BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032K06

Length=685
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02816.1|  unnamed protein product                              76.3    1e-12   Coffea canephora [robusta coffee]
ref|XP_002268376.2|  PREDICTED: probable protein phosphatase 2C 5...  63.2    3e-08   Vitis vinifera
ref|XP_010649173.1|  PREDICTED: probable protein phosphatase 2C 5...  63.2    3e-08   Vitis vinifera
ref|XP_010070043.1|  PREDICTED: probable protein phosphatase 2C 80    59.7    4e-07   Eucalyptus grandis [rose gum]
ref|XP_007046996.1|  Phosphatase 2C family protein                    56.6    4e-06   
ref|XP_010099838.1|  putative protein phosphatase 2C 80               55.1    1e-05   Morus notabilis
ref|XP_011099582.1|  PREDICTED: probable protein phosphatase 2C 55    52.4    1e-04   
gb|EYU44672.1|  hypothetical protein MIMGU_mgv1a007071mg              52.4    1e-04   Erythranthe guttata [common monkey flower]



>emb|CDP02816.1| unnamed protein product [Coffea canephora]
Length=467

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 74/143 (52%), Gaps = 15/143 (10%)
 Frame = +1

Query  238  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPI-RSNYLGSC----RSKSFAIGVL  402
            M S LL   NS+F FGVQ+ +  K    +KL ++L + RS   G+C    R+K  A+   
Sbjct  1    MSSGLLPKPNSAFCFGVQRGLRVKLAPTHKLIESLTVKRSQKFGACYTYSRTKHSAVEAF  60

Query  403  QHSSA----ILGDSTSRFSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFAN  570
              +      +   S+  F  +S        MA S STAAPGD  +   IS  GNVSSFA 
Sbjct  61   SQTPGGGVVVSRPSSQAFGKFSG------AMAVSSSTAAPGDLVMDTFISGCGNVSSFAK  114

Query  571  PASIHFGDRSCRNCWKTCVSVQH  639
            P  ++FG+R   NC K  +S+++
Sbjct  115  PVVMYFGNRGLDNCQKASLSLRN  137



>ref|XP_002268376.2| PREDICTED: probable protein phosphatase 2C 55 isoform X2 [Vitis 
vinifera]
Length=500

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 87/191 (46%), Gaps = 45/191 (24%)
 Frame = +1

Query  238  MPSALLSSLNSSFTFGVQKAVSAK----------QIGRYKL--------------TQALP  345
            MPS +  +LN +F+ G+++A++A+          Q+G  KL              T  L 
Sbjct  1    MPSGVFPNLNIAFSSGIRRAITAQRGGLHSSIELQLGWSKLLTGNTGLCLSSPFSTTVLS  60

Query  346  IRSNYLGSCRSKSFAIGV------------------LQHSSAILGDSTSRFSGYSTYLCN  471
             R +     + +  A+GV                   ++    L     RFS  + YL  
Sbjct  61   SRPDCYFVNQKRGLAVGVPVSRSLSLHSMPSPSSQLFEYQINSLISDIGRFSKSNLYL--  118

Query  472  PRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVK  651
             + MAASGS A  GD  +   I+++GN+S+FA P  + F DRS  +C K  +S++++E  
Sbjct  119  KKSMAASGSKAVSGDIYIDE-ITATGNLSNFAKPTGVFFNDRSLSSCRKASMSLRNQEPP  177

Query  652  MAPIVHGYFIF  684
               +V GY IF
Sbjct  178  NRSLVCGYLIF  188



>ref|XP_010649173.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649174.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
 ref|XP_010649176.1| PREDICTED: probable protein phosphatase 2C 55 isoform X1 [Vitis 
vinifera]
Length=501

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 87/191 (46%), Gaps = 45/191 (24%)
 Frame = +1

Query  238  MPSALLSSLNSSFTFGVQKAVSAK----------QIGRYKL--------------TQALP  345
            MPS +  +LN +F+ G+++A++A+          Q+G  KL              T  L 
Sbjct  1    MPSGVFPNLNIAFSSGIRRAITAQRGGLHSSIELQLGWSKLLTGNTGLCLSSPFSTTVLS  60

Query  346  IRSNYLGSCRSKSFAIGV------------------LQHSSAILGDSTSRFSGYSTYLCN  471
             R +     + +  A+GV                   ++    L     RFS  + YL  
Sbjct  61   SRPDCYFVNQKRGLAVGVPVSRSLSLHSMPSPSSQLFEYQINSLISDIGRFSKSNLYL--  118

Query  472  PRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVK  651
             + MAASGS A  GD  +   I+++GN+S+FA P  + F DRS  +C K  +S++++E  
Sbjct  119  KKSMAASGSKAVSGDIYIDE-ITATGNLSNFAKPTGVFFNDRSLSSCRKASMSLRNQEPP  177

