BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032J21

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010325349.1|  PREDICTED: protein ABIL2-like isoform X2           164   9e-46   Solanum lycopersicum
ref|XP_006343822.1|  PREDICTED: protein ABIL2-like                      165   1e-45   Solanum tuberosum [potatoes]
ref|XP_004245491.1|  PREDICTED: protein ABIL2-like isoform X1           164   3e-45   Solanum lycopersicum
ref|XP_009629169.1|  PREDICTED: protein ABIL2-like isoform X1           162   1e-44   Nicotiana tomentosiformis
ref|XP_009629171.1|  PREDICTED: protein ABIL2-like isoform X2           162   1e-44   
ref|XP_010912294.1|  PREDICTED: putative protein ABIL2 isoform X3       160   6e-44   Elaeis guineensis
ref|XP_010912262.1|  PREDICTED: putative protein ABIL2 isoform X1       157   7e-43   Elaeis guineensis
ref|XP_009803885.1|  PREDICTED: protein ABIL2-like                      157   1e-42   Nicotiana sylvestris
ref|XP_011070348.1|  PREDICTED: protein ABIL2-like isoform X2           155   4e-42   
ref|XP_011070345.1|  PREDICTED: protein ABIL2-like isoform X1           155   5e-42   Sesamum indicum [beniseed]
emb|CDP05046.1|  unnamed protein product                                155   6e-42   Coffea canephora [robusta coffee]
ref|XP_008810684.1|  PREDICTED: putative protein ABIL2                  154   1e-41   Phoenix dactylifera
ref|XP_011075964.1|  PREDICTED: protein ABIL2-like                      154   1e-41   Sesamum indicum [beniseed]
ref|XP_004307967.1|  PREDICTED: protein ABIL2 isoform X1                154   2e-41   Fragaria vesca subsp. vesca
ref|XP_011470213.1|  PREDICTED: protein ABIL2 isoform X2                154   2e-41   Fragaria vesca subsp. vesca
gb|KJB52569.1|  hypothetical protein B456_008G268000                    150   3e-41   Gossypium raimondii
ref|XP_006350530.1|  PREDICTED: protein ABIL3-like isoform X1           153   3e-41   Solanum tuberosum [potatoes]
gb|KJB17380.1|  hypothetical protein B456_003G074200                    149   3e-41   Gossypium raimondii
ref|XP_010318026.1|  PREDICTED: protein ABIL3                           153   4e-41   Solanum lycopersicum
ref|XP_002516649.1|  Protein ABIL2, putative                            152   6e-41   Ricinus communis
ref|XP_009623775.1|  PREDICTED: protein ABIL2-like isoform X2           152   7e-41   Nicotiana tomentosiformis
ref|XP_009623773.1|  PREDICTED: protein ABIL2-like isoform X1           152   8e-41   Nicotiana tomentosiformis
gb|KJB17377.1|  hypothetical protein B456_003G074200                    149   1e-40   Gossypium raimondii
ref|XP_010266575.1|  PREDICTED: protein ABIL2 isoform X2                151   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010266572.1|  PREDICTED: protein ABIL2 isoform X1                151   1e-40   Nelumbo nucifera [Indian lotus]
gb|KDP45550.1|  hypothetical protein JCGZ_18175                         151   1e-40   Jatropha curcas
gb|KJB17378.1|  hypothetical protein B456_003G074200                    147   2e-40   Gossypium raimondii
gb|KJB52567.1|  hypothetical protein B456_008G268000                    149   2e-40   Gossypium raimondii
ref|XP_010541486.1|  PREDICTED: protein ABIL3-like                      151   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_010421253.1|  PREDICTED: protein ABIL3 isoform X1                151   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010454735.1|  PREDICTED: protein ABIL3-like                      151   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010421254.1|  PREDICTED: protein ABIL3 isoform X2                151   2e-40   
ref|XP_006394685.1|  hypothetical protein EUTSA_v10004602mg             151   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_002317785.1|  hypothetical protein POPTR_0012s02400g             151   4e-40   
ref|XP_010493575.1|  PREDICTED: protein ABIL3-like                      150   4e-40   Camelina sativa [gold-of-pleasure]
ref|NP_974829.1|  ABL interactor-like protein 3                         148   4e-40   
ref|XP_009784228.1|  PREDICTED: protein ABIL2-like isoform X2           150   4e-40   Nicotiana sylvestris
ref|XP_009784226.1|  PREDICTED: protein ABIL2-like isoform X1           150   5e-40   Nicotiana sylvestris
ref|XP_010662870.1|  PREDICTED: protein ABIL2 isoform X2                150   5e-40   Vitis vinifera
emb|CBI23020.3|  unnamed protein product                                150   5e-40   Vitis vinifera
gb|KJB52566.1|  hypothetical protein B456_008G268000                    150   5e-40   Gossypium raimondii
ref|XP_007218279.1|  hypothetical protein PRUPE_ppa008359mg             150   5e-40   
ref|NP_190498.1|  ABL interactor-like protein 2                         150   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006441129.1|  hypothetical protein CICLE_v10021055mg             147   6e-40   
ref|XP_002872104.1|  hypothetical protein ARALYDRAFT_489290             150   7e-40   
ref|XP_009344687.1|  PREDICTED: protein ABIL2-like                      150   8e-40   Pyrus x bretschneideri [bai li]
ref|NP_197819.2|  ABL interactor-like protein 3                         149   8e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KHG10845.1|  Protein ABIL2                                           149   9e-40   Gossypium arboreum [tree cotton]
ref|XP_007039080.1|  ABL interactor-like protein 2 isoform 1            149   9e-40   
ref|XP_008376759.1|  PREDICTED: protein ABIL2-like                      149   9e-40   Malus domestica [apple tree]
ref|XP_009348526.1|  PREDICTED: protein ABIL2-like isoform X1           149   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_009348527.1|  PREDICTED: protein ABIL2-like isoform X2           149   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_010662869.1|  PREDICTED: protein ABIL2 isoform X1                149   1e-39   
gb|KJB17388.1|  hypothetical protein B456_003G074200                    148   1e-39   Gossypium raimondii
ref|XP_010267571.1|  PREDICTED: protein ABIL3-like                      149   1e-39   Nelumbo nucifera [Indian lotus]
dbj|BAB10397.1|  unnamed protein product                                149   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288227.1|  hypothetical protein CARUB_v10001467mg             149   2e-39   Capsella rubella
ref|XP_011024852.1|  PREDICTED: protein ABIL2                           149   2e-39   Populus euphratica
ref|XP_002875960.1|  hypothetical protein ARALYDRAFT_485287             148   2e-39   
ref|XP_006441130.1|  hypothetical protein CICLE_v10021055mg             149   2e-39   Citrus clementina [clementine]
ref|XP_008234720.1|  PREDICTED: protein ABIL2                           148   2e-39   Prunus mume [ume]
gb|KJB17384.1|  hypothetical protein B456_003G074200                    144   3e-39   Gossypium raimondii
ref|XP_002264080.2|  PREDICTED: protein ABIL2-like isoform X6           148   3e-39   Vitis vinifera
gb|EYU25243.1|  hypothetical protein MIMGU_mgv1a009919mg                148   4e-39   Erythranthe guttata [common monkey flower]
gb|KJB19858.1|  hypothetical protein B456_003G121700                    146   4e-39   Gossypium raimondii
ref|XP_006291525.1|  hypothetical protein CARUB_v10017674mg             147   4e-39   Capsella rubella
ref|XP_010659665.1|  PREDICTED: protein ABIL2-like isoform X7           147   4e-39   
ref|XP_010515274.1|  PREDICTED: protein ABIL2-like                      147   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010426437.1|  PREDICTED: protein ABIL2                           147   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010659662.1|  PREDICTED: protein ABIL2-like isoform X5           147   6e-39   Vitis vinifera
gb|KHG04210.1|  Protein ABIL3                                           143   7e-39   Gossypium arboreum [tree cotton]
gb|KJB19853.1|  hypothetical protein B456_003G121700                    147   9e-39   Gossypium raimondii
gb|KHG04211.1|  Protein ABIL3                                           144   9e-39   Gossypium arboreum [tree cotton]
ref|XP_010519446.1|  PREDICTED: protein ABIL2-like                      147   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_010109248.1|  hypothetical protein L484_011870                   146   1e-38   
gb|KHN23356.1|  Protein ABIL2                                           147   1e-38   Glycine soja [wild soybean]
ref|XP_006404160.1|  hypothetical protein EUTSA_v10010561mg             146   1e-38   Eutrema salsugineum [saltwater cress]
ref|XP_004146227.1|  PREDICTED: protein ABIL2-like                      147   1e-38   
ref|XP_004169136.1|  PREDICTED: protein ABIL2-like                      147   1e-38   
ref|XP_008466838.1|  PREDICTED: protein ABIL2                           146   1e-38   Cucumis melo [Oriental melon]
ref|XP_010659659.1|  PREDICTED: protein ABIL2-like isoform X4           147   1e-38   Vitis vinifera
emb|CBI34535.3|  unnamed protein product                                147   1e-38   Vitis vinifera
ref|XP_010659647.1|  PREDICTED: protein ABIL2-like isoform X2           147   2e-38   Vitis vinifera
ref|XP_009420773.1|  PREDICTED: putative protein ABIL2 isoform X1       147   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP12188.1|  unnamed protein product                                146   2e-38   Coffea canephora [robusta coffee]
ref|XP_010659654.1|  PREDICTED: protein ABIL2-like isoform X3           147   2e-38   Vitis vinifera
gb|KDO43393.1|  hypothetical protein CISIN_1g038307mg                   145   3e-38   Citrus sinensis [apfelsine]
ref|XP_009150953.1|  PREDICTED: protein ABIL3 isoform X2                145   3e-38   Brassica rapa
gb|KJB37359.1|  hypothetical protein B456_006G201700                    145   3e-38   Gossypium raimondii
ref|XP_010659643.1|  PREDICTED: protein ABIL2-like isoform X1           147   3e-38   Vitis vinifera
gb|KGN57659.1|  hypothetical protein Csa_3G238740                       147   3e-38   Cucumis sativus [cucumbers]
gb|KJB19859.1|  hypothetical protein B456_003G121700                    146   3e-38   Gossypium raimondii
ref|XP_006491995.1|  PREDICTED: protein ABIL2-like isoform X1           145   3e-38   Citrus sinensis [apfelsine]
ref|XP_002518857.1|  Protein ABIL2, putative                            145   3e-38   Ricinus communis
ref|XP_002299451.2|  hypothetical protein POPTR_0001s10950g             145   4e-38   
emb|CDY05919.1|  BnaC08g20960D                                          145   4e-38   
gb|KJB19852.1|  hypothetical protein B456_003G121700                    146   4e-38   Gossypium raimondii
ref|XP_008381232.1|  PREDICTED: protein ABIL2-like                      145   5e-38   Malus domestica [apple tree]
gb|KJB37361.1|  hypothetical protein B456_006G201700                    141   5e-38   Gossypium raimondii
ref|XP_010058324.1|  PREDICTED: protein ABIL2-like                      142   5e-38   
ref|XP_003523358.1|  PREDICTED: protein ABIL2-like isoform X1           145   6e-38   Glycine max [soybeans]
ref|XP_009149749.1|  PREDICTED: protein ABIL2                           144   6e-38   Brassica rapa
ref|XP_009420789.1|  PREDICTED: putative protein ABIL2 isoform X3       144   8e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB37360.1|  hypothetical protein B456_006G201700                    142   1e-37   Gossypium raimondii
ref|XP_008783161.1|  PREDICTED: probable protein ABIL3                  144   1e-37   Phoenix dactylifera
ref|XP_010671428.1|  PREDICTED: protein ABIL3                           144   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009351988.1|  PREDICTED: protein ABIL2-like                      144   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_009420781.1|  PREDICTED: putative protein ABIL2 isoform X2       144   1e-37   
ref|XP_009420797.1|  PREDICTED: putative protein ABIL2 isoform X4       144   1e-37   
gb|KCW72460.1|  hypothetical protein EUGRSUZ_E00910                     142   2e-37   Eucalyptus grandis [rose gum]
emb|CDX80429.1|  BnaC07g30150D                                          143   2e-37   
gb|KJB37358.1|  hypothetical protein B456_006G201700                    142   3e-37   Gossypium raimondii
gb|EYU45257.1|  hypothetical protein MIMGU_mgv1a012015mg                141   3e-37   Erythranthe guttata [common monkey flower]
gb|KEH35459.1|  ABIL1-like protein                                      140   4e-37   Medicago truncatula
gb|KCW72483.1|  hypothetical protein EUGRSUZ_E00938                     140   4e-37   Eucalyptus grandis [rose gum]
ref|XP_003526721.1|  PREDICTED: protein ABIL2-like isoform X1           142   4e-37   Glycine max [soybeans]
ref|XP_009150952.1|  PREDICTED: protein ABIL3 isoform X1                142   5e-37   Brassica rapa
ref|XP_010107272.1|  hypothetical protein L484_007833                   140   5e-37   
ref|XP_007136512.1|  hypothetical protein PHAVU_009G051500g             142   5e-37   Phaseolus vulgaris [French bean]
gb|KHN19504.1|  Protein ABIL2                                           142   6e-37   Glycine soja [wild soybean]
gb|KCW72452.1|  hypothetical protein EUGRSUZ_E00897                     140   6e-37   Eucalyptus grandis [rose gum]
ref|XP_010055757.1|  PREDICTED: protein ABIL3-like isoform X4           140   7e-37   Eucalyptus grandis [rose gum]
ref|XP_010055758.1|  PREDICTED: protein ABIL3-like isoform X5           140   7e-37   Eucalyptus grandis [rose gum]
ref|XP_010058329.1|  PREDICTED: protein ABIL2-like                      142   7e-37   
ref|XP_010055759.1|  PREDICTED: protein ABIL3-like isoform X6           140   7e-37   Eucalyptus grandis [rose gum]
ref|XP_006476345.1|  PREDICTED: protein ABIL2-like                      141   9e-37   
ref|XP_003602276.1|  Protein ABIL2                                      141   9e-37   Medicago truncatula
gb|KCW72286.1|  hypothetical protein EUGRSUZ_E00746                     140   1e-36   Eucalyptus grandis [rose gum]
ref|XP_011026838.1|  PREDICTED: protein ABIL2-like                      141   1e-36   Populus euphratica
ref|XP_010055755.1|  PREDICTED: uncharacterized protein LOC104443...    140   2e-36   Eucalyptus grandis [rose gum]
gb|KHG02930.1|  Protein ABIL2 -like protein                             140   2e-36   Gossypium arboreum [tree cotton]
ref|XP_010055753.1|  PREDICTED: protein ABIL2-like isoform X1           141   2e-36   Eucalyptus grandis [rose gum]
ref|XP_004300497.1|  PREDICTED: protein ABIL2-like                      140   2e-36   Fragaria vesca subsp. vesca
ref|XP_010035277.1|  PREDICTED: protein ABIL2                           140   3e-36   Eucalyptus grandis [rose gum]
gb|AAZ74718.1|  At5g24310                                               134   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010915983.1|  PREDICTED: probable protein ABIL3                  140   3e-36   Elaeis guineensis
gb|KCW46573.1|  hypothetical protein EUGRSUZ_K00391                     139   3e-36   Eucalyptus grandis [rose gum]
ref|XP_004502669.1|  PREDICTED: protein ABIL2-like                      140   3e-36   Cicer arietinum [garbanzo]
gb|KCW72494.1|  hypothetical protein EUGRSUZ_E00955                     137   5e-36   Eucalyptus grandis [rose gum]
gb|KCW72447.1|  hypothetical protein EUGRSUZ_E00893                     137   5e-36   Eucalyptus grandis [rose gum]
ref|XP_010058335.1|  PREDICTED: protein ABIL2-like                      139   7e-36   
gb|KCW72551.1|  hypothetical protein EUGRSUZ_E01020                     139   7e-36   Eucalyptus grandis [rose gum]
ref|XP_010055756.1|  PREDICTED: protein ABIL3-like isoform X3           139   8e-36   Eucalyptus grandis [rose gum]
ref|XP_010055979.1|  PREDICTED: protein ABIL3-like isoform X3           139   9e-36   Eucalyptus grandis [rose gum]
gb|AFK46504.1|  unknown                                                 135   9e-36   Medicago truncatula
ref|XP_006595602.1|  PREDICTED: uncharacterized protein LOC100808...    139   1e-35   Glycine max [soybeans]
ref|XP_004498510.1|  PREDICTED: protein ABIL2-like isoform X3           138   1e-35   
ref|XP_004498509.1|  PREDICTED: protein ABIL2-like isoform X2           139   1e-35   
gb|AAZ74719.1|  At5g24310                                               132   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002303669.1|  hypothetical protein POPTR_0003s14280g             137   2e-35   
ref|XP_006852591.1|  hypothetical protein AMTR_s00021p00216340          137   2e-35   Amborella trichopoda
ref|XP_011022465.1|  PREDICTED: protein ABIL2-like                      138   2e-35   Populus euphratica
ref|XP_008392261.1|  PREDICTED: protein ABIL2-like isoform X2           137   2e-35   
ref|XP_010055978.1|  PREDICTED: protein ABIL2-like isoform X2           138   2e-35   
ref|XP_010055977.1|  PREDICTED: protein ABIL2-like isoform X1           138   2e-35   
gb|KDP25264.1|  hypothetical protein JCGZ_20420                         137   2e-35   Jatropha curcas
ref|NP_001242020.1|  uncharacterized protein LOC100808485               137   3e-35   
ref|XP_004498508.1|  PREDICTED: protein ABIL2-like isoform X1           138   3e-35   Cicer arietinum [garbanzo]
gb|KCW72295.1|  hypothetical protein EUGRSUZ_E00761                     135   3e-35   Eucalyptus grandis [rose gum]
ref|XP_003588502.1|  Protein ABIL3                                      137   4e-35   
gb|KEH39727.1|  ABIL1-like protein                                      137   4e-35   Medicago truncatula
ref|XP_010055742.1|  PREDICTED: protein ABIL3-like isoform X3           137   5e-35   Eucalyptus grandis [rose gum]
ref|XP_010055743.1|  PREDICTED: protein ABIL2-like isoform X4           136   5e-35   Eucalyptus grandis [rose gum]
ref|XP_008239164.1|  PREDICTED: protein ABIL2-like                      137   5e-35   Prunus mume [ume]
ref|XP_006645995.1|  PREDICTED: putative protein ABIL2-like             133   6e-35   
ref|XP_007040588.1|  ABL interactor-like protein 2, putative            137   9e-35   
ref|XP_010055741.1|  PREDICTED: protein ABIL2-like isoform X2           136   9e-35   Eucalyptus grandis [rose gum]
ref|XP_010055740.1|  PREDICTED: protein ABIL2-like isoform X1           136   1e-34   Eucalyptus grandis [rose gum]
gb|KCW72267.1|  hypothetical protein EUGRSUZ_E00723                     136   1e-34   Eucalyptus grandis [rose gum]
ref|XP_008392259.1|  PREDICTED: protein ABIL2-like isoform X1           134   3e-34   
ref|XP_010447029.1|  PREDICTED: protein ABIL4                           132   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_006405281.1|  hypothetical protein EUTSA_v10027878mg             131   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_010230669.1|  PREDICTED: probable protein ABIL3                  132   4e-33   Brachypodium distachyon [annual false brome]
gb|AAM67279.1|  unknown                                                 130   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285711.1|  hypothetical protein CARUB_v10007182mg             132   4e-33   
ref|XP_009140142.1|  PREDICTED: protein ABIL4-like isoform X4           130   5e-33   Brassica rapa
ref|XP_009140141.1|  PREDICTED: protein ABIL4-like isoform X3           130   5e-33   Brassica rapa
ref|XP_009140139.1|  PREDICTED: protein ABIL4-like isoform X1           130   5e-33   Brassica rapa
ref|XP_009140140.1|  PREDICTED: protein ABIL4-like isoform X2           130   6e-33   Brassica rapa
gb|KCW72548.1|  hypothetical protein EUGRSUZ_E01014                     129   8e-33   Eucalyptus grandis [rose gum]
ref|XP_002868565.1|  hypothetical protein ARALYDRAFT_493780             130   9e-33   
emb|CDX67526.1|  BnaA07g15660D                                          130   1e-32   
gb|KJB52329.1|  hypothetical protein B456_008G256500                    128   1e-32   Gossypium raimondii
ref|NP_199018.1|  ABL interactor-like protein 4                         129   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010545092.1|  PREDICTED: protein ABIL4 isoform X5                130   1e-32   Tarenaya hassleriana [spider flower]
gb|KJB52328.1|  hypothetical protein B456_008G256500                    130   2e-32   Gossypium raimondii
ref|XP_010545054.1|  PREDICTED: protein ABIL4 isoform X1                129   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010545086.1|  PREDICTED: protein ABIL4 isoform X4                129   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010545079.1|  PREDICTED: protein ABIL4 isoform X3                129   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_010545073.1|  PREDICTED: protein ABIL4 isoform X2                129   2e-32   Tarenaya hassleriana [spider flower]
ref|XP_009125215.1|  PREDICTED: protein ABIL4-like                      130   2e-32   Brassica rapa
ref|XP_010436162.1|  PREDICTED: protein ABIL4-like                      129   4e-32   Camelina sativa [gold-of-pleasure]
gb|KJB52333.1|  hypothetical protein B456_008G256500                    129   4e-32   Gossypium raimondii
ref|XP_004968938.1|  PREDICTED: putative protein ABIL2-like isofo...    128   1e-31   Setaria italica
gb|EAZ12300.1|  hypothetical protein OsJ_02192                          127   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19497.1|  hypothetical protein F775_01027                         128   1e-31   
emb|CDY69736.1|  BnaCnng65090D                                          127   1e-31   Brassica napus [oilseed rape]
ref|XP_004968939.1|  PREDICTED: putative protein ABIL2-like isofo...    127   1e-31   Setaria italica
emb|CDY13370.1|  BnaC06g13870D                                          126   2e-31   Brassica napus [oilseed rape]
gb|EAY74497.1|  hypothetical protein OsI_02389                          126   4e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010231913.1|  PREDICTED: putative protein ABIL2 isoform X2       126   6e-31   
ref|XP_010058344.1|  PREDICTED: protein ABIL2-like                      121   8e-31   
dbj|BAJ91626.1|  predicted protein                                      126   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ99926.1|  predicted protein                                      126   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q5JKN2.1|ABIL2_ORYSJ  RecName: Full=Putative protein ABIL2; Al...    125   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|KCW72490.1|  hypothetical protein EUGRSUZ_E00951                     122   1e-30   Eucalyptus grandis [rose gum]
ref|XP_002457993.1|  hypothetical protein SORBIDRAFT_03g025120          125   2e-30   
gb|EEC70261.1|  hypothetical protein OsI_01066                          124   3e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_001042529.2|  Os01g0236400                                       124   3e-30   
gb|KCW72499.1|  hypothetical protein EUGRSUZ_E00962                     122   3e-30   Eucalyptus grandis [rose gum]
ref|XP_010231912.1|  PREDICTED: putative protein ABIL2 isoform X1       124   5e-30   Brachypodium distachyon [annual false brome]
gb|KFK32975.1|  hypothetical protein AALP_AA6G313500                    122   5e-30   Arabis alpina [alpine rockcress]
gb|KFK32976.1|  hypothetical protein AALP_AA6G313500                    122   5e-30   Arabis alpina [alpine rockcress]
ref|XP_006643968.1|  PREDICTED: probable protein ABIL3-like             123   6e-30   Oryza brachyantha
gb|EMT12714.1|  hypothetical protein F775_26273                         122   9e-30   
ref|NP_001150525.1|  protein ABIL1                                      122   1e-29   
ref|XP_009419651.1|  PREDICTED: probable protein ABIL3 isoform X2       122   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419650.1|  PREDICTED: probable protein ABIL3 isoform X1       122   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA59035.1|  TPA: hypothetical protein ZEAMMB73_813280              117   2e-29   
ref|XP_011081455.1|  PREDICTED: protein ABIL4-like                      121   3e-29   Sesamum indicum [beniseed]
ref|XP_001783354.1|  predicted protein                                  117   3e-29   
gb|KJB17382.1|  hypothetical protein B456_003G074200                    117   4e-29   Gossypium raimondii
ref|XP_004967360.1|  PREDICTED: probable protein ABIL3-like             120   6e-29   Setaria italica
