHLFHKSDDRKCDEAEPSGSSPATNKS  602
            AP+G RT WIMHEYR  EP L   +   G+FVL  LF+K+++    EA  +  SP+T+  
Sbjct  126  APRGHRTAWIMHEYRTAEPQLPQGQ--NGSFVLYRLFNKNEEES--EASDAADSPSTSSP  181

Query  603  --SPDDVSSNLFQEAALLDRQPQKANVTS  683
              +P+  + NL Q  +     P  A V+S
Sbjct  182  PIAPEVKTENLSQPTS-AKMSPHIATVSS  209



>ref|XP_004964251.1| PREDICTED: uncharacterized protein LOC101755267 isoform X2 [Setaria 
italica]
Length=601

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 12/163 (7%)
 Frame = +3

Query  57   ALPLGFRFRPTDQELISHYLRRKINGR-HSEVQVIPEVDVCKWEPWDLPSLSVIKTDDPE  233
            ALP+GFRFRPTD+EL+ HYL+ KI GR H ++ +IP+VD+   EPW+LP+ ++I++DDPE
Sbjct  13   ALPVGFRFRPTDEELVCHYLKPKIAGRVHPDLLLIPDVDLSACEPWELPAKALIRSDDPE  72

Query  234  WFFFCPLDRKYPNGNRCNRATYAGYWKATGKDRAIKTRKSTGSDQSNTPLIGIKKTLVFY  413
            WFFF PLDRKYP G+R NR+T AGYWKATGKDR I++R +         LIGIKKTLVF+
Sbjct  73   WFFFAPLDRKYPGGHRSNRSTAAGYWKATGKDRLIRSRPA-------GTLIGIKKTLVFH  125

Query  414  KGRAPKGERTNWIMHEYRATEPDLDGTRPGQ-GAFVLCHLFHK  539
            +GRAP+G RT+WIMHEYR  EP L   + GQ G+FVL  LF K
Sbjct  126  RGRAPRGHRTSWIMHEYRTAEPQL---QQGQNGSFVLYRLFDK  165



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320