Query  652  MAPIVHGYFIF  684
               +V GY IF
Sbjct  178  NRSLVCGYLIF  188



>ref|XP_010070043.1| PREDICTED: probable protein phosphatase 2C 80 [Eucalyptus grandis]
 gb|KCW58599.1| hypothetical protein EUGRSUZ_H01259 [Eucalyptus grandis]
Length=437

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 27/138 (20%)
 Frame = +1

Query  238  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSC-RSKSFAIGVLQHSS  414
            MPS+ LS LN++   G ++A++ +Q+  +    +LP++      C RS   + GV+    
Sbjct  1    MPSSALSRLNTTAFCGFRRALAEQQVHNFG---SLPLQ------CPRSTVLSTGVV----  47

Query  415  AILGDSTSRFSGYSTYLCNPRI-MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFG  591
                        YS      RI MAASGS A  GD  + GL+SS GN   F  P+ ++F 
Sbjct  48   ------------YSPSRVQRRISMAASGSKAVSGDVYMDGLLSSGGNTVDFTKPSGVYFF  95

Query  592  DRSCRNCWKTCVSVQHKE  645
            DRS ++  +  VS++ +E
Sbjct  96   DRSQKSFQRASVSLRRRE  113



>ref|XP_007046996.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOX91153.1| Phosphatase 2C family protein [Theobroma cacao]
Length=452

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 75/149 (50%), Gaps = 8/149 (5%)
 Frame = +1

Query  238  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSCRSKSFAIGVLQHSSA  417
            MP  +LS LN +   G ++A+S +++     T +L +R   L S  S       L +S  
Sbjct  1    MPPVVLSKLNPAIYTGFRRAISGRRVRLCNPTSSL-LRQRKLLSANSG--LTQFLPYSIN  57

Query  418  ILGDSTSRFSGYSTYLC-NPRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGD  594
            ++ D+  RF      LC + + MA SGS A  GD  +  L++S GN   F  P  ++F D
Sbjct  58   LISDN--RF--VLNQLCTSAKTMAVSGSKAVFGDVYVDELVASCGNGLDFLKPTGVYFPD  113

Query  595  RSCRNCWKTCVSVQHKEVKMAPIVHGYFI  681
             S  +C K  ++++ +E      V+GY++
Sbjct  114  GSRTSCQKVSMTLRKREQTNNRFVYGYYV  142



>ref|XP_010099838.1| putative protein phosphatase 2C 80 [Morus notabilis]
 gb|EXB80598.1| putative protein phosphatase 2C 80 [Morus notabilis]
Length=426

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 4/95 (4%)
 Frame = +1

Query  403  QHS-SAILGDSTSRFSG--YSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFANP  573
            +HS S +L    SR +G  YSTY   P  MAAS S    GD  +  LI+  GN   FA P
Sbjct  25   RHSISLLLRQGFSRKTGLPYSTYPL-PYPMAASNSKPVFGDVYVDDLITGCGNALDFAKP  83

Query  574  ASIHFGDRSCRNCWKTCVSVQHKEVKMAPIVHGYF  678
              + F D+S  +C K  VS++ +E+  + I  GYF
Sbjct  84   TGVFFNDKSLISCRKAVVSLRRREISNSQISCGYF  118



>ref|XP_011099582.1| PREDICTED: probable protein phosphatase 2C 55 [Sesamum indicum]
Length=382

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = +1

Query  481  MAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDRSCRNCWKTCVSVQHKEVKMAP  660
            MAASGS  A GD  +  L+SS GNVS F  P  + F DRS + C +  VS++   ++   
Sbjct  1    MAASGSMVASGDLVVDALVSSCGNVSGFVKPGGVFFSDRSYKICRRARVSMRSGAMESHH  60

Query  661  IVHGYFIF  684
              HG  +F
Sbjct  61   GPHGCLVF  68



>gb|EYU44672.1| hypothetical protein MIMGU_mgv1a007071mg [Erythranthe guttata]
Length=420

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 54/133 (41%), Gaps = 38/133 (29%)
 Frame = +1

Query  238  MPSALLSSLNSSFTFGVQKAVSAKQIGRYKLTQALPIRSNYLGSCRSKSFAIGVLQHSSA  417
            MPS LL +LN + +FG  +A    Q     L + L  RS   G  R              
Sbjct  1    MPSWLLPNLNVALSFGFPRAARVNQSQPLHLIETLFTRS---GKNR--------------  43

Query  418  ILGDSTSRFSGYSTYLCNPRIMAASGSTAAPGDFALGGLISSSGNVSSFANPASIHFGDR  597
                                 MAAS S  A GD  +  L+SS GNVS F  P  + +GDR
Sbjct  44   ---------------------MAASSSMVASGDVVVDTLLSSCGNVSGFLKPGGVFYGDR  82

Query  598  SCRNCWKTCVSVQ  636
            S + C K  VS++
Sbjct  83   SFKVCRKARVSIR  95



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1131443780880