ref|XP_002457050.1|  hypothetical protein SORBIDRAFT_03g000510          119   1e-28   Sorghum bicolor [broomcorn]
ref|XP_009413808.1|  PREDICTED: probable protein ABIL3                  119   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010055770.1|  PREDICTED: protein ABIL3-like isoform X2           113   4e-28   
ref|XP_010445754.1|  PREDICTED: protein ABIL4-like                      113   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_007051672.1|  ABI-1-like 1 isoform 2                             115   5e-28   
emb|CBI40454.3|  unnamed protein product                                117   6e-28   Vitis vinifera
ref|XP_002279419.1|  PREDICTED: protein ABIL1                           117   7e-28   Vitis vinifera
emb|CAN69308.1|  hypothetical protein VITISV_003083                     117   7e-28   Vitis vinifera
ref|XP_009400658.1|  PREDICTED: protein ABIL2-like                      114   8e-28   
ref|XP_009409710.1|  PREDICTED: protein ABIL2-like                      114   8e-28   
gb|KHG11471.1|  Protein ABIL1 -like protein                             117   9e-28   Gossypium arboreum [tree cotton]
ref|XP_010055745.1|  PREDICTED: protein ABIL3-like                      112   1e-27   Eucalyptus grandis [rose gum]
ref|XP_002880226.1|  hypothetical protein ARALYDRAFT_483770             116   2e-27   
ref|XP_006397808.1|  hypothetical protein EUTSA_v10001562mg             116   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006439297.1|  hypothetical protein CICLE_v10021975mg             115   2e-27   
gb|KHG10844.1|  Protein ABIL2                                           115   2e-27   Gossypium arboreum [tree cotton]
ref|XP_006397807.1|  hypothetical protein EUTSA_v10001562mg             116   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006294665.1|  hypothetical protein CARUB_v10023702mg             116   3e-27   Capsella rubella
ref|XP_006294664.1|  hypothetical protein CARUB_v10023702mg             115   3e-27   Capsella rubella
ref|XP_006842582.1|  hypothetical protein AMTR_s00077p00158760          115   3e-27   Amborella trichopoda
gb|ACF86655.1|  unknown                                                 115   3e-27   Zea mays [maize]
ref|NP_001148582.1|  protein ABIL1                                      115   3e-27   Zea mays [maize]
ref|XP_002981240.1|  hypothetical protein SELMODRAFT_113760             112   4e-27   
ref|XP_007051671.1|  ABI-1-like 1 isoform 1                             115   4e-27   Theobroma cacao [chocolate]
ref|XP_002982709.1|  hypothetical protein SELMODRAFT_116820             111   4e-27   
ref|XP_010058112.1|  PREDICTED: uncharacterized protein LOC104445868    115   5e-27   
emb|CDY42020.1|  BnaC04g00980D                                          115   6e-27   Brassica napus [oilseed rape]
ref|NP_001189756.1|  protein ABIL1                                      114   7e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43461.1|  unknown protein                                        114   8e-27   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA52710.1|  TPA: hypothetical protein ZEAMMB73_198209              111   8e-27   
ref|NP_001118534.1|  protein ABIL1                                      115   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566067.1|  protein ABIL1                                         114   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KJB24623.1|  hypothetical protein B456_004G154100                    112   9e-27   Gossypium raimondii
ref|XP_011093158.1|  PREDICTED: protein ABIL1-like isoform X3           114   9e-27   Sesamum indicum [beniseed]
gb|KFK37419.1|  hypothetical protein AALP_AA4G254700                    114   9e-27   Arabis alpina [alpine rockcress]
ref|XP_011093141.1|  PREDICTED: protein ABIL1-like isoform X1           114   9e-27   Sesamum indicum [beniseed]
ref|XP_011093148.1|  PREDICTED: protein ABIL1-like isoform X2           114   9e-27   
gb|KFK37420.1|  hypothetical protein AALP_AA4G254700                    114   1e-26   Arabis alpina [alpine rockcress]
emb|CDX79998.1|  BnaA05g01580D                                          114   1e-26   
ref|XP_009142675.1|  PREDICTED: protein ABIL1                           114   1e-26   Brassica rapa
ref|XP_006339648.1|  PREDICTED: protein ABIL1-like                      114   1e-26   Solanum tuberosum [potatoes]
gb|EYU38926.1|  hypothetical protein MIMGU_mgv1a010976mg                114   1e-26   Erythranthe guttata [common monkey flower]
ref|XP_004133838.1|  PREDICTED: protein ABIL1-like                      114   1e-26   Cucumis sativus [cucumbers]
gb|KJB24622.1|  hypothetical protein B456_004G154100                    113   1e-26   Gossypium raimondii
ref|XP_008437975.1|  PREDICTED: protein ABIL1                           114   1e-26   Cucumis melo [Oriental melon]
ref|XP_010506621.1|  PREDICTED: protein ABIL1 isoform X2                114   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010092890.1|  hypothetical protein L484_022485                   113   2e-26   Morus notabilis
ref|XP_010506619.1|  PREDICTED: protein ABIL1 isoform X1                114   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010544778.1|  PREDICTED: protein ABIL1                           113   2e-26   Tarenaya hassleriana [spider flower]
gb|KJB24621.1|  hypothetical protein B456_004G154100                    113   2e-26   Gossypium raimondii
ref|XP_010508052.1|  PREDICTED: protein ABIL1-like isoform X2           113   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010518289.1|  PREDICTED: protein ABIL1-like isoform X2           113   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010508051.1|  PREDICTED: protein ABIL1-like isoform X1           113   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010518288.1|  PREDICTED: protein ABIL1-like isoform X1           113   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010261431.1|  PREDICTED: protein ABIL1 isoform X1                112   4e-26   Nelumbo nucifera [Indian lotus]
emb|CDP08740.1|  unnamed protein product                                112   4e-26   Coffea canephora [robusta coffee]
ref|XP_006444921.1|  hypothetical protein CICLE_v10021371mg             112   6e-26   
ref|XP_009597505.1|  PREDICTED: protein ABIL1                           112   6e-26   
ref|XP_004494774.1|  PREDICTED: protein ABIL1-like isoform X2           112   6e-26   
ref|XP_004229960.1|  PREDICTED: protein ABIL1                           112   6e-26   
ref|XP_004494773.1|  PREDICTED: protein ABIL1-like isoform X1           112   7e-26   
ref|XP_011093164.1|  PREDICTED: protein ABIL1-like isoform X4           111   8e-26   
ref|XP_009801437.1|  PREDICTED: protein ABIL1                           111   1e-25   
ref|XP_010261432.1|  PREDICTED: protein ABIL1 isoform X2                111   1e-25   
gb|EPS61815.1|  hypothetical protein M569_12976                         106   2e-25   
gb|KJB49456.1|  hypothetical protein B456_008G122600                    108   2e-25   
ref|XP_010669659.1|  PREDICTED: protein ABIL1                           110   3e-25   
ref|XP_010924781.1|  PREDICTED: protein ABIL1-like isoform X2           110   3e-25   
ref|XP_004306717.1|  PREDICTED: protein ABIL1                           110   3e-25   
ref|XP_008232956.1|  PREDICTED: protein ABIL1                           110   3e-25   
ref|XP_009338792.1|  PREDICTED: protein ABIL1-like                      110   4e-25   
ref|XP_009377232.1|  PREDICTED: protein ABIL1-like                      109   4e-25   
ref|XP_010924779.1|  PREDICTED: protein ABIL1-like isoform X1           109   5e-25   
ref|XP_011093075.1|  PREDICTED: protein ABIL1-like isoform X1           109   5e-25   
gb|KJB49455.1|  hypothetical protein B456_008G122600                    107   6e-25   
ref|XP_011037292.1|  PREDICTED: protein ABIL1                           109   6e-25   
ref|XP_011023255.1|  PREDICTED: protein ABIL1-like isoform X1           109   9e-25   
ref|XP_011023256.1|  PREDICTED: protein ABIL1-like isoform X2           108   9e-25   
emb|CDX83376.1|  BnaA03g21300D                                          108   1e-24   
gb|KJB49461.1|  hypothetical protein B456_008G122600                    107   1e-24   
ref|XP_009133767.1|  PREDICTED: protein ABIL1-like isoform X2           108   1e-24   
ref|XP_008792392.1|  PREDICTED: protein ABIL1-like                      108   1e-24   
ref|XP_002320167.2|  hypothetical protein POPTR_0014s08800g             108   1e-24   
ref|XP_002511938.1|  Protein ABIL1, putative                            108   1e-24   
ref|NP_001149311.1|  LOC100282934                                       108   1e-24   
ref|XP_008375925.1|  PREDICTED: protein ABIL1                           108   1e-24   
gb|KEH18772.1|  ABIL1-like protein                                      106   1e-24   
ref|XP_007218725.1|  hypothetical protein PRUPE_ppa009050mg             108   1e-24   
gb|KJB49459.1|  hypothetical protein B456_008G122600                    108   2e-24   
gb|KJB49457.1|  hypothetical protein B456_008G122600                    107   2e-24   
gb|KJB49460.1|  hypothetical protein B456_008G122600                    108   2e-24   
ref|XP_003626514.1|  Protein ABIL1                                      108   2e-24   
ref|XP_009133766.1|  PREDICTED: protein ABIL1-like isoform X1           108   2e-24   
emb|CDY68381.1|  BnaC03g72740D                                          108   2e-24   
tpg|DAA58512.1|  TPA: hypothetical protein ZEAMMB73_369391              108   2e-24   
tpg|DAA58511.1|  TPA: hypothetical protein ZEAMMB73_369391              108   2e-24   
gb|ACR34577.1|  unknown                                                 108   2e-24   
ref|XP_010917115.1|  PREDICTED: protein ABIL1-like                      107   2e-24   
gb|KJB49451.1|  hypothetical protein B456_008G122600                    107   3e-24   
gb|KDP28544.1|  hypothetical protein JCGZ_14315                         107   3e-24   
gb|EYU32190.1|  hypothetical protein MIMGU_mgv1a011425mg                107   3e-24   
ref|XP_002301384.2|  hypothetical protein POPTR_0002s16750g             107   4e-24   
gb|KEH18770.1|  ABIL1-like protein                                      105   4e-24   
ref|XP_003548613.1|  PREDICTED: protein ABIL1-like                      107   4e-24   
ref|XP_003528820.1|  PREDICTED: protein ABIL1-like                      107   5e-24   
gb|KHN15983.1|  Protein ABIL1                                           107   5e-24   
ref|XP_004155889.1|  PREDICTED: LOW QUALITY PROTEIN: protein ABIL...    107   5e-24   
ref|XP_010912285.1|  PREDICTED: putative protein ABIL2 isoform X2       106   7e-24   
ref|XP_010912302.1|  PREDICTED: putative protein ABIL2 isoform X4       106   8e-24   
ref|XP_003626513.1|  Protein ABIL1                                      106   8e-24   
ref|XP_008802046.1|  PREDICTED: probable protein ABIL1 isoform X4       106   8e-24   
gb|KEH18771.1|  ABIL1-like protein                                      106   8e-24   
ref|XP_007135156.1|  hypothetical protein PHAVU_010G105800g             106   8e-24   
gb|EEE55009.1|  hypothetical protein OsJ_02653                          106   9e-24   
gb|KEH18769.1|  ABIL1-like protein                                      106   1e-23   
ref|XP_008802044.1|  PREDICTED: probable protein ABIL1 isoform X2       106   1e-23   
ref|XP_010251587.1|  PREDICTED: protein ABIL1-like isoform X1           105   1e-23   
ref|NP_001043613.1|  Os01g0622700                                       105   2e-23   
ref|XP_009394150.1|  PREDICTED: probable protein ABIL1 isoform X2       105   2e-23   
ref|XP_009394149.1|  PREDICTED: probable protein ABIL1 isoform X1       105   3e-23   
ref|XP_008802045.1|  PREDICTED: protein ABIL1-like isoform X3           105   3e-23   
ref|XP_007147254.1|  hypothetical protein PHAVU_006G108900g             104   3e-23   
ref|XP_002458183.1|  hypothetical protein SORBIDRAFT_03g028350          104   3e-23   
gb|EMS58659.1|  hypothetical protein TRIUR3_01529                       105   3e-23   
ref|XP_008802043.1|  PREDICTED: protein ABIL1-like isoform X1           104   4e-23   
ref|XP_010251588.1|  PREDICTED: protein ABIL1-like isoform X2           104   5e-23   
ref|XP_003567834.1|  PREDICTED: probable protein ABIL4 isoform X2       103   6e-23   
gb|ABS87386.1|  ABIL3-like protein                                      103   6e-23   
ref|XP_004491966.1|  PREDICTED: protein ABIL1-like                      103   6e-23   
ref|XP_010053769.1|  PREDICTED: protein ABIL1                           102   7e-23   
ref|XP_010230991.1|  PREDICTED: probable protein ABIL4 isoform X1       103   7e-23   
ref|XP_004488717.1|  PREDICTED: protein ABIL1-like                      103   7e-23   
gb|ACN40612.1|  unknown                                                 102   9e-23   
ref|XP_004510703.1|  PREDICTED: protein ABIL1-like                      103   9e-23   
gb|KCW78126.1|  hypothetical protein EUGRSUZ_D02333                     102   1e-22   
gb|KJB49458.1|  hypothetical protein B456_008G122600                    103   1e-22   
ref|XP_004969207.1|  PREDICTED: probable protein ABIL1-like             103   1e-22   
gb|AFK45593.1|  unknown                                                 103   1e-22   
ref|XP_006646118.1|  PREDICTED: probable protein ABIL1-like             102   1e-22   
gb|EPS71503.1|  hypothetical protein M569_03258                         100   2e-22   
ref|XP_003554741.1|  PREDICTED: protein ABIL1-like                      102   2e-22   
emb|CDM82654.1|  unnamed protein product                                101   4e-22   
ref|XP_003569387.1|  PREDICTED: probable protein ABIL1                  101   4e-22   
emb|CDY00780.1|  BnaC03g37640D                                          100   4e-22   
gb|EMT08867.1|  hypothetical protein F775_26056                         101   4e-22   
gb|KCW78125.1|  hypothetical protein EUGRSUZ_D02333                     101   5e-22   
gb|KHN43134.1|  Protein ABIL1                                           100   7e-22   
gb|EMS54348.1|  hypothetical protein TRIUR3_24588                       100   1e-21   
gb|KJB09709.1|  hypothetical protein B456_001G158200                    100   1e-21   
ref|XP_009406793.1|  PREDICTED: protein ABIL1-like isoform X2           100   2e-21   
ref|XP_009406792.1|  PREDICTED: probable protein ABIL1 isoform X1     99.8    2e-21   
gb|EPS71015.1|  hypothetical protein M569_03744                       99.0    2e-21   
ref|XP_009416405.1|  PREDICTED: probable protein ABIL1                99.4    2e-21   
gb|KHN35348.1|  Protein ABIL1                                         99.0    2e-21   
ref|XP_006655638.1|  PREDICTED: probable protein ABIL4-like           99.4    3e-21   
ref|XP_009392459.1|  PREDICTED: probable protein ABIL1                99.4    3e-21   
ref|XP_009410866.1|  PREDICTED: probable protein ABIL1                99.0    3e-21   
ref|NP_001056454.1|  Os05g0585400                                     99.0    3e-21   
ref|XP_002440340.1|  hypothetical protein SORBIDRAFT_09g029940        99.0    4e-21   
ref|XP_004961070.1|  PREDICTED: probable protein ABIL4-like           98.2    6e-21   
ref|XP_008656080.1|  PREDICTED: probable protein ABIL4                98.2    6e-21   
ref|XP_006577333.1|  PREDICTED: protein ABIL1-like                    98.2    6e-21   
gb|EMT22024.1|  hypothetical protein F775_00995                       96.3    2e-20   
gb|EMS66396.1|  hypothetical protein TRIUR3_28294                     94.0    6e-20   
gb|EMT25191.1|  hypothetical protein F775_06300                       94.7    1e-19   
gb|EMS46505.1|  hypothetical protein TRIUR3_15295                     94.4    3e-19   
gb|KDO76610.1|  hypothetical protein CISIN_1g045801mg                 91.7    1e-18   
emb|CDY57047.1|  BnaC08g15010D                                        85.9    1e-17   
emb|CDY26141.1|  BnaC06g10550D                                        86.7    3e-17   
ref|XP_001767060.1|  predicted protein                                84.0    7e-17   
ref|XP_008369969.1|  PREDICTED: probable protein ABIL1                83.6    8e-17   
ref|XP_007013135.1|  ABI-1-like 1, putative isoform 1                 84.0    4e-16   
gb|KHG20322.1|  hypothetical protein F383_09130                       83.6    7e-16   
ref|XP_008462689.1|  PREDICTED: probable protein ABIL5 isoform X2     82.4    1e-15   
ref|XP_008462688.1|  PREDICTED: probable protein ABIL5 isoform X1     82.8    1e-15   
ref|XP_004162800.1|  PREDICTED: probable protein ABIL5-like           82.0    2e-15   
emb|CDX79218.1|  BnaC06g20850D                                        79.0    2e-15   
gb|KJB54213.1|  hypothetical protein B456_009G025800                  81.6    2e-15   
ref|XP_002284308.1|  PREDICTED: probable protein ABIL5                81.6    3e-15   
gb|KJB54211.1|  hypothetical protein B456_009G025800                  81.6    3e-15   
ref|XP_004150382.1|  PREDICTED: probable protein ABIL5-like           81.6    3e-15   
gb|KJB54212.1|  hypothetical protein B456_009G025800                  81.3    3e-15   
emb|CBI28051.3|  unnamed protein product                              81.6    4e-15   
gb|KJB54214.1|  hypothetical protein B456_009G025800                  81.3    4e-15   
ref|XP_008462690.1|  PREDICTED: probable protein ABIL5 isoform X3     80.9    5e-15   
ref|XP_004287396.1|  PREDICTED: probable protein ABIL5                80.9    5e-15   
ref|XP_007013137.1|  ABI-1-like 1, putative isoform 3                 80.5    6e-15   
ref|XP_010047900.1|  PREDICTED: probable protein ABIL5                80.1    8e-15   
ref|XP_007013136.1|  ABI-1-like 1, putative isoform 2                 80.1    9e-15   
ref|XP_007202421.1|  hypothetical protein PRUPE_ppa009726mg           79.3    2e-14   
ref|XP_006833331.1|  hypothetical protein AMTR_s00109p00075250        78.2    2e-14   
gb|KDO48874.1|  hypothetical protein CISIN_1g024146mg                 79.0    2e-14   
ref|XP_003525272.1|  PREDICTED: probable protein ABIL5-like           79.0    2e-14   
ref|XP_010688230.1|  PREDICTED: probable protein ABIL5 isoform X1     79.0    3e-14   
ref|XP_006451185.1|  hypothetical protein CICLE_v10009168mg           78.6    3e-14   
ref|XP_011093173.1|  PREDICTED: protein ABIL1-like isoform X5         78.2    3e-14   
ref|XP_008242670.1|  PREDICTED: probable protein ABIL5                78.2    4e-14   
ref|XP_003530545.2|  PREDICTED: probable protein ABIL5-like           77.8    5e-14   
gb|KDP33690.1|  hypothetical protein JCGZ_07261                       77.8    5e-14   
ref|XP_003620605.1|  Protein ABIL1                                    77.4    7e-14   
ref|XP_009803579.1|  PREDICTED: probable protein ABIL5 isoform X2     77.4    7e-14   
ref|XP_009803578.1|  PREDICTED: probable protein ABIL5 isoform X1     77.4    8e-14   
gb|EPS63873.1|  hypothetical protein M569_10913                       78.6    1e-13   
ref|XP_008793051.1|  PREDICTED: probable protein ABIL5 isoform X1     77.0    1e-13   
ref|XP_011043497.1|  PREDICTED: probable protein ABIL5 isoform X2     76.3    2e-13   
ref|XP_011043498.1|  PREDICTED: probable protein ABIL5 isoform X3     76.3    2e-13   
ref|XP_011043496.1|  PREDICTED: probable protein ABIL5 isoform X1     76.3    2e-13   
gb|EMS49799.1|  hypothetical protein TRIUR3_14475                     75.9    3e-13   
gb|KHN45634.1|  Hypothetical protein glysoja_031505                   75.9    3e-13   
ref|XP_010254080.1|  PREDICTED: probable protein ABIL5                75.5    3e-13   
ref|XP_008343407.1|  PREDICTED: protein ABIL1-like                    75.5    4e-13   
ref|XP_006405280.1|  hypothetical protein EUTSA_v10027878mg           75.1    4e-13   
ref|XP_011093076.1|  PREDICTED: protein ABIL1-like isoform X2         75.1    5e-13   
ref|NP_001241017.1|  uncharacterized protein LOC100798609             74.3    8e-13   
ref|XP_007152847.1|  hypothetical protein PHAVU_004G164900g           74.3    9e-13   
ref|XP_003528929.1|  PREDICTED: probable protein ABIL5-like           74.3    9e-13   
ref|XP_002514282.1|  conserved hypothetical protein                   73.9    1e-12   
ref|XP_009371444.1|  PREDICTED: probable protein ABIL5                73.6    1e-12   
ref|XP_010920435.1|  PREDICTED: probable protein ABIL5                73.9    2e-12   
ref|XP_009416729.1|  PREDICTED: probable protein ABIL5                73.2    2e-12   
ref|XP_004252057.2|  PREDICTED: probable protein ABIL5                73.2    2e-12   
ref|XP_009374038.1|  PREDICTED: probable protein ABIL5                73.6    2e-12   
ref|XP_009406229.1|  PREDICTED: probable protein ABIL5 isoform X2     72.8    3e-12   
gb|KCW79917.1|  hypothetical protein EUGRSUZ_C01259                   72.8    3e-12   
ref|XP_009406230.1|  PREDICTED: probable protein ABIL5 isoform X3     72.0    3e-12   
ref|XP_006353464.1|  PREDICTED: protein ABIL2-like                    72.4    4e-12   
ref|XP_009406228.1|  PREDICTED: probable protein ABIL5 isoform X1     72.4    5e-12   
ref|XP_008337372.1|  PREDICTED: probable protein ABIL5                72.0    7e-12   
ref|XP_010924589.1|  PREDICTED: probable protein ABIL5                72.0    7e-12   
ref|XP_002324998.2|  hypothetical protein POPTR_0018s08920g           71.2    9e-12   
ref|XP_007211203.1|  hypothetical protein PRUPE_ppa009754mg           65.1    1e-11   
ref|XP_010249692.1|  PREDICTED: probable protein ABIL5 isoform X3     70.1    2e-11   
ref|XP_004512986.1|  PREDICTED: probable protein ABIL5-like           70.5    2e-11   
ref|XP_010249690.1|  PREDICTED: probable protein ABIL5 isoform X1     70.1    2e-11   
ref|XP_010249691.1|  PREDICTED: probable protein ABIL5 isoform X2     69.7    3e-11   
ref|XP_011093598.1|  PREDICTED: protein ABIL4-like                    69.7    3e-11   
ref|XP_004488722.1|  PREDICTED: protein ABIL1-like                    68.9    1e-10   
ref|XP_006644744.1|  PREDICTED: probable protein ABIL5-like           66.6    5e-10   
gb|EYU32935.1|  hypothetical protein MIMGU_mgv1a012340mg              64.7    2e-09   
ref|XP_006441118.1|  hypothetical protein CICLE_v10023724mg           62.0    3e-09   
ref|XP_010089225.1|  hypothetical protein L484_002500                 65.9    5e-09   
emb|CDY39460.1|  BnaC03g60700D                                        61.6    1e-08   
ref|NP_001044319.1|  Os01g0760900                                     62.4    1e-08   
emb|CDY32903.1|  BnaC02g11870D                                        60.5    2e-08   
ref|XP_007160329.1|  hypothetical protein PHAVU_002G312400g           61.2    4e-08   
ref|XP_010055892.1|  PREDICTED: protein ABIL2-like                    58.9    4e-08   
emb|CDP03315.1|  unnamed protein product                              60.8    5e-08   
emb|CDY61083.1|  BnaC06g41120D                                        58.5    1e-07   
gb|EEE55412.1|  hypothetical protein OsJ_03532                        58.2    4e-07   
gb|EEC71522.1|  hypothetical protein OsI_03823                        57.4    7e-07   
emb|CDX99519.1|  BnaC09g24730D                                        55.5    2e-06   
ref|XP_008802047.1|  PREDICTED: protein ABIL1-like isoform X5         56.2    3e-06   
ref|XP_008789392.1|  PREDICTED: probable protein ABIL5                53.5    4e-06   
ref|XP_010688231.1|  PREDICTED: uncharacterized protein LOC104902...  55.5    4e-06   
ref|XP_011078311.1|  PREDICTED: probable protein ABIL5 isoform X2     55.5    4e-06   
ref|XP_011078310.1|  PREDICTED: probable protein ABIL5 isoform X1     55.8    4e-06   
ref|XP_010519709.1|  PREDICTED: probable protein ABIL5 isoform X2     53.9    1e-05   
ref|XP_010519707.1|  PREDICTED: probable protein ABIL5 isoform X1     53.9    1e-05   
ref|XP_009610593.1|  PREDICTED: probable protein ABIL5 isoform X2     52.8    2e-05   
ref|XP_009610592.1|  PREDICTED: probable protein ABIL5 isoform X1     52.8    2e-05   
dbj|BAB61213.1|  P0460E08.23                                          51.6    3e-05   
ref|XP_010519710.1|  PREDICTED: probable protein ABIL5 isoform X3     52.0    5e-05   
ref|XP_008793052.1|  PREDICTED: probable protein ABIL5 isoform X2     52.0    7e-05   
ref|XP_006372056.1|  hypothetical protein POPTR_0018s08920g           51.2    8e-05   



>ref|XP_010325349.1| PREDICTED: protein ABIL2-like isoform X2 [Solanum lycopersicum]
Length=282

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDLKNLRKQ YSAAEYFE SYG++EHK  +++T+K YVSKA++++VDHLGS+A K
Sbjct  30   FSDSLKDLKNLRKQLYSAAEYFESSYGENEHKTLVIETLKDYVSKALVSSVDHLGSVACK  89

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            L+TFLDEKV EFS T+LRFSC+EQ+ ++CQE +DR+G+ QQS + V PK  K  +N  + 
Sbjct  90   LNTFLDEKVDEFSTTKLRFSCMEQKLQTCQEIVDRSGLLQQSLIIVTPKQHKRYVN--TA  147

Query  485  VDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEHPT  631
             +T   + K  +R+     L P  D  H +        F A  +K HP+
Sbjct  148  AETQPAVPKPRQRNSEQN-LCPQEDLQHGD---CFPHPFQALPSKPHPS  192



>ref|XP_006343822.1| PREDICTED: protein ABIL2-like [Solanum tuberosum]
Length=335

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 115/169 (68%), Gaps = 3/169 (2%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDLKNLRKQ YSAAEYFE SYG++EHK  +++T+K YVSKA++++VDHLGS+A K
Sbjct  30   FSDSLKDLKNLRKQLYSAAEYFESSYGENEHKTLVIETLKDYVSKALVSSVDHLGSVACK  89

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            L+TFLDEKV EFS T+LRFSC+EQ+ ++CQE +DR+G+ QQS + V PK  K  IN  + 
Sbjct  90   LNTFLDEKVDEFSTTKLRFSCMEQKLQTCQEIVDRSGLLQQSLIIVTPKQHKRYIN--TA  147

Query  485  VDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEHPT  631
             +T   + K  +R+     L P  D    N        F A   K HP+
Sbjct  148  AETQPAVPKPRQRNKEQN-LCPQEDLQLPNHGDCFPHPFQALPLKPHPS  195



>ref|XP_004245491.1| PREDICTED: protein ABIL2-like isoform X1 [Solanum lycopersicum]
Length=333

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 6/169 (4%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDLKNLRKQ YSAAEYFE SYG++EHK  +++T+K YVSKA++++VDHLGS+A K
Sbjct  30   FSDSLKDLKNLRKQLYSAAEYFESSYGENEHKTLVIETLKDYVSKALVSSVDHLGSVACK  89

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            L+TFLDEKV EFS T+LRFSC+EQ+ ++CQE +DR+G+ QQS + V PK  K  +N  + 
Sbjct  90   LNTFLDEKVDEFSTTKLRFSCMEQKLQTCQEIVDRSGLLQQSLIIVTPKQHKRYVN--TA  147

Query  485  VDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEHPT  631
             +T   + K  +R+     L P  D  H +        F A  +K HP+
Sbjct  148  AETQPAVPKPRQRNSEQN-LCPQEDLQHGD---CFPHPFQALPSKPHPS  192



>ref|XP_009629169.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629170.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
Length=332

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDLKNLRKQ YSAAEYFE SYG++EHK  +++T+K YVSKA++++VDHLGS+A K
Sbjct  31   FSDSLKDLKNLRKQLYSAAEYFESSYGENEHKTLVIETLKDYVSKALVSSVDHLGSVACK  90

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPK  451
            L++FLDEKV EFS T+LRFSC+EQ+ ++CQEF+DR+G+ QQSFV + PK
Sbjct  91   LNSFLDEKVDEFSTTKLRFSCMEQKLQTCQEFVDRSGLLQQSFVILTPK  139



>ref|XP_009629171.1| PREDICTED: protein ABIL2-like isoform X2 [Nicotiana tomentosiformis]
Length=330

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDLKNLRKQ YSAAEYFE SYG++EHK  +++T+K YVSKA++++VDHLGS+A K
Sbjct  31   FSDSLKDLKNLRKQLYSAAEYFESSYGENEHKTLVIETLKDYVSKALVSSVDHLGSVACK  90

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPK  451
            L++FLDEKV EFS T+LRFSC+EQ+ ++CQEF+DR+G+ QQSFV + PK
Sbjct  91   LNSFLDEKVDEFSTTKLRFSCMEQKLQTCQEFVDRSGLLQQSFVILTPK  139



>ref|XP_010912294.1| PREDICTED: putative protein ABIL2 isoform X3 [Elaeis guineensis]
Length=322

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  22   ELSMQQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQLVVNTLKDYAVKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K++  LDEKV E S TELR SC+EQR R+CQ FIDR G+ QQS V   
Sbjct  78   VNTVDHLGSVSFKVNGLLDEKVDEVSGTELRVSCIEQRIRTCQAFIDREGLSQQSLVITA  137

Query  446  PKYLKHCINPGSDV  487
            PKY K  I PG  +
Sbjct  138  PKYHKRYILPGGSL  151



>ref|XP_010912262.1| PREDICTED: putative protein ABIL2 isoform X1 [Elaeis guineensis]
 ref|XP_010912270.1| PREDICTED: putative protein ABIL2 isoform X1 [Elaeis guineensis]
 ref|XP_010912276.1| PREDICTED: putative protein ABIL2 isoform X1 [Elaeis guineensis]
Length=323

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  22   ELSMQQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQLVVNTLKDYAVKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K++  LDEKV E S TELR SC+EQR R+CQ FIDR G+ QQS V   
Sbjct  78   VNTVDHLGSVSFKVNGLLDEKVDEVSGTELRVSCIEQRIRTCQAFIDREGLSQQSLVITA  137

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  138  PKYHKRYILP  147



>ref|XP_009803885.1| PREDICTED: protein ABIL2-like [Nicotiana sylvestris]
 ref|XP_009803886.1| PREDICTED: protein ABIL2-like [Nicotiana sylvestris]
Length=334

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 114/169 (67%), Gaps = 3/169 (2%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDLKNLRKQ YSAAEYFE SYG++EHK  +++T+K YVS A++++VDHLGS+A K
Sbjct  31   FSDSLKDLKNLRKQLYSAAEYFESSYGENEHKTLVIETLKDYVSNALVSSVDHLGSVACK  90

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            L++FLDEKV EFS T+LRFSC+EQ+ ++CQE +DR+G+ QQSFV + PK  K  +   S 
Sbjct  91   LNSFLDEKVDEFSTTKLRFSCMEQKLQTCQEVVDRSGLLQQSFVVLTPKQHKRYM--ISA  148

Query  485  VDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEHPT  631
             +T   + K  +R      L P  D     Q       F A  +K HP+
Sbjct  149  AETQPAVIKPRQRHKEQN-LCPQDDLRLPKQGDCFPHPFQALPSKPHPS  196



>ref|XP_011070348.1| PREDICTED: protein ABIL2-like isoform X2 [Sesamum indicum]
Length=293

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  113  NRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGS  292
            N  +  DSLKDLKNLRKQ YSAAEYFE SYGK++HKQ ++++ K YV+KA+++TVDHLGS
Sbjct  22   NSLHFADSLKDLKNLRKQLYSAAEYFESSYGKNDHKQLVIESSKDYVAKALVSTVDHLGS  81

Query  293  IAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCIN  472
            +A KL+ FLDEK  E SAT++RFSC+EQR ++   FID  GI Q S +   PK+ K  I 
Sbjct  82   VADKLNRFLDEKANELSATKIRFSCIEQRLKTSHRFIDLRGITQHSLMIETPKHHKRYIV  141

Query  473  PGSDV  487
            PG+D 
Sbjct  142  PGADT  146



>ref|XP_011070345.1| PREDICTED: protein ABIL2-like isoform X1 [Sesamum indicum]
 ref|XP_011070346.1| PREDICTED: protein ABIL2-like isoform X1 [Sesamum indicum]
 ref|XP_011070347.1| PREDICTED: protein ABIL2-like isoform X1 [Sesamum indicum]
Length=309

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  113  NRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGS  292
            N  +  DSLKDLKNLRKQ YSAAEYFE SYGK++HKQ ++++ K YV+KA+++TVDHLGS
Sbjct  22   NSLHFADSLKDLKNLRKQLYSAAEYFESSYGKNDHKQLVIESSKDYVAKALVSTVDHLGS  81

Query  293  IAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCIN  472
            +A KL+ FLDEK  E SAT++RFSC+EQR ++   FID  GI Q S +   PK+ K  I 
Sbjct  82   VADKLNRFLDEKANELSATKIRFSCIEQRLKTSHRFIDLRGITQHSLMIETPKHHKRYIV  141

Query  473  PGSDV  487
            PG+D 
Sbjct  142  PGADT  146



>emb|CDP05046.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  77   IKKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVS  256
            I  E +M +S+      +DSLKDLKNLRKQ YSAAEYFE+SY  D+ KQ +V+T+K Y  
Sbjct  18   IYDEASMQQSMV----FSDSLKDLKNLRKQLYSAAEYFELSYTSDDQKQIVVNTLKDYAI  73

Query  257  KAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            KA++NTVDHLGS++ K++  LDEKV E S TELR SC+EQR R+CQ++IDR G+ QQS V
Sbjct  74   KALVNTVDHLGSMSYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCQDYIDREGLSQQSLV  133

Query  437  TVLPKYLKHCI  469
               PKY K  I
Sbjct  134  INTPKYHKRYI  144



>ref|XP_008810684.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
 ref|XP_008810685.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
 ref|XP_008810686.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
 ref|XP_008810687.1| PREDICTED: putative protein ABIL2 [Phoenix dactylifera]
Length=323

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  22   ELSMHQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQLVVNTLKDYAVKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K++  LDEKV E S TELR SC+EQR R+CQ  IDR G+ QQS V   
Sbjct  78   VNTVDHLGSVSFKVNGLLDEKVDEVSGTELRVSCIEQRIRTCQALIDREGLSQQSLVITA  137

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  138  PKYHKRYILP  147



>ref|XP_011075964.1| PREDICTED: protein ABIL2-like [Sesamum indicum]
Length=328

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLRKQ YSAAEYFE+SY  D+ K  +V+T+K Y  KA+
Sbjct  21   EVSMQQSML----FSDSLKDLKNLRKQLYSAAEYFELSYTNDDQKHIVVNTLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR R+CQE+IDR GI QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCQEYIDREGISQQSLVINT  136

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  137  PNYHKRYILP  146



>ref|XP_004307967.1| PREDICTED: protein ABIL2 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011470212.1| PREDICTED: protein ABIL2 isoform X1 [Fragaria vesca subsp. vesca]
Length=319

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 112/182 (62%), Gaps = 13/182 (7%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  17   EVSMHQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQTVVETLKDYAIKAL  72

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  73   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQSSVIDT  132

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +      +G +N+        Y G +    ++ HQ +    AT ++  
Sbjct  133  PKYHKRYILPVGET-----MGGANK----TKSTYKGCNLDDEDEWHQFRNAVRATISETP  183

Query  626  PT  631
            PT
Sbjct  184  PT  185



>ref|XP_011470213.1| PREDICTED: protein ABIL2 isoform X2 [Fragaria vesca subsp. vesca]
Length=318

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 112/182 (62%), Gaps = 13/182 (7%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  17   EVSMHQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQTVVETLKDYAIKAL  72

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  73   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQSSVIDT  132

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +      +G +N+        Y G +    ++ HQ +    AT ++  
Sbjct  133  PKYHKRYILPVGET-----MGGANK----TKSTYKGCNLDDEDEWHQFRNAVRATISETP  183

Query  626  PT  631
            PT
Sbjct  184  PT  185



>gb|KJB52569.1| hypothetical protein B456_008G268000 [Gossypium raimondii]
Length=197

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 110/182 (60%), Gaps = 14/182 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q Y+AAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSLL----FSDSLKDLKNLRSQLYTAAEYFELSYTNDDQKQIVVETLKDYTIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NT+DHLGS+  K++  LDEKV E S TELR SC+EQR R+C E+ID  GI QQS V   
Sbjct  74   VNTIDHLGSVTYKVNDLLDEKVEEVSGTELRVSCIEQRLRTCHEYIDHEGISQQSSVINT  133

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +    ++L KS          Y G      +  HQ +    AT  +E 
Sbjct  134  PKYNKRYILPVGETMHGANLTKSK---------YVGCSLDDEDDWHQFKNAVQAT-IRET  183

Query  626  PT  631
            PT
Sbjct  184  PT  185



>ref|XP_006350530.1| PREDICTED: protein ABIL3-like isoform X1 [Solanum tuberosum]
 ref|XP_006350531.1| PREDICTED: protein ABIL3-like isoform X2 [Solanum tuberosum]
Length=325

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLRKQ YSAAEYFE+SY  DE K  +VDT+K Y  KA+
Sbjct  21   EVSMHQSML----FSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKDVVVDTLKEYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+   LDEKV E S TELR SC+EQR ++CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVSDLLDEKVDEVSGTELRISCIEQRLKTCQEYIDNEGLSQQSLVIHT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>gb|KJB17380.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
Length=183

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYF ++Y K+  KQ + DT+K Y  K
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFAMAYTKEMQKQIVEDTLKDYAIK  74

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQR R+CQ++++  G+ QQS V 
Sbjct  75   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQSLVL  134

Query  440  VLPKYLKHCINPGSDVDTVSDLGKSNRR  523
              PK+ KH I P +  +T++D+  +N R
Sbjct  135  EAPKHHKHYIFPVN--ETLTDVAIANPR  160



>ref|XP_010318026.1| PREDICTED: protein ABIL3 [Solanum lycopersicum]
Length=325

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLRKQ YSAAEYFE+SY  DE K  +VDT+K Y  KA+
Sbjct  21   EVSMHQSML----FSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKDVVVDTLKEYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+   LDEKV E S TELR SC+EQR ++CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVSDLLDEKVDEVSGTELRISCIEQRLKTCQEYIDNEGMSQQSLVIHT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>ref|XP_002516649.1| Protein ABIL2, putative [Ricinus communis]
 gb|EEF45668.1| Protein ABIL2, putative [Ricinus communis]
Length=312

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  15   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  70

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  GI QQS V   
Sbjct  71   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGITQQSLVINT  130

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  131  PKYHKRYILP  140



>ref|XP_009623775.1| PREDICTED: protein ABIL2-like isoform X2 [Nicotiana tomentosiformis]
Length=323

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLRKQ YSAAEYFE+SY  DE K+ +V+T+K Y  KA+
Sbjct  21   EVSMHQSML----FSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+   LDEKV E S TELR SC+EQR ++CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLSQQSLVIHT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>ref|XP_009623773.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009623774.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
Length=324

 Score =   152 bits (384),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLRKQ YSAAEYFE+SY  DE K+ +V+T+K Y  KA+
Sbjct  21   EVSMHQSML----FSDSLKDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+   LDEKV E S TELR SC+EQR ++CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLSQQSLVIHT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>gb|KJB17377.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
 gb|KJB17386.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
Length=218

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 104/148 (70%), Gaps = 6/148 (4%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYF ++Y K+  KQ + DT+K Y  K
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFAMAYTKEMQKQIVEDTLKDYAIK  74

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQR R+CQ++++  G+ QQS V 
Sbjct  75   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQSLVL  134

Query  440  VLPKYLKHCINPGSDVDTVSDLGKSNRR  523
              PK+ KH I P +  +T++D+  +N R
Sbjct  135  EAPKHHKHYIFPVN--ETLTDVAIANPR  160



>ref|XP_010266575.1| PREDICTED: protein ABIL2 isoform X2 [Nelumbo nucifera]
Length=313

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 6/141 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  23   ELSMQQSLL----FSDSLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR RSCQ +ID  G+ QQS V   
Sbjct  79   VNTVDHLGSMTYKVNGLLDEKVEEVSGTELRVSCIEQRLRSCQAYIDHQGLAQQSLVITT  138

Query  446  PKYLKHCINPGSDVDTVSDLG  508
            PKY K  I P    +T+  LG
Sbjct  139  PKYHKRYILPVG--ETMRGLG  157



>ref|XP_010266572.1| PREDICTED: protein ABIL2 isoform X1 [Nelumbo nucifera]
 ref|XP_010266574.1| PREDICTED: protein ABIL2 isoform X1 [Nelumbo nucifera]
Length=314

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 97/141 (69%), Gaps = 6/141 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  23   ELSMQQSLL----FSDSLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR RSCQ +ID  G+ QQS V   
Sbjct  79   VNTVDHLGSMTYKVNGLLDEKVEEVSGTELRVSCIEQRLRSCQAYIDHQGLAQQSLVITT  138

Query  446  PKYLKHCINPGSDVDTVSDLG  508
            PKY K  I P    +T+  LG
Sbjct  139  PKYHKRYILPVG--ETMRGLG  157



>gb|KDP45550.1| hypothetical protein JCGZ_18175 [Jatropha curcas]
Length=314

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  15   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  70

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  71   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLTQQSLVINT  130

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  131  PKYHKRYILP  140



>gb|KJB17378.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
 gb|KJB17379.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
 gb|KJB17381.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
 gb|KJB17383.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
 gb|KJB17385.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
 gb|KJB17387.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
Length=184

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYF ++Y K+  KQ + DT+K Y  K
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFAMAYTKEMQKQIVEDTLKDYAIK  74

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQR R+CQ++++  G+ QQS V 
Sbjct  75   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQSLVL  134

Query  440  VLPKYLKHCINPG  478
              PK+ KH I PG
Sbjct  135  EAPKHHKHYIFPG  147



>gb|KJB52567.1| hypothetical protein B456_008G268000 [Gossypium raimondii]
Length=247

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 110/182 (60%), Gaps = 14/182 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q Y+AAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSLL----FSDSLKDLKNLRSQLYTAAEYFELSYTNDDQKQIVVETLKDYTIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NT+DHLGS+  K++  LDEKV E S TELR SC+EQR R+C E+ID  GI QQS V   
Sbjct  74   VNTIDHLGSVTYKVNDLLDEKVEEVSGTELRVSCIEQRLRTCHEYIDHEGISQQSSVINT  133

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +    ++L KS          Y G      +  HQ +    AT  +E 
Sbjct  134  PKYNKRYILPVGETMHGANLTKSK---------YVGCSLDDEDDWHQFKNAVQAT-IRET  183

Query  626  PT  631
            PT
Sbjct  184  PT  185



>ref|XP_010541486.1| PREDICTED: protein ABIL3-like [Tarenaya hassleriana]
Length=318

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  DE K+ +V+T+K Y  KA+
Sbjct  19   ELSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKEIVVETLKDYAIKAL  74

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV E S TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  75   VNTVDHLGSVTYKVNDFLDEKVDEVSGTELRVSCMEQRLRMCQEYMDHEGRSQQSLVINT  134

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++   ++L K
Sbjct  135  PKFHKRYILPAGEMMAGANLSK  156



>ref|XP_010421253.1| PREDICTED: protein ABIL3 isoform X1 [Camelina sativa]
Length=321

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYSNDEQKQIVVETLKDYALKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++   ++L +
Sbjct  134  PKFHKRYILPSGEIKRGANLAE  155



>ref|XP_010454735.1| PREDICTED: protein ABIL3-like [Camelina sativa]
Length=321

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYSNDEQKQIVVETLKDYALKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++   ++L +
Sbjct  134  PKFHKRYILPSGEIKRGANLAE  155



>ref|XP_010421254.1| PREDICTED: protein ABIL3 isoform X2 [Camelina sativa]
Length=315

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  12   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYSNDEQKQIVVETLKDYALKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  127

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++   ++L +
Sbjct  128  PKFHKRYILPSGEIKRGANLAE  149



>ref|XP_006394685.1| hypothetical protein EUTSA_v10004602mg [Eutrema salsugineum]
 gb|ESQ31971.1| hypothetical protein EUTSA_v10004602mg [Eutrema salsugineum]
Length=322

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++    +L K
Sbjct  134  PKFHKRYILPSGEIKRGGNLAK  155



>ref|XP_002317785.1| hypothetical protein POPTR_0012s02400g [Populus trichocarpa]
 gb|EEE96005.1| hypothetical protein POPTR_0012s02400g [Populus trichocarpa]
Length=341

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 90/127 (71%), Gaps = 4/127 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  18   EVSMQQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R  C+EQR R+CQE+ID  GI QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVCCIEQRLRTCQEYIDHEGISQQSLVIDT  133

Query  446  PKYLKHC  466
            PKY K C
Sbjct  134  PKYHKRC  140



>ref|XP_010493575.1| PREDICTED: protein ABIL3-like [Camelina sativa]
Length=321

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYALKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++   ++L +
Sbjct  134  PKFHKRYILPSGEIKRGANLAE  155



>ref|NP_974829.1| ABL interactor-like protein 3 [Arabidopsis thaliana]
 gb|AED93284.1| ABL interactor-like protein 3 [Arabidopsis thaliana]
Length=240

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K    P  ++    +L K
Sbjct  134  PKFHKRYFLPSGEIKRGGNLAK  155



>ref|XP_009784228.1| PREDICTED: protein ABIL2-like isoform X2 [Nicotiana sylvestris]
Length=323

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSL DLKNLRKQ YSAAEYFE+SY  DE K+ +V+T+K Y  KA+
Sbjct  22   EVSMHQSML----FSDSLTDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTLKDYAIKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+   LDEKV E S TELR SC+EQR ++CQE+ID  G+ QQS V   
Sbjct  78   VNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLSQQSLVIHT  137

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  138  PKYHKRYILP  147



>ref|XP_009784226.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009784227.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana sylvestris]
Length=324

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSL DLKNLRKQ YSAAEYFE+SY  DE K+ +V+T+K Y  KA+
Sbjct  22   EVSMHQSML----FSDSLTDLKNLRKQLYSAAEYFELSYSNDEQKEVVVNTLKDYAIKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+   LDEKV E S TELR SC+EQR ++CQE+ID  G+ QQS V   
Sbjct  78   VNTVDHLGSVTYKVSDLLDEKVDEVSGTELRLSCIEQRLKTCQEYIDHEGLSQQSLVIHT  137

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  138  PKYHKRYILP  147



>ref|XP_010662870.1| PREDICTED: protein ABIL2 isoform X2 [Vitis vinifera]
 ref|XP_010662871.1| PREDICTED: protein ABIL2 isoform X2 [Vitis vinifera]
 ref|XP_010662872.1| PREDICTED: protein ABIL2 isoform X2 [Vitis vinifera]
Length=314

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 14/175 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  20   EVSMEQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVMETLKEYAIKAL  75

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR R+C E++D  G+ QQS V   
Sbjct  76   VNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCHEYMDHEGVSQQSLVIDT  135

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLAT  610
            PKY K  I P   V    + G++  +       Y GR     +  HQ +    AT
Sbjct  136  PKYHKRYILP---VGETMNGGRTKSK-------YQGRSLDDEDDWHQFRNAVRAT  180



>emb|CBI23020.3| unnamed protein product [Vitis vinifera]
Length=311

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 14/175 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  17   EVSMEQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVMETLKEYAIKAL  72

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR R+C E++D  G+ QQS V   
Sbjct  73   VNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCHEYMDHEGVSQQSLVIDT  132

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLAT  610
            PKY K  I P   V    + G++  +       Y GR     +  HQ +    AT
Sbjct  133  PKYHKRYILP---VGETMNGGRTKSK-------YQGRSLDDEDDWHQFRNAVRAT  177



>gb|KJB52566.1| hypothetical protein B456_008G268000 [Gossypium raimondii]
 gb|KJB52568.1| hypothetical protein B456_008G268000 [Gossypium raimondii]
Length=320

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 110/182 (60%), Gaps = 14/182 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q Y+AAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSLL----FSDSLKDLKNLRSQLYTAAEYFELSYTNDDQKQIVVETLKDYTIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NT+DHLGS+  K++  LDEKV E S TELR SC+EQR R+C E+ID  GI QQS V   
Sbjct  74   VNTIDHLGSVTYKVNDLLDEKVEEVSGTELRVSCIEQRLRTCHEYIDHEGISQQSSVINT  133

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +    ++L KS          Y G      +  HQ +    AT  +E 
Sbjct  134  PKYNKRYILPVGETMHGANLTKSK---------YVGCSLDDEDDWHQFKNAVQAT-IRET  183

Query  626  PT  631
            PT
Sbjct  184  PT  185



>ref|XP_007218279.1| hypothetical protein PRUPE_ppa008359mg [Prunus persica]
 gb|EMJ19478.1| hypothetical protein PRUPE_ppa008359mg [Prunus persica]
Length=335

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ K  +V+T+K Y  KA+
Sbjct  19   EVSMHQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKDYAIKAL  74

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  75   VNTVDHLGSVTYKVNDFFDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQSSVIDT  134

Query  446  PKYLKHCINPG  478
            PKY K  I PG
Sbjct  135  PKYHKRYILPG  145



>ref|NP_190498.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
 ref|NP_001030832.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
 sp|Q9M3A3.1|ABIL2_ARATH RecName: Full=Protein ABIL2; AltName: Full=Abl interactor-like 
protein 2; Short=AtABIL2 [Arabidopsis thaliana]
 emb|CAB66408.1| putative protein [Arabidopsis thaliana]
 gb|AAW49257.1| Abl interactor-like protein-2 [Arabidopsis thaliana]
 gb|ABG48437.1| At3g49290 [Arabidopsis thaliana]
 gb|AEE78522.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
 gb|AEE78523.1| ABL interactor-like protein 2 [Arabidopsis thaliana]
Length=312

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +D L+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EVSMQQSML----FSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E S TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSVTYKVNDFIDEKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  127

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++ T ++L K
Sbjct  128  PKFHKRYILPAGEIMTATNLEK  149



>ref|XP_006441129.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
 gb|ESR54369.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
Length=234

 Score =   147 bits (372),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  21   EVAMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>ref|XP_002872104.1| hypothetical protein ARALYDRAFT_489290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48363.1| hypothetical protein ARALYDRAFT_489290 [Arabidopsis lyrata subsp. 
lyrata]
Length=321

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMRQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++    +L K
Sbjct  134  PKFHKRYILPFGEIKRGGNLAK  155



>ref|XP_009344687.1| PREDICTED: protein ABIL2-like [Pyrus x bretschneideri]
 ref|XP_009344688.1| PREDICTED: protein ABIL2-like [Pyrus x bretschneideri]
Length=327

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR+Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  22   EVSMHQSLL----FSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS +   
Sbjct  78   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQSSIIDT  137

Query  446  PKYLKHCINPGSDV  487
            PKY K  I P S+ 
Sbjct  138  PKYHKRYIFPVSET  151



>ref|NP_197819.2| ABL interactor-like protein 3 [Arabidopsis thaliana]
 sp|Q6NMC6.1|ABIL3_ARATH RecName: Full=Protein ABIL3; AltName: Full=Abl interactor-like 
protein 3; Short=AtABIL3 [Arabidopsis thaliana]
 gb|AAS49097.1| At5g24310 [Arabidopsis thaliana]
 gb|AAW49258.1| Abl interactor-like protein-3 [Arabidopsis thaliana]
 dbj|BAD95383.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF00710.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93285.1| ABL interactor-like protein 3 [Arabidopsis thaliana]
Length=321

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K    P  ++    +L K
Sbjct  134  PKFHKRYFLPSGEIKRGGNLAK  155



>gb|KHG10845.1| Protein ABIL2 [Gossypium arboreum]
Length=330

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 96/133 (72%), Gaps = 4/133 (3%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYFE++Y K+  KQ + DT+K Y  K
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFEMAYTKEMQKQIVEDTLKDYAIK  74

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQR R+CQ++++  G+ QQS V 
Sbjct  75   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQSLVL  134

Query  440  VLPKYLKHCINPG  478
              PK+ KH I PG
Sbjct  135  EAPKHHKHYIFPG  147



>ref|XP_007039080.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
 ref|XP_007039081.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY23581.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
 gb|EOY23582.1| ABL interactor-like protein 2 isoform 1 [Theobroma cacao]
Length=325

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 108/182 (59%), Gaps = 14/182 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLKNLR Q YSAAEYFE+SY  D+ K  +V+T+K Y  KA+
Sbjct  18   EVSMHQSLL----FADSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E   TELR SC+EQR R+CQE+ID  GI QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDLLDEKVDEVCGTELRVSCIEQRLRTCQEYIDHEGISQQSLVINT  133

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P         +GK+   +      Y G      +  HQL+    AT  +E 
Sbjct  134  PKYHKRYILP---------VGKTMHGANRTKSKYLGCSLDDEDDWHQLRNAVRAT-IRET  183

Query  626  PT  631
            PT
Sbjct  184  PT  185



>ref|XP_008376759.1| PREDICTED: protein ABIL2-like [Malus domestica]
Length=327

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR+Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  22   EVSMHQSLL----FSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS +   
Sbjct  78   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQSSIIDT  137

Query  446  PKYLKHCINPGSDV  487
            PKY K  I P S+ 
Sbjct  138  PKYHKRYIFPVSET  151



>ref|XP_009348526.1| PREDICTED: protein ABIL2-like isoform X1 [Pyrus x bretschneideri]
Length=327

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR+Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  22   EVSMHQSLL----FSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS +   
Sbjct  78   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQSSIIDT  137

Query  446  PKYLKHCINPGSDV  487
            PKY K  I P S+ 
Sbjct  138  PKYHKRYIFPVSET  151



>ref|XP_009348527.1| PREDICTED: protein ABIL2-like isoform X2 [Pyrus x bretschneideri]
Length=322

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR+Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  17   EVSMHQSLL----FSDSLKDLKNLRRQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  72

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS +   
Sbjct  73   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQSSIIDT  132

Query  446  PKYLKHCINPGSDV  487
            PKY K  I P S+ 
Sbjct  133  PKYHKRYIFPVSET  146



>ref|XP_010662869.1| PREDICTED: protein ABIL2 isoform X1 [Vitis vinifera]
Length=340

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 14/175 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  46   EVSMEQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVMETLKEYAIKAL  101

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR R+C E++D  G+ QQS V   
Sbjct  102  VNTVDHLGSVTYKVNDLLDEKVDEVSGTELRVSCIEQRLRTCHEYMDHEGVSQQSLVIDT  161

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLAT  610
            PKY K  I P   V    + G++  +       Y GR     +  HQ +    AT
Sbjct  162  PKYHKRYILP---VGETMNGGRTKSK-------YQGRSLDDEDDWHQFRNAVRAT  206



>gb|KJB17388.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
Length=283

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYF ++Y K+  KQ + DT+K Y  K
Sbjct  16   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFAMAYTKEMQKQIVEDTLKDYAIK  71

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQR R+CQ++++  G+ QQS V 
Sbjct  72   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQSLVL  131

Query  440  VLPKYLKHCINPG  478
              PK+ KH I PG
Sbjct  132  EAPKHHKHYIFPG  144



>ref|XP_010267571.1| PREDICTED: protein ABIL3-like [Nelumbo nucifera]
Length=309

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  21   ELSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TELR SC+EQR RSCQ++ D  G  QQS V + 
Sbjct  77   VNTVDHLGSVTYKVNGLLDEKVVEVSGTELRVSCIEQRLRSCQDYTDHQGRAQQSLVIMT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>dbj|BAB10397.1| unnamed protein product [Arabidopsis thaliana]
Length=333

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K    P  ++    +L K
Sbjct  134  PKFHKRYFLPSGEIKRGGNLAK  155



>ref|XP_006288227.1| hypothetical protein CARUB_v10001467mg [Capsella rubella]
 gb|EOA21125.1| hypothetical protein CARUB_v10001467mg [Capsella rubella]
Length=321

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EISMQQSML----FSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E +  ELR SC+EQR R CQE++D  G  QQS +   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDEVAGAELRVSCIEQRLRMCQEYMDHEGRSQQSLLIET  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++    +L K
Sbjct  134  PKFHKRYILPSGEIKRGGNLAK  155



>ref|XP_011024852.1| PREDICTED: protein ABIL2 [Populus euphratica]
Length=334

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  18   EVSMQQSLL----FSDSLKDLKNLRSQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R  C+EQR R+CQE+ID  GI QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVCCIEQRLRTCQEYIDHEGISQQSLVIDT  133

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  134  PKYHKRYILP  143



>ref|XP_002875960.1| hypothetical protein ARALYDRAFT_485287 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52219.1| hypothetical protein ARALYDRAFT_485287 [Arabidopsis lyrata subsp. 
lyrata]
Length=312

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +D L+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EVSMQQSML----FSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+D+KV E S TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSVTYKVNDFIDDKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  127

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++ T ++L K
Sbjct  128  PKFHKRYILPAGEIMTATNLEK  149



>ref|XP_006441130.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
 gb|ESR54370.1| hypothetical protein CICLE_v10021055mg [Citrus clementina]
Length=334

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  21   EVAMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDLLDEKVDEVSDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>ref|XP_008234720.1| PREDICTED: protein ABIL2 [Prunus mume]
 ref|XP_008234721.1| PREDICTED: protein ABIL2 [Prunus mume]
Length=326

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 107/175 (61%), Gaps = 13/175 (7%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ K  +V+T+K Y  KA+
Sbjct  21   EVSMHQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDFFDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGLSQQSSVIDT  136

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLAT  610
            PKY K  I P         +G++ R +      Y G +    ++ HQ +    AT
Sbjct  137  PKYHKRYILP---------VGETMRGANKTKSKYEGCNLDDEDEWHQFRNAVRAT  182



>gb|KJB17384.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
Length=185

 Score =   144 bits (363),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 5/134 (4%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELV-DTMKVYVS  256
            + E  M +SL       D+LKDLKNLR+Q YSAAEYF ++Y K+  KQ  V DT+K Y  
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFAMAYTKEMQKQIRVEDTLKDYAI  74

Query  257  KAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            KA++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQR R+CQ++++  G+ QQS V
Sbjct  75   KALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQRLRTCQDYVNLGGLSQQSLV  134

Query  437  TVLPKYLKHCINPG  478
               PK+ KH I PG
Sbjct  135  LEAPKHHKHYIFPG  148



>ref|XP_002264080.2| PREDICTED: protein ABIL2-like isoform X6 [Vitis vinifera]
Length=322

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  31   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  86

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  87   VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  146

Query  446  PKYLKHCINPGSDV  487
            PK+ K    PG + 
Sbjct  147  PKHHKRYTFPGGET  160



>gb|EYU25243.1| hypothetical protein MIMGU_mgv1a009919mg [Erythranthe guttata]
Length=327

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +DSL+DLKNLRKQ YSAAEYFE++Y  D+ K  +V+T+K Y  KA+
Sbjct  21   EVSMQQSML----FSDSLEDLKNLRKQLYSAAEYFEMTYINDDQKDIVVNTLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV + S TELR SC+EQR R+CQE+IDR G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDLLDEKVDQVSGTELRVSCIEQRLRTCQEYIDREGLSQQSLVINT  136

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  137  PNYHKRYILP  146



>gb|KJB19858.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
Length=266

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  12   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAVKAI  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV + S TEL+ SCVE++ R CQE+ID  GI QQS +   
Sbjct  68   VNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSLMINT  127

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  128  PMYHKRYILP  137



>ref|XP_006291525.1| hypothetical protein CARUB_v10017674mg [Capsella rubella]
 gb|EOA24423.1| hypothetical protein CARUB_v10017674mg [Capsella rubella]
Length=312

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +++      +D L+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EVSMQQTML----FSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSVTYKVNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  127

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++ T ++L K
Sbjct  128  PKFHKRYILPAGEIMTATNLEK  149



>ref|XP_010659665.1| PREDICTED: protein ABIL2-like isoform X7 [Vitis vinifera]
 ref|XP_010659668.1| PREDICTED: protein ABIL2-like isoform X7 [Vitis vinifera]
 ref|XP_010659674.1| PREDICTED: protein ABIL2-like isoform X7 [Vitis vinifera]
Length=314

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  20   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  75

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  76   VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  135

Query  446  PKYLKHCINPG  478
            PK+ K    PG
Sbjct  136  PKHHKRYTFPG  146



>ref|XP_010515274.1| PREDICTED: protein ABIL2-like [Camelina sativa]
Length=312

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 0/129 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D L+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K
Sbjct  21   FSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDYAVKALVNTVDHLGSVTYK  80

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            ++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   PK+ K  I P  +
Sbjct  81   VNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPKFHKRYILPAGE  140

Query  485  VDTVSDLGK  511
            + T ++L K
Sbjct  141  IMTATNLEK  149



>ref|XP_010426437.1| PREDICTED: protein ABIL2 [Camelina sativa]
Length=312

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 92/128 (72%), Gaps = 0/128 (0%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D L+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K+
Sbjct  22   SDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDYAVKALVNTVDHLGSVTYKV  81

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDV  487
            + F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   PK+ K  I P  ++
Sbjct  82   NDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPKFHKRYILPAGEI  141

Query  488  DTVSDLGK  511
             T ++L K
Sbjct  142  MTTTNLEK  149



>ref|XP_010659662.1| PREDICTED: protein ABIL2-like isoform X5 [Vitis vinifera]
Length=325

 Score =   147 bits (371),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  31   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  86

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  87   VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  146

Query  446  PKYLKHCINPG  478
            PK+ K    PG
Sbjct  147  PKHHKRYTFPG  157



>gb|KHG04210.1| Protein ABIL3 [Gossypium arboreum]
Length=185

 Score =   143 bits (361),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  43   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAVKAI  98

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV + S TEL+ SCVE++ R CQE+ID  GI QQS +   
Sbjct  99   VNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSLMINT  158

Query  446  PKYLK  460
            P Y K
Sbjct  159  PMYHK  163



>gb|KJB19853.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
 gb|KJB19854.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
 gb|KJB19855.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
 gb|KJB19856.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
 gb|KJB19857.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
Length=318

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  12   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAVKAI  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV + S TEL+ SCVE++ R CQE+ID  GI QQS +   
Sbjct  68   VNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSLMINT  127

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  128  PMYHKRYILP  137



>gb|KHG04211.1| Protein ABIL3 [Gossypium arboreum]
Length=235

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  34   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAVKAI  89

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV + S TEL+ SCVE++ R CQE+ID  GI QQS +   
Sbjct  90   VNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSLMINT  149

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  150  PMYHKRYILP  159



>ref|XP_010519446.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519447.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519448.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519449.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
 ref|XP_010519450.1| PREDICTED: protein ABIL2-like [Tarenaya hassleriana]
Length=321

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 94/142 (66%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNL+ Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA+
Sbjct  18   EVSMQQSLL----FSDSLKDLKNLKAQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K+  FLDEKV E S T LR SC+EQR R  QEF+D  G  QQS +   
Sbjct  74   VNTVDHLGSVTYKVSDFLDEKVDEVSGTALRVSCIEQRLRKSQEFMDHEGRSQQSLMINA  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++ T   L K
Sbjct  134  PKFHKRYILPAGEMVTGDSLSK  155



>ref|XP_010109248.1| hypothetical protein L484_011870 [Morus notabilis]
 gb|EXC21428.1| hypothetical protein L484_011870 [Morus notabilis]
Length=289

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSL+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  35   EVSMHQSLL----FSDSLQDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKAL  90

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K++  LDEKV E S TELR SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  91   VNTVDHLGSVSYKVNDILDEKVDEVSGTELRVSCIEQRLRTCQEYIDHEGLIQQSSVINT  150

Query  446  PKYLK  460
            PKY K
Sbjct  151  PKYHK  155



>gb|KHN23356.1| Protein ABIL2 [Glycine soja]
Length=329

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 86/119 (72%), Gaps = 0/119 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRAQLYSAAEYFELSYSNDDQKQVVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDV  487
              LDEKV E S  ELR SC+EQR ++C E++D  G  QQS V   PKY K  I PG+ V
Sbjct  92   DLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDHEGRTQQSLVISTPKYHKRYILPGNSV  150



>ref|XP_006404160.1| hypothetical protein EUTSA_v10010561mg [Eutrema salsugineum]
 gb|ESQ45613.1| hypothetical protein EUTSA_v10010561mg [Eutrema salsugineum]
Length=312

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 97/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +D LKDL+NLR Q YSAAEYFE+SY  D+ +Q +V+T+K Y  KA+
Sbjct  12   EVSMQQSML----FSDGLKDLRNLRTQLYSAAEYFELSYTTDDKRQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGSI  K++ F+DEKV   S TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSITYKVNDFIDEKVDVVSETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDT  127

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++ T ++L K
Sbjct  128  PKFHKRYILPAGEIMTATNLEK  149



>ref|XP_004146227.1| PREDICTED: protein ABIL2-like [Cucumis sativus]
Length=325

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +D LKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EISMKQSLI----FSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G  QQS V   
Sbjct  68   VNTVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINT  127

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  128  PKYHKRYILP  137



>ref|XP_004169136.1| PREDICTED: protein ABIL2-like [Cucumis sativus]
Length=325

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +D LKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EISMKQSLI----FSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G  QQS V   
Sbjct  68   VNTVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINT  127

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  128  PKYHKRYILP  137



>ref|XP_008466838.1| PREDICTED: protein ABIL2 [Cucumis melo]
 ref|XP_008466839.1| PREDICTED: protein ABIL2 [Cucumis melo]
Length=327

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +D LKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EISMKQSLI----FSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G  QQS V   
Sbjct  68   VNTVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINT  127

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  128  PKYHKRYILP  137



>ref|XP_010659659.1| PREDICTED: protein ABIL2-like isoform X4 [Vitis vinifera]
Length=369

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  86   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  141

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  142  VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  201

Query  446  PKYLKHCINPGSDVDTVS  499
            PK+ K    PG +    +
Sbjct  202  PKHHKRYTFPGGETTNTT  219



>emb|CBI34535.3| unnamed protein product [Vitis vinifera]
Length=349

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  20   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  75

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  76   VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  135

Query  446  PKYLKHCINPG  478
            PK+ K    PG
Sbjct  136  PKHHKRYTFPG  146



>ref|XP_010659647.1| PREDICTED: protein ABIL2-like isoform X2 [Vitis vinifera]
Length=377

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  86   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  141

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  142  VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  201

Query  446  PKYLKHCINPGSDVDTVS  499
            PK+ K    PG +    +
Sbjct  202  PKHHKRYTFPGGETTNTT  219



>ref|XP_009420773.1| PREDICTED: putative protein ABIL2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=350

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLK+LKNLR Q YSAAEYFE+SY  D+HKQ +V+T++ Y  KAV
Sbjct  23   ELSMDQSLL----FSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKAV  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K+   L+ KV E S  E R SC+EQR R+C+E +DR G+ QQS V   
Sbjct  79   VNTVDHLGSVSFKVTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIKA  138

Query  446  PKYLKHCINPG  478
            P+Y K  I PG
Sbjct  139  PRYHKRYIVPG  149



>emb|CDP12188.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = +2

Query  143  DLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLD  322
            DLKNLR Q YSAAEYFE SY K E+KQ +V+T+K Y SKA+I+TVDHLGS+A K+ +FLD
Sbjct  44   DLKNLRVQLYSAAEYFESSYEKHEYKQLVVETLKDYASKALISTVDHLGSVAYKVGSFLD  103

Query  323  EKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD--TV  496
            +KV E SAT L+FSC+EQR R+C+ + DRNG+ QQS V   P++ KH   PG+ V   T+
Sbjct  104  KKVNEMSATRLQFSCLEQRLRTCRGYTDRNGLLQQSLVIKTPRHYKHYTVPGNYVSLLTL  163

Query  497  SDLGKSNRR  523
            +D GK  R+
Sbjct  164  AD-GKFTRK  171



>ref|XP_010659654.1| PREDICTED: protein ABIL2-like isoform X3 [Vitis vinifera]
Length=372

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  86   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  141

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  142  VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  201

Query  446  PKYLKHCINPG  478
            PK+ K    PG
Sbjct  202  PKHHKRYTFPG  212



>gb|KDO43393.1| hypothetical protein CISIN_1g038307mg [Citrus sinensis]
Length=322

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  21   EVAMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E   TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDILDEKVDEVLDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>ref|XP_009150953.1| PREDICTED: protein ABIL3 isoform X2 [Brassica rapa]
 emb|CDX88092.1| BnaA06g26830D [Brassica napus]
Length=321

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D   Q +V+T+K Y  KA+
Sbjct  18   EISMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDGDTQSVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV + + TELR +C+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDQVTGTELRVACIEQRLRMCQEYMDHEGRSQQSLVINT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++    +L K
Sbjct  134  PKFHKRYILPSGEIKKGGNLAK  155



>gb|KJB37359.1| hypothetical protein B456_006G201700 [Gossypium raimondii]
Length=313

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 112/182 (62%), Gaps = 13/182 (7%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      ++SLK LKNLR Q YSAAEYFEVSY  D+ KQ +V+T+K Y  KA+
Sbjct  13   EVLMQQSLL----FSESLKGLKNLRTQLYSAAEYFEVSYTNDDQKQMVVETLKDYAIKAL  68

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDE + + S TELR SC+EQR ++C++ IDR G+ QQS V  +
Sbjct  69   VNTVDHLGSMTYKVNDLLDENLEQVSGTELRVSCIEQRLQTCRDLIDREGLSQQSLVINM  128

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +      +  +NR    +  +  G D+   +  HQL+ G +    +E 
Sbjct  129  PKYHKRYILPAGET-----INGANRTK--LKFVGCGLDD--EDDWHQLRNGTVRATIQET  179

Query  626  PT  631
            PT
Sbjct  180  PT  181



>ref|XP_010659643.1| PREDICTED: protein ABIL2-like isoform X1 [Vitis vinifera]
Length=380

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 96/131 (73%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLK+LRKQ YSAAEYFE  Y KD+ KQ +++T+K Y  KA+
Sbjct  86   EYSMQQSLL----FGDSLKDLKSLRKQLYSAAEYFEQCYHKDDQKQIVLETLKDYAIKAL  141

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++TFLD+K+GE   TEL+FSC+EQR R+C+EFI+R+G  QQS +   
Sbjct  142  VNTVDHLGSVTYKVNTFLDDKIGEVHGTELQFSCIEQRIRTCREFINRSGFCQQSLLMRT  201

Query  446  PKYLKHCINPG  478
            PK+ K    PG
Sbjct  202  PKHHKRYTFPG  212



>gb|KGN57659.1| hypothetical protein Csa_3G238740 [Cucumis sativus]
Length=377

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +D LKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  12   EISMKQSLI----FSDCLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G  QQS V   
Sbjct  68   VNTVDHLGSVTFKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGHSQQSLVINT  127

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  128  PKYHKRYILP  137



>gb|KJB19859.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
Length=340

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  34   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAVKAI  89

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV + S TEL+ SCVE++ R CQE+ID  GI QQS +   
Sbjct  90   VNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSLMINT  149

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  150  PMYHKRYILP  159



>ref|XP_006491995.1| PREDICTED: protein ABIL2-like isoform X1 [Citrus sinensis]
 ref|XP_006491996.1| PREDICTED: protein ABIL2-like isoform X2 [Citrus sinensis]
Length=334

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA+
Sbjct  21   EVAMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAVKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E   TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  77   VNTVDHLGSVTYKVNDILDEKVDEVLDTEHRVSCIEQRLRTCQEYIDHEGLSQQSLVINT  136

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  137  PKYHKRYILP  146



>ref|XP_002518857.1| Protein ABIL2, putative [Ricinus communis]
 gb|EEF43390.1| Protein ABIL2, putative [Ricinus communis]
Length=308

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLK+LRKQ YSAAEYFE SY K++ KQ +V+T+K Y  KA+INT+DHLGS+A K
Sbjct  32   FSDTLKDLKSLRKQLYSAAEYFEKSYSKEDQKQIVVETLKDYAVKALINTIDHLGSVAYK  91

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            ++   D K  E SA ELRFSC+EQR ++CQE+I+  G+ QQ  V   PKY K  I P  +
Sbjct  92   VNNLFDNKADEISALELRFSCLEQRRQTCQEYINHGGLSQQFLVVQTPKYHKRYIFPAEE  151

Query  485  -VDTVSDLGKSNRRS  526
             +DT S++   +RRS
Sbjct  152  TLDTKSNV---HRRS  163



>ref|XP_002299451.2| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
 ref|XP_006368791.1| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
 gb|EEE84256.2| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
 gb|ERP65360.1| hypothetical protein POPTR_0001s10950g [Populus trichocarpa]
Length=312

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 95/133 (71%), Gaps = 4/133 (3%)
 Frame = +2

Query  77   IKKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVS  256
            I +E  M +SL      +D+LKDLKNLRKQ YSAA+YFE++Y K++ KQ +V+ +K Y  
Sbjct  18   IHEELLMQQSLL----FSDALKDLKNLRKQLYSAADYFELAYNKEDQKQIVVENLKDYAI  73

Query  257  KAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            KA+INTVDHLGS+A K+D FLD+K+ E S  ELRFSC EQR  +CQ++I++ G+ QQS V
Sbjct  74   KALINTVDHLGSVAYKVDRFLDQKIDEVSGMELRFSCSEQRLEACQKYINQGGLSQQSLV  133

Query  437  TVLPKYLKHCINP  475
               P + K  I P
Sbjct  134  IKTPYHYKRYIFP  146



>emb|CDY05919.1| BnaC08g20960D [Brassica napus]
Length=315

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +D LKDL+NLR Q YSAAEYFE+SY  D+ +Q +V+T+K Y  KA+
Sbjct  12   EASMDQSML----FSDGLKDLRNLRTQLYSAAEYFELSYTTDDKRQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGSI  K++ F+DE+V E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSITYKVNDFIDERVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIET  127

Query  446  PKYLKHCINPGSDVDTVSDLGKSN  517
            PK+ K  I P  +    ++L K N
Sbjct  128  PKFHKRYILPAGETIKTTNLDKLN  151



>gb|KJB19852.1| hypothetical protein B456_003G121700 [Gossypium raimondii]
Length=399

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  93   EVSMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAVKAI  148

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ FLDEKV + S TEL+ SCVE++ R CQE+ID  GI QQS +   
Sbjct  149  VNTVDHLGSVTYKVNEFLDEKVDDVSGTELQVSCVEEKVRKCQEYIDLKGISQQSLMINT  208

Query  446  PKYLKHCINP  475
            P Y K  I P
Sbjct  209  PMYHKRYILP  218



>ref|XP_008381232.1| PREDICTED: protein ABIL2-like [Malus domestica]
 ref|XP_008381238.1| PREDICTED: protein ABIL2-like [Malus domestica]
Length=322

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSL+DLKNLR Q YSAAEYFE+SY  D+ K  +V+T+K Y  KA+
Sbjct  17   EVSMHQSLL----FSDSLRDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKDYAIKAL  72

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R SC+EQR R+CQE+ID  G+ QQS V   
Sbjct  73   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIRTCQEYIDHEGLSQQSSVIDT  132

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  133  PKYHKRYILP  142



>gb|KJB37361.1| hypothetical protein B456_006G201700 [Gossypium raimondii]
Length=189

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 92/133 (69%), Gaps = 4/133 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      ++SLK LKNLR Q YSAAEYFEVSY  D+ KQ +V+T+K Y  KA+
Sbjct  13   EVLMQQSLL----FSESLKGLKNLRTQLYSAAEYFEVSYTNDDQKQMVVETLKDYAIKAL  68

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDE + + S TELR SC+EQR ++C++ IDR G+ QQS V  +
Sbjct  69   VNTVDHLGSMTYKVNDLLDENLEQVSGTELRVSCIEQRLQTCRDLIDREGLSQQSLVINM  128

Query  446  PKYLKHCINPGSD  484
            PKY K  I P  +
Sbjct  129  PKYHKRYILPAGE  141



>ref|XP_010058324.1| PREDICTED: protein ABIL2-like, partial [Eucalyptus grandis]
Length=205

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +DSLKDLK+LRKQ YSAAEYFE+SY + +HK+ +V+T++ Y +KA INT DHLGS+  K+
Sbjct  8    SDSLKDLKDLRKQLYSAAEYFELSYNEQDHKEIVVNTLRDYATKAFINTADHLGSMTYKV  67

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG  478
            +  LD+K+GE SA ELRFSCV+QR R C+ F+D  G+ QQS     PK+    I PG
Sbjct  68   NCLLDDKIGEASAIELRFSCVQQRRRMCEMFVDHGGLSQQSLAIRTPKHHIRYILPG  124



>ref|XP_003523358.1| PREDICTED: protein ABIL2-like isoform X1 [Glycine max]
 ref|XP_006578895.1| PREDICTED: protein ABIL2-like isoform X2 [Glycine max]
Length=325

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRAQLYSAAEYFELSYSNDDQKQIVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E S  ELR SC+EQR ++C E++DR G  QQS V   PKY K  I P
Sbjct  92   DLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDREGRTQQSLVISTPKYHKRYILP  146



>ref|XP_009149749.1| PREDICTED: protein ABIL2 [Brassica rapa]
 ref|XP_009149750.1| PREDICTED: protein ABIL2 [Brassica rapa]
 emb|CDY08121.1| BnaA06g16050D [Brassica napus]
Length=317

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +S+      +D LKDL+NLR Q YSAAEYFE+SY  D+ +Q +V+T+K Y  KA+
Sbjct  12   EASMDQSML----FSDGLKDLRNLRTQLYSAAEYFELSYTTDDKRQIVVETLKDYAVKAL  67

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGSI  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V   
Sbjct  68   VNTVDHLGSITYKVNDFIDEKVDEVAETELRVSCIEQRLRMCQEYMDHEGRSQQSLVIET  127

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  +    ++L K
Sbjct  128  PKFHKRYILPAGETIKTTNLDK  149



>ref|XP_009420789.1| PREDICTED: putative protein ABIL2 isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   144 bits (364),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLK+LKNLR Q YSAAEYFE+SY  D+HKQ +V+T++ Y  KAV
Sbjct  23   ELSMDQSLL----FSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKAV  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K+   L+ KV E S  E R SC+EQR R+C+E +DR G+ QQS V   
Sbjct  79   VNTVDHLGSVSFKVTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIKA  138

Query  446  PKYLKHCINP  475
            P+Y K  I P
Sbjct  139  PRYHKRYIVP  148



>gb|KJB37360.1| hypothetical protein B456_006G201700 [Gossypium raimondii]
Length=270

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      ++SLK LKNLR Q YSAAEYFEVSY  D+ KQ +V+T+K Y  KA+
Sbjct  13   EVLMQQSLL----FSESLKGLKNLRTQLYSAAEYFEVSYTNDDQKQMVVETLKDYAIKAL  68

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDE + + S TELR SC+EQR ++C++ IDR G+ QQS V  +
Sbjct  69   VNTVDHLGSMTYKVNDLLDENLEQVSGTELRVSCIEQRLQTCRDLIDREGLSQQSLVINM  128

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +      +  +NR    +  +  G D+   +  HQL+    AT  +E 
Sbjct  129  PKYHKRYILPAGET-----INGANRTK--LKFVGCGLDD--EDDWHQLRNAVRAT-IQET  178

Query  626  PT  631
            PT
Sbjct  179  PT  180



>ref|XP_008783161.1| PREDICTED: probable protein ABIL3 [Phoenix dactylifera]
 ref|XP_008783162.1| PREDICTED: probable protein ABIL3 [Phoenix dactylifera]
 ref|XP_008783163.1| PREDICTED: probable protein ABIL3 [Phoenix dactylifera]
Length=324

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      + SLKDLKNLR Q YSAAEYFE+S   D+ K+  ++T+K Y  +A+
Sbjct  23   EISMKQSLL----FSHSLKDLKNLRSQLYSAAEYFELSCSHDDQKRTAMNTLKDYALEAL  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K++  L+EKVGE S TE R SC+EQR R+CQE+ID+ G  QQS V   
Sbjct  79   VNTVDHLGSVSYKVNDLLNEKVGEVSGTEFRVSCIEQRLRTCQEYIDQEGRSQQSLVIQA  138

Query  446  PKYLKHCINP  475
            PKY KH I P
Sbjct  139  PKYHKHYILP  148



>ref|XP_010671428.1| PREDICTED: protein ABIL3 [Beta vulgaris subsp. vulgaris]
Length=351

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 94/141 (67%), Gaps = 4/141 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL       DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  21   EMSMHQSLL----FADSLKDLKNLRTQLYSAAEYFELSYTNDDQKQFVIETLKDYAIKAL  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  L+EKV E S TE   SC+EQR R+CQE+I+R G+ QQS +   
Sbjct  77   VNTVDHLGSVTYKVNDLLEEKVEEVSETEFHVSCIEQRLRTCQEYIEREGMAQQSSIIDT  136

Query  446  PKYLKHCINPGSDVDTVSDLG  508
            PKY K  + P       S+L 
Sbjct  137  PKYHKRYVLPAGQTMNSSNLA  157



>ref|XP_009351988.1| PREDICTED: protein ABIL2-like [Pyrus x bretschneideri]
Length=322

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 90/130 (69%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D+ K  +V+T+K Y  KA+
Sbjct  17   EVSMHQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDDQKHIVVETLKDYAIKAL  72

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++   DEKV E S TE R SC+EQR ++CQE+ID  G+ QQS +   
Sbjct  73   VNTVDHLGSVTYKVNDLFDEKVDEVSGTEFRVSCIEQRIKTCQEYIDHEGLSQQSSIIDT  132

Query  446  PKYLKHCINP  475
            PKY K  I P
Sbjct  133  PKYHKRYILP  142



>ref|XP_009420781.1| PREDICTED: putative protein ABIL2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=349

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLK+LKNLR Q YSAAEYFE+SY  D+HKQ +V+T++ Y  KAV
Sbjct  23   ELSMDQSLL----FSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKAV  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K+   L+ KV E S  E R SC+EQR R+C+E +DR G+ QQS V   
Sbjct  79   VNTVDHLGSVSFKVTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIKA  138

Query  446  PKYLKHCINP  475
            P+Y K  I P
Sbjct  139  PRYHKRYIVP  148



>ref|XP_009420797.1| PREDICTED: putative protein ABIL2 isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   144 bits (362),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLK+LKNLR Q YSAAEYFE+SY  D+HKQ +V+T++ Y  KAV+NTVDHLGS++ K
Sbjct  7    FSDSLKELKNLRSQLYSAAEYFELSYATDDHKQFVVNTLREYAIKAVVNTVDHLGSVSFK  66

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            +   L+ KV E S  E R SC+EQR R+C+E +DR G+ QQS V   P+Y K  I P
Sbjct  67   VTGLLEAKVDEVSGAESRVSCIEQRIRACRELVDREGLSQQSLVIKAPRYHKRYIVP  123



>gb|KCW72460.1| hypothetical protein EUGRSUZ_E00910 [Eucalyptus grandis]
Length=263

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+L KQ YSAAEYFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLSKQLYSAAEYFELSYNGQDHKQIVVNTLRDYATKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K++  LD+K+GE SA ELRFSCV+QR R C+ F+D  G+ QQS     
Sbjct  78   INTVDHLGSMTYKVNCLLDDKIGEASAIELRFSCVQQRRRMCEMFMDHGGLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>emb|CDX80429.1| BnaC07g30150D [Brassica napus]
Length=325

 Score =   143 bits (361),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 4/142 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D     +V+T+K Y  KA+
Sbjct  18   EISMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDGDTHSVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV + + TELR +C+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDQVTGTELRVACIEQRLRMCQEYMDHEGRSQQSLVINT  133

Query  446  PKYLKHCINPGSDVDTVSDLGK  511
            PK+ K  I P  ++    +L K
Sbjct  134  PKFHKRYILPSGEIKKGGNLAK  155



>gb|KJB37358.1| hypothetical protein B456_006G201700 [Gossypium raimondii]
Length=312

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 112/182 (62%), Gaps = 14/182 (8%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      ++SLK LKNLR Q YSAAEYFEVSY  D+ KQ +V+T+K Y  KA+
Sbjct  13   EVLMQQSLL----FSESLKGLKNLRTQLYSAAEYFEVSYTNDDQKQMVVETLKDYAIKAL  68

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDE + + S TELR SC+EQR ++C++ IDR G+ QQS V  +
Sbjct  69   VNTVDHLGSMTYKVNDLLDENLEQVSGTELRVSCIEQRLQTCRDLIDREGLSQQSLVINM  128

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEH  625
            PKY K  I P  +      +  +NR    +  +  G D+   +  HQL+    AT  +E 
Sbjct  129  PKYHKRYILPAGET-----INGANRTK--LKFVGCGLDD--EDDWHQLRNAVRAT-IQET  178

Query  626  PT  631
            PT
Sbjct  179  PT  180



>gb|EYU45257.1| hypothetical protein MIMGU_mgv1a012015mg [Erythranthe guttata]
Length=264

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 90/119 (76%), Gaps = 1/119 (1%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
              DSLKDLKNLR+Q YSAAEYFE SY KD+H+Q ++++ K YV+KA+++TVDHLGS+A K
Sbjct  32   FADSLKDLKNLREQLYSAAEYFESSYEKDDHQQFVIESSKDYVAKALVSTVDHLGSVADK  91

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            L+ F+DEK  EFS T +RFSC+EQR  + + FID  G+ Q+S +   PK+ K  I PG+
Sbjct  92   LNKFVDEKANEFSTTNIRFSCIEQRLNTFRGFIDLRGVSQKSLIEA-PKHYKQYIIPGT  149



>gb|KEH35459.1| ABIL1-like protein [Medicago truncatula]
Length=247

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEKV E S  ELR SC+EQR RS Q F D  G  QQS V   PKY K  I P  +  
Sbjct  92   DLLDEKVVEVSGAELRVSCIEQRMRSYQGFADHGGRSQQSLVISTPKYHKRYILPVGETM  151

Query  491  TVSDLGKS  514
              ++L KS
Sbjct  152  VGANLTKS  159



>gb|KCW72483.1| hypothetical protein EUGRSUZ_E00938 [Eucalyptus grandis]
Length=221

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+L KQ YSAA+YFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLSKQLYSAAQYFELSYNVQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K+++ LD+K+GE SA ELRFSCV+QR R C+ F+D  G+ QQS     
Sbjct  78   INTVDHLGSMTYKVNSLLDDKIGEASAIELRFSCVQQRQRMCELFMDHGGLSQQSLAIRT  137

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  138  PKHHMRYILPVS  149



>ref|XP_003526721.1| PREDICTED: protein ABIL2-like isoform X1 [Glycine max]
 ref|XP_006581654.1| PREDICTED: protein ABIL2-like isoform X2 [Glycine max]
 ref|XP_006581655.1| PREDICTED: protein ABIL2-like isoform X3 [Glycine max]
Length=326

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRAQLYSAAEYFELSYSNDDQKQVVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E S  ELR SC+EQR ++C E++D  G  QQS V   PKY K  I P
Sbjct  92   DLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDHEGRTQQSLVISTPKYHKRYILP  146



>ref|XP_009150952.1| PREDICTED: protein ABIL3 isoform X1 [Brassica rapa]
Length=322

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLKNLR Q YSAAEYFE+SY  D   Q +V+T+K Y  KA+
Sbjct  18   EISMQQSLL----FSDSLKDLKNLRTQLYSAAEYFELSYTNDGDTQSVVETLKDYAIKAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++ F+DEKV + + TELR +C+EQR R CQE++D  G  QQS V   
Sbjct  74   VNTVDHLGSVTYKVNDFVDEKVDQVTGTELRVACIEQRLRMCQEYMDHEGRSQQSLVINT  133

Query  446  PKYLKHCINPGS  481
            PK+ K  I P +
Sbjct  134  PKFHKRYILPSA  145



>ref|XP_010107272.1| hypothetical protein L484_007833 [Morus notabilis]
 gb|EXC14466.1| hypothetical protein L484_007833 [Morus notabilis]
Length=263

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 0/121 (0%)
 Frame = +2

Query  116  RTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSI  295
            R   ++SL +LKNLRKQ YSAAEYFE+SY KD+ KQ +V+T+K Y  KA INTVDHLGS+
Sbjct  26   RMVFSESLNELKNLRKQLYSAAEYFELSYSKDDQKQIVVETLKDYTIKAFINTVDHLGSM  85

Query  296  AAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            A K++ F+DEK  + S  +L+FSC+EQR R+ Q+ IDR+G+ QQS     P++ K  I P
Sbjct  86   ADKVNNFVDEKTVDVSEADLKFSCIEQRQRTSQDLIDRSGLFQQSLAFSFPRHHKRYIIP  145

Query  476  G  478
            G
Sbjct  146  G  146



>ref|XP_007136512.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
 ref|XP_007136513.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
 gb|ESW08506.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
 gb|ESW08507.1| hypothetical protein PHAVU_009G051500g [Phaseolus vulgaris]
Length=327

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 84/115 (73%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRAQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E S  +LR SC+EQR ++CQE++D  G  QQS V   PKY K  I P
Sbjct  92   DLLDEKVVEVSVADLRVSCIEQRIKTCQEYMDHEGRTQQSLVISTPKYHKRYILP  146



>gb|KHN19504.1| Protein ABIL2 [Glycine soja]
Length=325

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRAQLYSAAEYFELSYSNDDQKQIVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E S  ELR SC+EQR ++C E++D  G  QQS V   PKY K  I P
Sbjct  92   DLLDEKVVEVSVAELRVSCIEQRIKTCHEYMDHEGRTQQSLVISTPKYHKRYILP  146



>gb|KCW72452.1| hypothetical protein EUGRSUZ_E00897 [Eucalyptus grandis]
Length=253

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE+SY + +HK+ +V+T++ Y +KA 
Sbjct  55   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFELSYNEQDHKEIVVNTLRDYATKAF  110

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INT DHLGS+  K++  LD+K+GE SA ELRFSCV+QR R C+ F+D  G+ QQS     
Sbjct  111  INTADHLGSMTYKVNCLLDDKIGEASAIELRFSCVQQRRRMCEMFVDHGGLSQQSLAIRT  170

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  171  PKHHIRYILPVS  182



>ref|XP_010055757.1| PREDICTED: protein ABIL3-like isoform X4 [Eucalyptus grandis]
Length=263

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>ref|XP_010055758.1| PREDICTED: protein ABIL3-like isoform X5 [Eucalyptus grandis]
Length=263

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>ref|XP_010058329.1| PREDICTED: protein ABIL2-like [Eucalyptus grandis]
Length=367

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+L KQ YSAAEYFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  71   ELSMKESLI----FSDSLKDLKDLSKQLYSAAEYFELSYNGQDHKQIVVNTLRDYATKAF  126

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K++  LD+K+GE SA ELRFSCV+QR R C+ F+D  G+ QQS     
Sbjct  127  INTVDHLGSMTYKVNCLLDDKIGEASAIELRFSCVQQRRRMCEMFMDHGGLSQQSLAIRT  186

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  187  PKHHMRYILPG  197



>ref|XP_010055759.1| PREDICTED: protein ABIL3-like isoform X6 [Eucalyptus grandis]
Length=260

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>ref|XP_006476345.1| PREDICTED: protein ABIL2-like [Citrus sinensis]
Length=310

 Score =   141 bits (355),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLKNLRKQ  SAA++FEVSY +   KQ +V+T+K Y  KA+INTVDHLGS+A K
Sbjct  27   FSDTLKDLKNLRKQLCSAADFFEVSYMQQNQKQIVVETLKDYAIKALINTVDHLGSVAFK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            ++  LDEK+GE S TEL+F+C+EQR +S Q+FI++ G+ QQS + + PK+ K  I P  D
Sbjct  87   VNNLLDEKIGEVSETELQFTCLEQRVKSYQDFINQAGLCQQSSIILTPKHHKRYIFP--D  144

Query  485  VDTVSDLGKSNRR  523
             +T  D G+   R
Sbjct  145  EETTDDFGQPTSR  157



>ref|XP_003602276.1| Protein ABIL2 [Medicago truncatula]
 gb|AES72527.1| ABIL1-like protein [Medicago truncatula]
Length=326

 Score =   141 bits (356),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRTQLYSAAEYFELSYTNDDQKQIVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEKV E S  ELR SC+EQR RS Q F D  G  QQS V   PKY K  I P  +  
Sbjct  92   DLLDEKVVEVSGAELRVSCIEQRMRSYQGFADHGGRSQQSLVISTPKYHKRYILPVGETM  151

Query  491  TVSDLGKS  514
              ++L KS
Sbjct  152  VGANLTKS  159



>gb|KCW72286.1| hypothetical protein EUGRSUZ_E00746 [Eucalyptus grandis]
Length=291

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>ref|XP_011026838.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011026839.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011026840.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011026842.1| PREDICTED: protein ABIL2-like [Populus euphratica]
Length=312

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 94/133 (71%), Gaps = 4/133 (3%)
 Frame = +2

Query  77   IKKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVS  256
            I +E  M +SL      +D+LKDLKNLRKQ YSAA+YFE++Y K++ KQ +V+ +K Y  
Sbjct  18   IHEELLMQQSLL----FSDTLKDLKNLRKQLYSAADYFELAYNKEDQKQIVVENLKGYAI  73

Query  257  KAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            KA+INTVDHLGS+A K+D FLD+K+ E S   LRFSC +QR  +CQ++I++ G+ QQS V
Sbjct  74   KALINTVDHLGSVAYKVDKFLDQKIDEVSGMGLRFSCSKQRLEACQKYINQGGLSQQSLV  133

Query  437  TVLPKYLKHCINP  475
               P + K  I P
Sbjct  134  IKTPYHYKRYIFP  146



>ref|XP_010055755.1| PREDICTED: uncharacterized protein LOC104443902 isoform X2 [Eucalyptus 
grandis]
Length=305

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>gb|KHG02930.1| Protein ABIL2 -like protein [Gossypium arboreum]
Length=324

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 100/165 (61%), Gaps = 10/165 (6%)
 Frame = +2

Query  137  LKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTF  316
             +DLKNLR Q Y+AAEYFE+SY  D+ KQ +V+T+K Y  KA++NT+DHLGS+  K++  
Sbjct  35   FQDLKNLRSQLYTAAEYFELSYTNDDQKQIVVETLKDYTIKALVNTIDHLGSVTYKVNDL  94

Query  317  LDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVDTV  496
            LDEKV E S TELR SC+EQR R+C E+ID  GI QQS V   PKY K  I P  +    
Sbjct  95   LDEKVEEVSGTELRVSCIEQRLRTCHEYIDHEGISQQSSVINTPKYNKRYILPVGETMHG  154

Query  497  SDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEHPT  631
            ++L KS          Y G      +  HQ +    AT  +E PT
Sbjct  155  ANLTKSK---------YVGCSLDDEDDWHQFKNAVRAT-IRETPT  189



>ref|XP_010055753.1| PREDICTED: protein ABIL2-like isoform X1 [Eucalyptus grandis]
Length=332

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 91/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPG  478
            PK+    I PG
Sbjct  138  PKHHMRYILPG  148



>ref|XP_004300497.1| PREDICTED: protein ABIL2-like [Fragaria vesca subsp. vesca]
Length=295

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = +2

Query  116  RTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSI  295
            R   +++L +L NLRKQ YSAAEYFE+SY K++ KQ +V+T+K YV KAVINTVDHLGS+
Sbjct  28   RVLFSENLNELTNLRKQLYSAAEYFEISYSKEDQKQLVVETLKDYVIKAVINTVDHLGSV  87

Query  296  AAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            A K++ FLD+KV E S TELR S  EQR R+C++F ++ G+ Q SF    PK+ K  I P
Sbjct  88   AYKVNGFLDDKVSEVSETELRLSSFEQRLRTCRDFSNQGGLFQHSFAINFPKHHKRYILP  147

Query  476  GSDVDTVSDLGKS  514
            G    T   +G+S
Sbjct  148  GG--ATTQTVGQS  158



>ref|XP_010035277.1| PREDICTED: protein ABIL2 [Eucalyptus grandis]
 ref|XP_010035278.1| PREDICTED: protein ABIL2 [Eucalyptus grandis]
 ref|XP_010035279.1| PREDICTED: protein ABIL2 [Eucalyptus grandis]
 gb|KCW46570.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
 gb|KCW46571.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
 gb|KCW46572.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
Length=325

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      ++SLKDL++LR Q YSAAEYFE+SY  D+ KQ +V+T++ Y  KA+
Sbjct  20   EVSMQQSLL----FSNSLKDLRSLRTQLYSAAEYFEMSYTNDDQKQIVVETLRDYAIKAL  75

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G  +QS V   
Sbjct  76   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGRSEQSLVIDT  135

Query  446  PKYLKHCINP  475
            PK+ K  I P
Sbjct  136  PKFHKRYILP  145



>gb|AAZ74718.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74720.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74721.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74722.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74723.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74724.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74725.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74726.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74727.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74728.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74729.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74730.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74731.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74732.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74733.1| At5g24310, partial [Arabidopsis thaliana]
 gb|AAZ74734.1| At5g24310, partial [Arabidopsis thaliana]
Length=111

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  143  DLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLD  322
            DLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA++NTVDHLGS+  K++ F+D
Sbjct  1    DLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKALVNTVDHLGSVTYKVNDFVD  60

Query  323  EKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            EKV E + TELR SC+EQR R CQE++D  G  QQS V   PK+ K    P
Sbjct  61   EKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPKFHKRYFLP  111



>ref|XP_010915983.1| PREDICTED: probable protein ABIL3 [Elaeis guineensis]
Length=326

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E ++ +SL      + SL+DLKN+R Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+
Sbjct  22   EISIQQSLL----FSHSLRDLKNMRSQLYSAAEYFELSYSNDDQKQMVMNTLKDYALKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ K++  L++KVGE S TE R SC+EQ  R+CQE++D+ G  QQS  +  
Sbjct  78   VNTVDHLGSVSYKVNNLLNKKVGEVSGTEFRVSCLEQILRTCQEYMDQEGRFQQSLASPA  137

Query  446  PKYLKHCINP  475
            PKY KH I P
Sbjct  138  PKYHKHYILP  147



>gb|KCW46573.1| hypothetical protein EUGRSUZ_K00391 [Eucalyptus grandis]
Length=285

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 91/130 (70%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      ++SLKDL++LR Q YSAAEYFE+SY  D+ KQ +V+T++ Y  KA+
Sbjct  20   EVSMQQSLL----FSNSLKDLRSLRTQLYSAAEYFEMSYTNDDQKQIVVETLRDYAIKAL  75

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+  K++  LDEKV E S TE R SC+EQR R+CQE+ID  G  +QS V   
Sbjct  76   VNTVDHLGSVTYKVNDLLDEKVDEVSGTEFRVSCIEQRLRTCQEYIDHEGRSEQSLVIDT  135

Query  446  PKYLKHCINP  475
            PK+ K  I P
Sbjct  136  PKFHKRYILP  145



>ref|XP_004502669.1| PREDICTED: protein ABIL2-like [Cicer arietinum]
Length=326

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 88/129 (68%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+HKQ +V+T+K Y  KA++NTVDHLGS+  K++
Sbjct  32   DSLKDLKNLRTQLYSAAEYFELSYTNDDHKQIVVETLKDYAIKALVNTVDHLGSVTYKVN  91

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEKV E S  ELR SC+EQR R+ Q  +D  G  QQS V   PKY K  I P  +  
Sbjct  92   DLLDEKVVEVSGAELRVSCIEQRMRTYQGHMDHKGRTQQSLVISTPKYHKRYILPVGETM  151

Query  491  TVSDLGKSN  517
              ++  KSN
Sbjct  152  IGANHTKSN  160



>gb|KCW72494.1| hypothetical protein EUGRSUZ_E00955 [Eucalyptus grandis]
Length=220

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFELSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K+++ LD+K+GE SA +L+FSCV+QR R C+  +D   + QQS     
Sbjct  78   INTVDHLGSMTYKVNSLLDDKIGEASAIDLKFSCVQQRRRMCEMSVDHGSLSQQSLALRT  137

Query  446  PKYLKHCINPGS  481
            PK+    I+P S
Sbjct  138  PKHHMRYISPVS  149



>gb|KCW72447.1| hypothetical protein EUGRSUZ_E00893 [Eucalyptus grandis]
 gb|KCW72448.1| hypothetical protein EUGRSUZ_E00893 [Eucalyptus grandis]
Length=220

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +D+LKDLK+LRKQ YSAAEYFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDNLKDLKDLRKQLYSAAEYFELSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K+++ LD+K+GE SA +L+FSCV+QR R C+  +D  G+ QQS     
Sbjct  78   INTVDHLGSMTYKVNSLLDDKIGEASAIDLKFSCVQQRRRMCEMSVDHGGLSQQSLAIRT  137

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  138  PKHHMRYILPVS  149



>ref|XP_010058335.1| PREDICTED: protein ABIL2-like [Eucalyptus grandis]
Length=323

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+L KQ YSAA+YFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  71   ELSMKESLI----FSDSLKDLKDLSKQLYSAAQYFELSYNVQDHKQIVVNTLRDYTTKAF  126

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K+++ LD+K+GE SA ELRFSCV+QR R C+ F+D  G+ QQS     
Sbjct  127  INTVDHLGSMTYKVNSLLDDKIGEASAIELRFSCVQQRQRMCELFMDHGGLSQQSLAIRT  186

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  187  PKHHMRYILPVS  198



>gb|KCW72551.1| hypothetical protein EUGRSUZ_E01020 [Eucalyptus grandis]
Length=304

 Score =   139 bits (349),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL    N +DSLKDLK+LRKQ YSAAEYFE+SY K + KQ +V+T++ Y +KA 
Sbjct  21   ELSMKESL----NFSDSLKDLKDLRKQLYSAAEYFELSYNKQDQKQIVVNTLRDYATKAF  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            I+TVDHLGS+  K++  LD+K+ E SA ELRFSC++QR R C  FID  G+ QQS     
Sbjct  77   ISTVDHLGSMTYKVNCLLDDKIEEASAIELRFSCLQQRLRMCDVFIDHGGLSQQSLAIRT  136

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  137  PKHHMRYILPVS  148



>ref|XP_010055756.1| PREDICTED: protein ABIL3-like isoform X3 [Eucalyptus grandis]
Length=304

 Score =   139 bits (349),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE SY   +HKQ +V+T++ Y +KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFESSYNGQDHKQIVVNTLRDYTTKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  +++  LD+K+GE SA ELRFSCV+QR R C+ FID   + QQS     
Sbjct  78   INTVDHLGSMTYEVNCLLDDKIGEASAIELRFSCVQQRQRMCEMFIDHGDLSQQSLAIRT  137

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  138  PKHHMRYILPVS  149



>ref|XP_010055979.1| PREDICTED: protein ABIL3-like isoform X3 [Eucalyptus grandis]
 ref|XP_010055980.1| PREDICTED: protein ABIL3-like isoform X3 [Eucalyptus grandis]
 ref|XP_010055981.1| PREDICTED: protein ABIL3-like isoform X3 [Eucalyptus grandis]
Length=307

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL    N +DSLKDLK+LRKQ YSAAEYFE+SY K + KQ +V+T++ Y +KA 
Sbjct  21   ELSMKESL----NFSDSLKDLKDLRKQLYSAAEYFELSYNKQDQKQIVVNTLRDYATKAF  76

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            I+TVDHLGS+  K++  LD+K+ E SA ELRFSC++QR R C  FID  G+ QQS     
Sbjct  77   ISTVDHLGSMTYKVNCLLDDKIEEASAIELRFSCLQQRLRMCDVFIDHGGLSQQSLAIRT  136

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  137  PKHHMRYILPVS  148



>gb|AFK46504.1| unknown [Medicago truncatula]
Length=168

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSL DLKNLR Q YSAAEYFE+SY  D+ KQ LV+T+K Y  KA+INTVDHLGS+A K+ 
Sbjct  18   DSLTDLKNLRIQLYSAAEYFELSYTNDDQKQILVETLKDYAVKALINTVDHLGSVAYKVG  77

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E    +LR SC+EQR ++CQ F+D  G  QQS V   PK+ K  I P
Sbjct  78   DLLDEKVTEVFGEDLRLSCIEQRIKTCQGFMDHEGHTQQSLVISTPKHHKRYILP  132



>ref|XP_006595602.1| PREDICTED: uncharacterized protein LOC100808485 isoform X1 [Glycine 
max]
 gb|KHN03203.1| Protein ABIL2 [Glycine soja]
Length=324

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 87/128 (68%), Gaps = 0/128 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA+IN+VDHLGS+  K++
Sbjct  29   DSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAIKALINSVDHLGSVTYKVN  88

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEK+ E S T+LR SC++QR  +C  F+D  G  QQS V   PKY K  I P  +  
Sbjct  89   DLLDEKIVEVSETQLRLSCIQQRISTCHAFMDHEGRTQQSLVIDAPKYHKRYILPAGETL  148

Query  491  TVSDLGKS  514
              + L KS
Sbjct  149  RGAKLTKS  156



>ref|XP_004498510.1| PREDICTED: protein ABIL2-like isoform X3 [Cicer arietinum]
Length=311

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ LV+T+K Y  KA+INTVDHLGS+A K+ 
Sbjct  18   DSLKDLKNLRTQLYSAAEYFELSYTNDDQKQVLVETLKDYAIKALINTVDHLGSVAYKVS  77

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEKV      ELR SC+EQR ++CQ F+D  G  QQ+ V   PK+ K  I P  +  
Sbjct  78   DLLDEKVTNVLGEELRLSCIEQRIKTCQGFMDHEGHTQQALVISTPKHHKRYILPVGETL  137

Query  491  TVSDLGKSN  517
              +   KSN
Sbjct  138  HGTKFTKSN  146



>ref|XP_004498509.1| PREDICTED: protein ABIL2-like isoform X2 [Cicer arietinum]
Length=322

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ LV+T+K Y  KA+INTVDHLGS+A K+ 
Sbjct  29   DSLKDLKNLRTQLYSAAEYFELSYTNDDQKQVLVETLKDYAIKALINTVDHLGSVAYKVS  88

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEKV      ELR SC+EQR ++CQ F+D  G  QQ+ V   PK+ K  I P  +  
Sbjct  89   DLLDEKVTNVLGEELRLSCIEQRIKTCQGFMDHEGHTQQALVISTPKHHKRYILPVGETL  148

Query  491  TVSDLGKSN  517
              +   KSN
Sbjct  149  HGTKFTKSN  157



>gb|AAZ74719.1| At5g24310, partial [Arabidopsis thaliana]
Length=111

 Score =   132 bits (333),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  143  DLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLD  322
            DLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  KA++NTVDHLGS+  K++ F+D
Sbjct  1    DLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKALVNTVDHLGSVTYKVNDFVD  60

Query  323  EKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            EKV E + TELR SC+EQR R CQE++D  G  QQS V   P + K    P
Sbjct  61   EKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLVIDTPNFHKRYFLP  111



>ref|XP_002303669.1| hypothetical protein POPTR_0003s14280g [Populus trichocarpa]
 gb|EEE78648.1| hypothetical protein POPTR_0003s14280g [Populus trichocarpa]
Length=262

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLKNLRKQ YSAA+YFE++Y K++ KQ +V+T+K Y  KA+++TVDHLGS+A K
Sbjct  31   FSDTLKDLKNLRKQLYSAADYFELAYYKEDQKQIVVETLKDYAIKALVSTVDHLGSVAYK  90

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKH  463
            ++ FLD+++GE S  ELRF C EQR  +CQE+I++ G+ QQS     PK+ K 
Sbjct  91   VNKFLDQEIGEVSEMELRFFCTEQRLEACQEYINQGGLSQQSLAIKTPKHQKR  143



>ref|XP_006852591.1| hypothetical protein AMTR_s00021p00216340 [Amborella trichopoda]
 gb|ERN14058.1| hypothetical protein AMTR_s00021p00216340 [Amborella trichopoda]
Length=296

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 90/131 (69%), Gaps = 4/131 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSL+DLKNLR Q YSAAE+FE+SY  D HKQ +VDT+K +  +A+
Sbjct  18   EISMQQSLI----FSDSLQDLKNLRAQLYSAAEHFELSYTNDNHKQTVVDTLKDFAVRAL  73

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS++ +++  L+EKV E S TE R  C+EQR R CQE++D  G+ +QS     
Sbjct  74   VNTVDHLGSVSYRVNGLLNEKVEEVSETEFRIGCMEQRVRMCQEYMDHEGLGEQSITITA  133

Query  446  PKYLKHCINPG  478
            PKY K  +  G
Sbjct  134  PKYHKRYMLKG  144



>ref|XP_011022465.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022466.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022467.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022468.1| PREDICTED: protein ABIL2-like [Populus euphratica]
 ref|XP_011022469.1| PREDICTED: protein ABIL2-like [Populus euphratica]
Length=312

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      +D+LKDLKNLRKQ YSAA+YFE++Y K++ KQ +V+T+K Y  KA+
Sbjct  22   ELFMQQSLL----FSDTLKDLKNLRKQLYSAADYFELAYYKEDQKQIVVETLKDYAIKAL  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            ++TVDHLGS+A K++ FLD+++GE S  ELRF C EQR  +CQE+I++ G+ QQS     
Sbjct  78   VSTVDHLGSVAYKVNKFLDQEIGEVSEMELRFFCTEQRLEACQEYINQGGLSQQSLAIKT  137

Query  446  PKYLKHCINP  475
            P + K  I P
Sbjct  138  PTHHKRYIFP  147



>ref|XP_008392261.1| PREDICTED: protein ABIL2-like isoform X2 [Malus domestica]
Length=302

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  116  RTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSI  295
            R   +++L +LKNLRKQ YSAAEYFE+SY K++ +Q +V+T+K YV KAVINTVDHLGS+
Sbjct  30   RVLFSENLNELKNLRKQLYSAAEYFEISYRKEDQQQLVVETLKDYVMKAVINTVDHLGSM  89

Query  296  AAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            A K++ FLD+KV E S TELR SC++QR R+C++FI + G+ + S     P + +    P
Sbjct  90   AYKVNVFLDDKVDEVSETELRMSCIQQRLRTCEDFIGQGGVSKHSLAISFPMHHRRYTLP  149

Query  476  -GSDVDTV  496
             G+ +D V
Sbjct  150  VGAAMDAV  157



>ref|XP_010055978.1| PREDICTED: protein ABIL2-like isoform X2 [Eucalyptus grandis]
Length=342

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL    N +DSLKDLK+LRKQ YSAAEYFE+SY K + KQ +V+T++ Y +KA 
Sbjct  59   ELSMKESL----NFSDSLKDLKDLRKQLYSAAEYFELSYNKQDQKQIVVNTLRDYATKAF  114

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            I+TVDHLGS+  K++  LD+K+ E SA ELRFSC++QR R C  FID  G+ QQS     
Sbjct  115  ISTVDHLGSMTYKVNCLLDDKIEEASAIELRFSCLQQRLRMCDVFIDHGGLSQQSLAIRT  174

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  175  PKHHMRYILPVS  186



>ref|XP_010055977.1| PREDICTED: protein ABIL2-like isoform X1 [Eucalyptus grandis]
Length=345

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL    N +DSLKDLK+LRKQ YSAAEYFE+SY K + KQ +V+T++ Y +KA 
Sbjct  59   ELSMKESL----NFSDSLKDLKDLRKQLYSAAEYFELSYNKQDQKQIVVNTLRDYATKAF  114

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            I+TVDHLGS+  K++  LD+K+ E SA ELRFSC++QR R C  FID  G+ QQS     
Sbjct  115  ISTVDHLGSMTYKVNCLLDDKIEEASAIELRFSCLQQRLRMCDVFIDHGGLSQQSLAIRT  174

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  175  PKHHMRYILPVS  186



>gb|KDP25264.1| hypothetical protein JCGZ_20420 [Jatropha curcas]
Length=308

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 103/147 (70%), Gaps = 6/147 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL      +++L+DLKNLRKQ YSAAEYFE +Y K++ KQ +V+T+K Y  KA+
Sbjct  23   ELFMQQSLL----FSETLQDLKNLRKQLYSAAEYFETTYRKEDQKQIVVETLKDYTIKAL  78

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INT+DHLGS+A K+++F DEK+   SA +LRF+C+EQ+ R+C+E+I+ +G+ QQ  +   
Sbjct  79   INTIDHLGSVAYKVNSFSDEKLRGVSALDLRFTCLEQKLRTCEEYINHSGLSQQFLMVET  138

Query  446  PKYLKHCINPGSDVDTVSDLGKSNRRS  526
            PKY K  I P    +T+    KS+ RS
Sbjct  139  PKYHKRYIFPAE--ETLDTESKSHTRS  163



>ref|NP_001242020.1| uncharacterized protein LOC100808485 [Glycine max]
 gb|ACU19668.1| unknown [Glycine max]
Length=324

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ +++T+K Y  KA IN+VDHLGS+  K++
Sbjct  29   DSLKDLKNLRTQLYSAAEYFELSYANDDQKQIVIETLKDYAIKAPINSVDHLGSVTYKVN  88

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEK+ E S T+LR SC++QR  +C  F+D  G  QQS V   PKY K  I P  +  
Sbjct  89   DLLDEKIVEVSETQLRLSCIQQRISTCHAFMDHEGRTQQSLVIDAPKYHKRYILPAGETL  148

Query  491  TVSDLGKS  514
              + L KS
Sbjct  149  RGAKLTKS  156



>ref|XP_004498508.1| PREDICTED: protein ABIL2-like isoform X1 [Cicer arietinum]
Length=359

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 86/129 (67%), Gaps = 0/129 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSLKDLKNLR Q YSAAEYFE+SY  D+ KQ LV+T+K Y  KA+INTVDHLGS+A K+ 
Sbjct  66   DSLKDLKNLRTQLYSAAEYFELSYTNDDQKQVLVETLKDYAIKALINTVDHLGSVAYKVS  125

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVD  490
              LDEKV      ELR SC+EQR ++CQ F+D  G  QQ+ V   PK+ K  I P  +  
Sbjct  126  DLLDEKVTNVLGEELRLSCIEQRIKTCQGFMDHEGHTQQALVISTPKHHKRYILPVGETL  185

Query  491  TVSDLGKSN  517
              +   KSN
Sbjct  186  HGTKFTKSN  194



>gb|KCW72295.1| hypothetical protein EUGRSUZ_E00761 [Eucalyptus grandis]
Length=220

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 91/132 (69%), Gaps = 4/132 (3%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE+SY   +HKQ +V+T++ Y++KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFELSYNGQDHKQIVVNTLRDYITKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            INTVDHLGS+  K+++ LD+K+GE SA +LRFSC   R R C+  +D  G+ QQS     
Sbjct  78   INTVDHLGSMTYKVNSLLDDKIGEASAIDLRFSCSTGRQRMCEMSVDHGGLSQQSLAIRT  137

Query  446  PKYLKHCINPGS  481
            PK+    I P S
Sbjct  138  PKHHMRYILPVS  149



>ref|XP_003588502.1| Protein ABIL3 [Medicago truncatula]
 gb|AES58753.1| ABIL1-like protein [Medicago truncatula]
Length=323

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSL DLKNLR Q YSAAEYFE+SY  D+ KQ LV+T+K Y  KA+INTVDHLGS+A K+ 
Sbjct  29   DSLTDLKNLRTQLYSAAEYFELSYTNDDQKQILVETLKDYAVKALINTVDHLGSVAYKVS  88

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E    +LR SC+EQR ++CQ F+D  G  QQS V   PK+ K  I P
Sbjct  89   DLLDEKVTEVFGEDLRLSCIEQRIKTCQGFMDHEGHTQQSLVISTPKHHKRYILP  143



>gb|KEH39727.1| ABIL1-like protein [Medicago truncatula]
Length=342

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  131  DSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLD  310
            DSL DLKNLR Q YSAAEYFE+SY  D+ KQ LV+T+K Y  KA+INTVDHLGS+A K+ 
Sbjct  48   DSLTDLKNLRTQLYSAAEYFELSYTNDDQKQILVETLKDYAVKALINTVDHLGSVAYKVS  107

Query  311  TFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
              LDEKV E    +LR SC+EQR ++CQ F+D  G  QQS V   PK+ K  I P
Sbjct  108  DLLDEKVTEVFGEDLRLSCIEQRIKTCQGFMDHEGHTQQSLVISTPKHHKRYILP  162



>ref|XP_010055742.1| PREDICTED: protein ABIL3-like isoform X3 [Eucalyptus grandis]
Length=308

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YSAA+YFE+SY + + KQ +V+T+K YV++A INTVDHLG +  
Sbjct  64   NFSDSLKDLKHLRKQLYSAADYFELSYNRHDRKQIVVNTLKDYVTRAFINTVDHLGFMTY  123

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            K++  LD+K+ E SA ELRFSCV QR R C+ FID  G+ QQS     PK+    I P S
Sbjct  124  KVNCLLDDKIEEASAIELRFSCVRQRLRMCEMFIDHGGLSQQSLAIRTPKHHIQYILPVS  183



>ref|XP_010055743.1| PREDICTED: protein ABIL2-like isoform X4 [Eucalyptus grandis]
Length=304

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YSAA+YFE+SY + + KQ +V+T+K YV++A INTVDHLG +  
Sbjct  29   NFSDSLKDLKHLRKQLYSAADYFELSYNRHDRKQIVVNTLKDYVTRAFINTVDHLGFMTY  88

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            K++  LD+K+ E SA ELRFSCV QR R C+ FID  G+ QQS     PK+    I P S
Sbjct  89   KVNCLLDDKIEEASAIELRFSCVRQRLRMCEMFIDHGGLSQQSLAIRTPKHHIQYILPVS  148



>ref|XP_008239164.1| PREDICTED: protein ABIL2-like [Prunus mume]
Length=320

 Score =   137 bits (344),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = +2

Query  116  RTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSI  295
            R   +++L +LKN+RKQ YSAAEYFE+SY K++ KQ +++ +K YV K V+N VDHLGS+
Sbjct  43   RVLFSENLNELKNMRKQLYSAAEYFEMSYRKEDQKQLVMEALKDYVLKTVVNAVDHLGSM  102

Query  296  AAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            A K++ FLDE V + S T LR SCVEQR R+CQ+F+ + G+ Q S  T  PK+ +  I P
Sbjct  103  AYKVNGFLDENVNQVSETGLRLSCVEQRLRTCQDFVTQGGVFQNSLATKFPKHHRRYILP  162

Query  476  GSDVDTVSDLGKSNRRSPMMTILY  547
               V  +  +G+S  R      LY
Sbjct  163  DKYVPIMDTVGQSALRQSAEEDLY  186



>ref|XP_006645995.1| PREDICTED: putative protein ABIL2-like [Oryza brachyantha]
Length=191

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 97/149 (65%), Gaps = 6/149 (4%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D++KDLK L+ Q YSAAEYFE++Y ++E KQE++  +K Y  KA++NTVDHLGSI+ K+
Sbjct  35   SDTIKDLKMLKSQLYSAAEYFELAYTQEEDKQEVMSNLKEYSVKALVNTVDHLGSISFKV  94

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD-  484
             T LD++  E   T LR SC++QR+++ Q  +D+ G+ QQS V   PKY K  I P  D 
Sbjct  95   STLLDQRFDEVEDTNLRASCIQQRAQASQACMDKEGLSQQSLVITAPKYHKRYILPAGDG  154

Query  485  -----VDTVSDLGKSNRRSPMMTILYPGR  556
                 V   S++ K+  R+  M  ++ G+
Sbjct  155  SMPHAVPNFSEMRKAKSRAAQMQQVFSGK  183



>ref|XP_007040588.1| ABL interactor-like protein 2, putative [Theobroma cacao]
 gb|EOY25089.1| ABL interactor-like protein 2, putative [Theobroma cacao]
Length=365

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 101/149 (68%), Gaps = 6/149 (4%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL      +D+LKDLK+LRKQ YSAAE+FE++Y K+E KQ + +T+K Y  K
Sbjct  73   RDELLMQQSLL----FSDTLKDLKSLRKQLYSAAEHFELAYSKEEQKQIVEETLKDYAIK  128

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGS+A K++ F DEK+G     +LR SC+EQR R+CQEF+   GI QQS V 
Sbjct  129  ALVNTVDHLGSVAYKVNNFWDEKMGGICGMQLRLSCLEQRLRTCQEFVSLGGISQQSLVL  188

Query  440  VLPKYLKHCINPGSDVDTVSDLGKSNRRS  526
               ++ K  I P    DT++D  +++ +S
Sbjct  189  EASEHHKRYIFPVE--DTLNDFAQTSLKS  215



>ref|XP_010055741.1| PREDICTED: protein ABIL2-like isoform X2 [Eucalyptus grandis]
Length=320

 Score =   136 bits (342),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YSAA+YFE+SY + + KQ +V+T+K YV++A INTVDHLG +  
Sbjct  64   NFSDSLKDLKHLRKQLYSAADYFELSYNRHDRKQIVVNTLKDYVTRAFINTVDHLGFMTY  123

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            K++  LD+K+ E SA ELRFSCV QR R C+ FID  G+ QQS     PK+    I P S
Sbjct  124  KVNCLLDDKIEEASAIELRFSCVRQRLRMCEMFIDHGGLSQQSLAIRTPKHHIQYILPVS  183



>ref|XP_010055740.1| PREDICTED: protein ABIL2-like isoform X1 [Eucalyptus grandis]
Length=339

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YSAA+YFE+SY + + KQ +V+T+K YV++A INTVDHLG +  
Sbjct  64   NFSDSLKDLKHLRKQLYSAADYFELSYNRHDRKQIVVNTLKDYVTRAFINTVDHLGFMTY  123

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            K++  LD+K+ E SA ELRFSCV QR R C+ FID  G+ QQS     PK+    I P S
Sbjct  124  KVNCLLDDKIEEASAIELRFSCVRQRLRMCEMFIDHGGLSQQSLAIRTPKHHIQYILPVS  183



>gb|KCW72267.1| hypothetical protein EUGRSUZ_E00723 [Eucalyptus grandis]
Length=333

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YSAA+YFE+SY + + KQ +V+T+K YV++A INTVDHLG +  
Sbjct  58   NFSDSLKDLKHLRKQLYSAADYFELSYNRHDRKQIVVNTLKDYVTRAFINTVDHLGFMTY  117

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            K++  LD+K+ E SA ELRFSCV QR R C+ FID  G+ QQS     PK+    I P S
Sbjct  118  KVNCLLDDKIEEASAIELRFSCVRQRLRMCEMFIDHGGLSQQSLAIRTPKHHIQYILPVS  177



>ref|XP_008392259.1| PREDICTED: protein ABIL2-like isoform X1 [Malus domestica]
 ref|XP_008392260.1| PREDICTED: protein ABIL2-like isoform X1 [Malus domestica]
Length=303

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +2

Query  140  KDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFL  319
            ++LKNLRKQ YSAAEYFE+SY K++ +Q +V+T+K YV KAVINTVDHLGS+A K++ FL
Sbjct  39   QELKNLRKQLYSAAEYFEISYRKEDQQQLVVETLKDYVMKAVINTVDHLGSMAYKVNVFL  98

Query  320  DEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP-GSDVDTV  496
            D+KV E S TELR SC++QR R+C++FI + G+ + S     P + +    P G+ +D V
Sbjct  99   DDKVDEVSETELRMSCIQQRLRTCEDFIGQGGVSKHSLAISFPMHHRRYTLPVGAAMDAV  158



>ref|XP_010447029.1| PREDICTED: protein ABIL4 [Camelina sativa]
Length=277

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR R C+E++ ++G  Q   +   P++ K    P
Sbjct  88   FNSFLSDNSTHFSTTHLRLSSLEQRMRLCREYMGKSGTHQHLLLFQYPRHHKRYFFP  144



>ref|XP_006405281.1| hypothetical protein EUTSA_v10027878mg [Eutrema salsugineum]
 gb|ESQ46734.1| hypothetical protein EUTSA_v10027878mg [Eutrema salsugineum]
Length=282

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F+   P + K    P
Sbjct  88   FNSFLSDNSTHFSITHLRLSSLEQRMKLCREYMGKSGTYQHCFLIQTPHHHKRYFFP  144



>ref|XP_010230669.1| PREDICTED: probable protein ABIL3 [Brachypodium distachyon]
Length=320

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 6/166 (4%)
 Frame = +2

Query  41   ETTPTSWGLN*LIKKETTM-MKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEH  217
            E +P+S   + L    T+  M SL      +DSLKDL+NLR Q YSAAEYFEV Y  + H
Sbjct  5    EMSPSSASSHHLDAASTSEDMPSLQEGLLFSDSLKDLRNLRSQLYSAAEYFEVFYRNNSH  64

Query  218  KQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQE  397
            +  +V ++K Y  +A+++TVDHLG ++ K+D  + EK  E + TELR S VEQR R CQ+
Sbjct  65   RSTVVTSLKDYTVEALVSTVDHLGFVSYKVDNLVSEKADEVNETELRVSSVEQRVRICQQ  124

Query  398  FIDRNGIEQQSFVTVLPKYLKHCINPGSD-----VDTVSDLGKSNR  520
             ID+ G  QQS +   PKY +  I PG D     +  VS+  + NR
Sbjct  125  MIDQEGRSQQSLLIRTPKYHRRYILPGPDLVESAIHPVSEPPRYNR  170



>gb|AAM67279.1| unknown [Arabidopsis thaliana]
Length=279

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR R C++++ ++G  Q   +   P++ K    P
Sbjct  88   FNSFLSDNSTHFSTTHLRLSSLEQRMRLCRDYMGKSGTHQHLLLFQYPRHHKRYFFP  144



>ref|XP_006285711.1| hypothetical protein CARUB_v10007182mg [Capsella rubella]
 gb|EOA18609.1| hypothetical protein CARUB_v10007182mg [Capsella rubella]
Length=332

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  82   FSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  141

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR R C+E++ ++G  Q   +   P++ K    P
Sbjct  142  FNSFLSDNSTHFSTTHLRLSSLEQRMRLCREYMGKSGTHQHLLLFQYPRHHKRYFFP  198



>ref|XP_009140142.1| PREDICTED: protein ABIL4-like isoform X4 [Brassica rapa]
Length=269

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSQTLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY  454
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F    P +
Sbjct  88   FNSFLSDNSAHFSTTRLRLSSLEQRMKLCREYMGKSGSSQHRFQVQSPHH  137



>ref|XP_009140141.1| PREDICTED: protein ABIL4-like isoform X3 [Brassica rapa]
Length=270

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSQTLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY  454
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F    P +
Sbjct  88   FNSFLSDNSAHFSTTRLRLSSLEQRMKLCREYMGKSGSSQHRFQVQSPHH  137



>ref|XP_009140139.1| PREDICTED: protein ABIL4-like isoform X1 [Brassica rapa]
Length=277

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSQTLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY  454
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F    P +
Sbjct  88   FNSFLSDNSAHFSTTRLRLSSLEQRMKLCREYMGKSGSSQHRFQVQSPHH  137



>ref|XP_009140140.1| PREDICTED: protein ABIL4-like isoform X2 [Brassica rapa]
 emb|CDY27664.1| BnaUnng00140D [Brassica napus]
Length=276

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSQTLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY  454
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F    P +
Sbjct  88   FNSFLSDNSAHFSTTRLRLSSLEQRMKLCREYMGKSGSSQHRFQVQSPHH  137



>gb|KCW72548.1| hypothetical protein EUGRSUZ_E01014 [Eucalyptus grandis]
Length=253

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N  DSLKDLK+LRKQ YSAA+YFE+SY + +HKQ +V+T+K YV++A IN VDHLG +  
Sbjct  53   NFLDSLKDLKHLRKQLYSAADYFELSYNRHDHKQIVVNTLKDYVTRAFINIVDHLGFMTY  112

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPK  451
            K++  LD+K+ E SA ELRFSC   R R C+ FID  G+ QQS     PK
Sbjct  113  KVNCLLDDKIEEASAIELRFSCSTCRLRMCEMFIDHGGLSQQSLAIRTPK  162



>ref|XP_002868565.1| hypothetical protein ARALYDRAFT_493780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44824.1| hypothetical protein ARALYDRAFT_493780 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR R C++++ ++G  Q   +   P++ K    P
Sbjct  88   FNSFLSDNSTHFSTTHLRVSSLEQRMRLCRDYMGKSGTHQHLLLFQYPRHHKRYFFP  144



>emb|CDX67526.1| BnaA07g15660D [Brassica napus]
Length=287

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDL+NLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSQTLKDLRNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY  454
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F+   P +
Sbjct  88   FNSFLSDDSAHFSTTHLRLSSLEQRMKLCREYMGKSGTSQHCFLIQSPPH  137



>gb|KJB52329.1| hypothetical protein B456_008G256500 [Gossypium raimondii]
 gb|KJB52330.1| hypothetical protein B456_008G256500 [Gossypium raimondii]
Length=232

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLK+LRKQ YSAA+YFE +Y ++E K+ + DT+K Y  KA+INTVDHLGS+A K
Sbjct  24   FSDTLKDLKSLRKQLYSAADYFERTYNEEEQKELVEDTLKDYAIKALINTVDHLGSVAYK  83

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            ++ FLD+K+ E S  +LR SC+EQR R+C+EF+   G+ QQS V
Sbjct  84   VNNFLDDKMVEISGMDLRLSCLEQRLRTCREFVSLGGLSQQSLV  127



>ref|NP_199018.1| ABL interactor-like protein 4 [Arabidopsis thaliana]
 sp|Q9FHY1.1|ABIL4_ARATH RecName: Full=Protein ABIL4; AltName: Full=Abl interactor-like 
protein 4; Short=AtABIL4 [Arabidopsis thaliana]
 dbj|BAB08436.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAD43291.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43326.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44462.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44675.1| unknown protein [Arabidopsis thaliana]
 gb|AAW49259.1| Abl interactor-like protein-4 [Arabidopsis thaliana]
 gb|ABD19684.1| At5g42030 [Arabidopsis thaliana]
 gb|AED94757.1| ABL interactor-like protein 4 [Arabidopsis thaliana]
Length=279

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 83/117 (71%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAAEYFETSYGKAEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR R C++++ ++G  Q   +   P++ K    P
Sbjct  88   FNSFLSDNSTHFSTTHLRLSSLEQRMRLCRDYMGKSGTHQHLLLFQYPRHHKRYFFP  144



>ref|XP_010545092.1| PREDICTED: protein ABIL4 isoform X5 [Tarenaya hassleriana]
Length=292

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++L+DLKN+RKQ YSAA+YFE SY K++HK+ +++T+K Y  KA++NTVDHLGS++ K
Sbjct  27   FSETLRDLKNMRKQLYSAADYFETSYDKEDHKEVVIETLKDYAVKALVNTVDHLGSVSDK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
             + FL +   +FS T+LR  C+EQR +SC+E+ D++G  QQ  V   P+Y K    P  D
Sbjct  87   FNGFLSDNTDQFSTTDLRLRCLEQRMKSCREYSDQSGAYQQLRVIESPQYHKRYFFPDED  146

Query  485  VD  490
            ++
Sbjct  147  ME  148



>gb|KJB52328.1| hypothetical protein B456_008G256500 [Gossypium raimondii]
 gb|KJB52331.1| hypothetical protein B456_008G256500 [Gossypium raimondii]
Length=307

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLK+LRKQ YSAA+YFE +Y ++E K+ + DT+K Y  KA+INTVDHLGS+A K
Sbjct  24   FSDTLKDLKSLRKQLYSAADYFERTYNEEEQKELVEDTLKDYAIKALINTVDHLGSVAYK  83

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            ++ FLD+K+ E S  +LR SC+EQR R+C+EF+   G+ QQS V
Sbjct  84   VNNFLDDKMVEISGMDLRLSCLEQRLRTCREFVSLGGLSQQSLV  127



>ref|XP_010545054.1| PREDICTED: protein ABIL4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010545063.1| PREDICTED: protein ABIL4 isoform X1 [Tarenaya hassleriana]
Length=298

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++L+DLKN+RKQ YSAA+YFE SY K++HK+ +++T+K Y  KA++NTVDHLGS++ K
Sbjct  27   FSETLRDLKNMRKQLYSAADYFETSYDKEDHKEVVIETLKDYAVKALVNTVDHLGSVSDK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
             + FL +   +FS T+LR  C+EQR +SC+E+ D++G  QQ  V   P+Y K    P  D
Sbjct  87   FNGFLSDNTDQFSTTDLRLRCLEQRMKSCREYSDQSGAYQQLRVIESPQYHKRYFFPDED  146

Query  485  VD  490
            ++
Sbjct  147  ME  148



>ref|XP_010545086.1| PREDICTED: protein ABIL4 isoform X4 [Tarenaya hassleriana]
Length=295

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++L+DLKN+RKQ YSAA+YFE SY K++HK+ +++T+K Y  KA++NTVDHLGS++ K
Sbjct  27   FSETLRDLKNMRKQLYSAADYFETSYDKEDHKEVVIETLKDYAVKALVNTVDHLGSVSDK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
             + FL +   +FS T+LR  C+EQR +SC+E+ D++G  QQ  V   P+Y K    P  D
Sbjct  87   FNGFLSDNTDQFSTTDLRLRCLEQRMKSCREYSDQSGAYQQLRVIESPQYHKRYFFPDED  146

Query  485  VD  490
            ++
Sbjct  147  ME  148



>ref|XP_010545079.1| PREDICTED: protein ABIL4 isoform X3 [Tarenaya hassleriana]
Length=296

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++L+DLKN+RKQ YSAA+YFE SY K++HK+ +++T+K Y  KA++NTVDHLGS++ K
Sbjct  27   FSETLRDLKNMRKQLYSAADYFETSYDKEDHKEVVIETLKDYAVKALVNTVDHLGSVSDK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
             + FL +   +FS T+LR  C+EQR +SC+E+ D++G  QQ  V   P+Y K    P  D
Sbjct  87   FNGFLSDNTDQFSTTDLRLRCLEQRMKSCREYSDQSGAYQQLRVIESPQYHKRYFFPDED  146

Query  485  VD  490
            ++
Sbjct  147  ME  148



>ref|XP_010545073.1| PREDICTED: protein ABIL4 isoform X2 [Tarenaya hassleriana]
Length=297

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++L+DLKN+RKQ YSAA+YFE SY K++HK+ +++T+K Y  KA++NTVDHLGS++ K
Sbjct  27   FSETLRDLKNMRKQLYSAADYFETSYDKEDHKEVVIETLKDYAVKALVNTVDHLGSVSDK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
             + FL +   +FS T+LR  C+EQR +SC+E+ D++G  QQ  V   P+Y K    P  D
Sbjct  87   FNGFLSDNTDQFSTTDLRLRCLEQRMKSCREYSDQSGAYQQLRVIESPQYHKRYFFPDED  146

Query  485  VD  490
            ++
Sbjct  147  ME  148



>ref|XP_009125215.1| PREDICTED: protein ABIL4-like [Brassica rapa]
Length=319

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDL+NLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  60   FSQTLKDLRNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  119

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY  454
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F+   P +
Sbjct  120  FNSFLSDDSAHFSTTHLRLSSLEQRMKLCREYMGKSGTSQHCFLIQSPPH  169



>ref|XP_010436162.1| PREDICTED: protein ABIL4-like [Camelina sativa]
 ref|XP_010436164.1| PREDICTED: protein ABIL4-like [Camelina sativa]
Length=314

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 84/117 (72%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAA+YFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  65   FSETLKDLKNLRKQLYSAADYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  124

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR R C+E++ ++G  Q   +   P++ K    P
Sbjct  125  FNSFLSDNSTHFSTTHLRLSSLEQRMRLCREYMGKSGSHQHLLLFQYPRHHKRYFFP  181



>gb|KJB52333.1| hypothetical protein B456_008G256500 [Gossypium raimondii]
Length=336

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLK+LRKQ YSAA+YFE +Y ++E K+ + DT+K Y  KA+INTVDHLGS+A K
Sbjct  24   FSDTLKDLKSLRKQLYSAADYFERTYNEEEQKELVEDTLKDYAIKALINTVDHLGSVAYK  83

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV  436
            ++ FLD+K+ E S  +LR SC+EQR R+C+EF+   G+ QQS V
Sbjct  84   VNNFLDDKMVEISGMDLRLSCLEQRLRTCREFVSLGGLSQQSLV  127



>ref|XP_004968938.1| PREDICTED: putative protein ABIL2-like isoform X1 [Setaria italica]
Length=322

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%), Gaps = 16/166 (10%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D++KDLK LR Q YSAAEYFE++Y ++E KQ +++ +K Y  KA++NTVDHLGSI+ K+
Sbjct  34   SDTIKDLKTLRSQLYSAAEYFELAYMREEGKQAVMNNLKEYAVKALVNTVDHLGSISFKV  93

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDV  487
             + +D++  E +   LR SC++QR++  Q  +DR G+ QQS V   PKY K  I P  D 
Sbjct  94   SSLIDQRFDEVADANLRVSCIQQRTQDGQACMDREGLSQQSLVITAPKYHKRYILPAGDK  153

Query  488  DTVSDLGKSNRRSPMMTILYPGRDEMH--XNQHHQLQQGFLATKTK  619
                           M    P   EM+   N+  Q+ Q F A + K
Sbjct  154  S--------------MPSAVPNFREMNKVTNRTAQMHQVFSAAQPK  185



>gb|EAZ12300.1| hypothetical protein OsJ_02192 [Oryza sativa Japonica Group]
Length=307

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 99/162 (61%), Gaps = 9/162 (6%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D++KDLK L+ Q YSAAEYFE++Y +++ KQE+++ +K Y  KA++NTVDHLGSI+ K
Sbjct  34   FSDTIKDLKMLKSQLYSAAEYFELAYTQEDDKQEVMNNLKEYSVKALVNTVDHLGSISFK  93

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            + + +D++  E   T LR SC+ QR++  Q  +D+ G+ QQS V   PKY K  I P  D
Sbjct  94   VSSLIDQRFDEVDDTNLRVSCIHQRAQVSQACMDKEGLSQQSLVITAPKYHKRYILPAGD  153

Query  485  ------VDTVSDLGKSNRRSPMMTILYP---GRDEMHXNQHH  583
                  V   S++ K+  R+  M  ++    GR  +H    H
Sbjct  154  GSMPNAVPNFSEMRKAKNRAAQMQQVFSASFGRSPVHLRNVH  195



>gb|EMT19497.1| hypothetical protein F775_01027 [Aegilops tauschii]
Length=335

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 96/149 (64%), Gaps = 5/149 (3%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            + ++KDLK LR Q YSAAEYFE++Y ++  KQ ++  +K Y  KA+INTVDHLGSI+ K+
Sbjct  13   SQTIKDLKALRPQLYSAAEYFELAYTQEGGKQAVMSNLKEYAVKALINTVDHLGSISFKV  72

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG---  478
             + +D+K+ E +   LR SC++QR+++ Q  ++R G+ QQS V   PKY K  I PG   
Sbjct  73   SSLVDQKLDEVAEANLRASCIQQRAQTIQACVNREGLTQQSLVITAPKYHKRYILPGDGS  132

Query  479  --SDVDTVSDLGKSNRRSPMMTILYPGRD  559
              + V   S++ K+  R+  M   + G+D
Sbjct  133  VPNAVPNFSEMNKAKSRTTQMHQAFRGKD  161



>emb|CDY69736.1| BnaCnng65090D [Brassica napus]
Length=276

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             + +LKDLKNL KQ YSAAEYFE SYGK+EHK+ +++T+K Y +KA++NTVDHLGS++ K
Sbjct  28   FSQTLKDLKNLGKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKALVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS T LR S +EQR + C+E++ ++G  Q  F    P + K    P
Sbjct  88   FNSFLSDNSAHFSTTRLRLSSLEQRMKLCREYMGKSGSSQHRFQVQSPHHHKRYFFP  144



>ref|XP_004968939.1| PREDICTED: putative protein ABIL2-like isoform X2 [Setaria italica]
Length=321

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D++KDLK LR Q YSAAEYFE++Y ++E KQ +++ +K Y  KA++NTVDHLGSI+ K+
Sbjct  34   SDTIKDLKTLRSQLYSAAEYFELAYMREEGKQAVMNNLKEYAVKALVNTVDHLGSISFKV  93

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
             + +D++  E +   LR SC++QR++  Q  +DR G+ QQS V   PKY K  I P  D
Sbjct  94   SSLIDQRFDEVADANLRVSCIQQRTQDGQACMDREGLSQQSLVITAPKYHKRYILPAGD  152



>emb|CDY13370.1| BnaC06g13870D [Brassica napus]
Length=263

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = +2

Query  143  DLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLD  322
            DLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K ++FL 
Sbjct  10   DLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDKFNSFLS  69

Query  323  EKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLP  448
            +    FS T LR S +EQR + C+E++ ++G  Q  F+   P
Sbjct  70   DDSAHFSTTHLRLSSLEQRMKLCREYMGKSGTSQHFFLIQSP  111



>gb|EAY74497.1| hypothetical protein OsI_02389 [Oryza sativa Indica Group]
Length=324

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 95/146 (65%), Gaps = 6/146 (4%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D++KDLK L+ Q YSAAEYFE++Y +++ KQE+++++K Y  KA++NTVDHLGSI+ K+
Sbjct  35   SDTIKDLKMLKSQLYSAAEYFELAYTQEDDKQEVMNSLKEYSVKALVNTVDHLGSISFKV  94

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD-  484
             + +D++  E   T LR SC+ QR++  Q  +D+ G+ QQS V   PKY K  I P  D 
Sbjct  95   SSLIDQRFDEVDDTNLRMSCIHQRAQVSQACMDKEGLSQQSLVITAPKYHKRYILPAGDG  154

Query  485  -----VDTVSDLGKSNRRSPMMTILY  547
                 V   S++ K+  R+  M  ++
Sbjct  155  SMPNAVPNFSEMRKAKNRAAQMQQVF  180



>ref|XP_010231913.1| PREDICTED: putative protein ABIL2 isoform X2 [Brachypodium distachyon]
Length=329

 Score =   126 bits (316),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 94/148 (64%), Gaps = 5/148 (3%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             ++++KDLK LR Q YSAAEYFE++Y +++ KQ ++  +K Y  KA++NTVDHLGSI+ K
Sbjct  35   FSETIKDLKTLRSQLYSAAEYFELAYTQEDGKQAVMSNIKEYAVKALVNTVDHLGSISFK  94

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            + + +D+++ E +   LR SC++QR++  Q  ++R G+ QQS V   PKY K  I PG D
Sbjct  95   VSSLVDQRLDEVAEANLRVSCIQQRTQMSQACMNREGLSQQSLVITAPKYHKRYILPGDD  154

Query  485  -----VDTVSDLGKSNRRSPMMTILYPG  553
                 V   S++ K   R+  M   + G
Sbjct  155  SIPNAVPNFSEMNKVKNRAAQMHQAFGG  182



>ref|XP_010058344.1| PREDICTED: protein ABIL2-like [Eucalyptus grandis]
Length=158

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YS+ +YFE+SY + + KQ +V+T+K Y +KA I TVDHLG++  
Sbjct  29   NFSDSLKDLKDLRKQLYSSTDYFELSYIRHDQKQIVVNTLKDYATKAFIKTVDHLGTMTY  88

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKH  463
            K++  LDEK+ E  A ELRFSCV +R R C+  ID  G+ QQS   V  + LKH
Sbjct  89   KVNCLLDEKIEEAFAIELRFSCVRERLRMCEMVIDHGGLSQQS---VAIRTLKH  139



>dbj|BAJ91626.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDL+NLR Q YSAAEYFEV Y  + H+  +V ++K Y  +A+++TVDHLG ++ K
Sbjct  106  FSDSLKDLRNLRSQLYSAAEYFEVFYTNNSHRSTVVTSLKDYAVEALVSTVDHLGFVSYK  165

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            +D  ++EK  E + TE R S VEQR + CQ+ ID+ G  QQS +   P+Y +  I PG+D
Sbjct  166  VDNLVNEKADEVNETEFRVSSVEQRVKICQQAIDQEGRSQQSLLIRAPQYHRRYILPGAD  225

Query  485  V  487
            +
Sbjct  226  I  226



>dbj|BAJ99926.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +DSLKDL+NLR Q YSAAEYFEV Y  + H+  +V ++K Y  +A+++TVDHLG ++ K
Sbjct  107  FSDSLKDLRNLRSQLYSAAEYFEVFYTNNSHRSTVVTSLKDYAVEALVSTVDHLGFVSYK  166

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            +D  ++EK  E + TE R S VEQR + CQ+ ID+ G  QQS +   P+Y +  I PG+D
Sbjct  167  VDNLVNEKADEVNETEFRVSSVEQRVKICQQAIDQEGRSQQSLLIRAPQYHRRYILPGAD  226

Query  485  V  487
            +
Sbjct  227  I  227



>sp|Q5JKN2.1|ABIL2_ORYSJ RecName: Full=Putative protein ABIL2; AltName: Full=Abl interactor-like 
protein 2 [Oryza sativa Japonica Group]
 dbj|BAD87975.1| Abl tyrosine kinase-interacting-like protein [Oryza sativa Japonica 
Group]
 gb|EAY74495.1| hypothetical protein OsI_02387 [Oryza sativa Indica Group]
 dbj|BAH01508.1| unnamed protein product [Oryza sativa Japonica Group]
Length=323

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D++KDLK L+ Q YSAAEYFE++Y +++ KQE+++ +K Y  KA++NTVDHLGSI+ K+
Sbjct  35   SDTIKDLKMLKSQLYSAAEYFELAYTQEDDKQEVMNNLKEYSVKALVNTVDHLGSISFKV  94

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD-  484
             + +D++  E   T LR SC+ QR++  Q  +D+ G+ QQS V   PKY K  I P  D 
Sbjct  95   SSLIDQRFDEVDDTNLRVSCIHQRAQVSQACMDKEGLSQQSLVITAPKYHKRYILPAGDG  154

Query  485  -----VDTVSDLGKSNRRSPMMTILY  547
                 V   S++ K+  R+  M  ++
Sbjct  155  SMPNAVPNFSEMRKAKNRAAQMQQVF  180



>gb|KCW72490.1| hypothetical protein EUGRSUZ_E00951 [Eucalyptus grandis]
Length=201

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 10/139 (7%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YSAA+YFE+          +V+T+K YV++A INTVDHLG +  
Sbjct  29   NFSDSLKDLKHLRKQLYSAADYFEL----------MVNTLKDYVTRAFINTVDHLGFMTY  78

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            K++  LD+K+ E SA ELRFSCV +R + C+ FID  G+ QQS     PK+    I PG 
Sbjct  79   KVNCLLDDKIEEASAIELRFSCVRERLQMCEMFIDHGGLSQQSLAIRTPKHHMRYILPGM  138

Query  482  DVDTVSDLGKSNRRSPMMT  538
             + T        RRS  M+
Sbjct  139  LLITRFVFPSELRRSTSMS  157



>ref|XP_002457993.1| hypothetical protein SORBIDRAFT_03g025120 [Sorghum bicolor]
 gb|EES03113.1| hypothetical protein SORBIDRAFT_03g025120 [Sorghum bicolor]
Length=320

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 97/163 (60%), Gaps = 10/163 (6%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M ++L      ++++KDLK LR Q YSAA+YFE++Y +++ KQ +   +K Y  KA+
Sbjct  24   EVQMQETLA----FSETIKDLKTLRSQLYSAAQYFELAYMQEDKKQAMTKNLKEYAVKAL  79

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGSI+ K+ + +D++  E +   LR SC++QR++  Q  +DR G+ QQS V   
Sbjct  80   VNTVDHLGSISFKVSSLIDQRFNEVADANLRISCIQQRAQVSQACMDREGLSQQSLVITA  139

Query  446  PKYLKHCINPGSD------VDTVSDLGKSNRRSPMMTILYPGR  556
            PKY K  I P  D      V    ++ K   R+  +  ++ GR
Sbjct  140  PKYHKRYILPAGDQSMPSAVPNFREMNKVTNRASQIHQVFSGR  182



>gb|EEC70261.1| hypothetical protein OsI_01066 [Oryza sativa Indica Group]
Length=317

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +2

Query  98   MKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTV  277
            M SL      +DSLKDL+NLR Q YSAAEYFEV Y  +  K  ++ ++K Y  +A+++TV
Sbjct  27   MSSLQEGLLFSDSLKDLRNLRSQLYSAAEYFEVFYRNNSQKSTVMTSLKDYTVEALVSTV  86

Query  278  DHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYL  457
            DHLG ++ K+D  + E+  E + TE R S VEQR R CQ+ ID+ G  QQS +   PKY 
Sbjct  87   DHLGFVSYKVDNLVKERSDEVNETEFRVSSVEQRVRICQQTIDQEGRSQQSLLIRAPKYH  146

Query  458  KHCINPGSDV  487
            +  I PG+D+
Sbjct  147  RRYILPGTDI  156



>ref|NP_001042529.2| Os01g0236400 [Oryza sativa Japonica Group]
 sp|Q5NB83.1|ABIL3_ORYSJ RecName: Full=Probable protein ABIL3; AltName: Full=Abl interactor-like 
protein 3 [Oryza sativa Japonica Group]
 dbj|BAD81273.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG89094.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54196.1| hypothetical protein OsJ_01031 [Oryza sativa Japonica Group]
 dbj|BAF04443.2| Os01g0236400 [Oryza sativa Japonica Group]
Length=317

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 84/130 (65%), Gaps = 0/130 (0%)
 Frame = +2

Query  98   MKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTV  277
            M SL      +DSLKDL+NLR Q YSAAEYFEV Y  +  K  ++ ++K Y  +A+++TV
Sbjct  27   MSSLQEGLLFSDSLKDLRNLRSQLYSAAEYFEVFYRNNSQKSTVMTSLKDYTVEALVSTV  86

Query  278  DHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYL  457
            DHLG ++ K+D  + E+  E + TE R S VEQR R CQ+ ID+ G  QQS +   PKY 
Sbjct  87   DHLGFVSYKVDNLVKERSDEVNETEFRVSSVEQRVRICQQTIDQEGRSQQSLLIRAPKYH  146

Query  458  KHCINPGSDV  487
            +  I PG+D+
Sbjct  147  RRYILPGTDI  156



>gb|KCW72499.1| hypothetical protein EUGRSUZ_E00962 [Eucalyptus grandis]
Length=211

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 81/114 (71%), Gaps = 3/114 (3%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N +DSLKDLK+LRKQ YS+ +YFE+SY + + KQ +V+T+K Y +KA I TVDHLG++  
Sbjct  29   NFSDSLKDLKDLRKQLYSSTDYFELSYIRHDQKQIVVNTLKDYATKAFIKTVDHLGTMTY  88

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKH  463
            K++  LDEK+ E  A ELRFSCV +R R C+  ID  G+ QQS   V  + LKH
Sbjct  89   KVNCLLDEKIEEAFAIELRFSCVRERLRMCEMVIDHGGLSQQS---VAIRTLKH  139



>ref|XP_010231912.1| PREDICTED: putative protein ABIL2 isoform X1 [Brachypodium distachyon]
Length=330

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             ++++KDLK LR Q YSAAEYFE++Y +++ KQ ++  +K Y  KA++NTVDHLGSI+ K
Sbjct  35   FSETIKDLKTLRSQLYSAAEYFELAYTQEDGKQAVMSNIKEYAVKALVNTVDHLGSISFK  94

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            + + +D+++ E +   LR SC++QR++  Q  ++R G+ QQS V   PKY K  I P  D
Sbjct  95   VSSLVDQRLDEVAEANLRVSCIQQRTQMSQACMNREGLSQQSLVITAPKYHKRYILPAGD  154

Query  485  ------VDTVSDLGKSNRRSPMMTILYPG  553
                  V   S++ K   R+  M   + G
Sbjct  155  DSIPNAVPNFSEMNKVKNRAAQMHQAFGG  183



>gb|KFK32975.1| hypothetical protein AALP_AA6G313500 [Arabis alpina]
Length=272

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 82/117 (70%), Gaps = 3/117 (3%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAA+YFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAADYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS   LR S +EQR + C+E++ +N   Q  F+   P + K    P
Sbjct  88   FNSFLSDNTCNFSTAHLRLSSLEQRMKLCREYMGKN---QHCFLFQSPHHHKRYFFP  141



>gb|KFK32976.1| hypothetical protein AALP_AA6G313500 [Arabis alpina]
Length=273

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 82/117 (70%), Gaps = 3/117 (3%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAA+YFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAADYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
             ++FL +    FS   LR S +EQR + C+E++ +N   Q  F+   P + K    P
Sbjct  88   FNSFLSDNTCNFSTAHLRLSSLEQRMKLCREYMGKN---QHCFLFQSPHHHKRYFFP  141



>ref|XP_006643968.1| PREDICTED: probable protein ABIL3-like [Oryza brachyantha]
Length=316

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +DSLKDL+NLR Q YSAAEYFEV Y  +  K  ++ ++K Y  +A+++TVDHLG ++ K+
Sbjct  36   SDSLKDLRNLRSQLYSAAEYFEVFYRNNSQKSTVMTSLKDYTVEALVSTVDHLGFVSYKV  95

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDV  487
            D  + E+  E + TE R S VEQR R CQ+ ID+ G  QQS +   PKY +  I PG+D+
Sbjct  96   DNLVKERSDEVNETEFRVSSVEQRVRICQQSIDQEGRSQQSLLIRTPKYHRRYILPGADI  155



>gb|EMT12714.1| hypothetical protein F775_26273 [Aegilops tauschii]
Length=297

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 94/145 (65%), Gaps = 2/145 (1%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
            +++++KDL  LR Q YSAAEYFE++Y +++ KQ +V  +K Y  KA++NTVDHLGSI+ K
Sbjct  34   LSETIKDLMTLRSQLYSAAEYFELAYMQEDGKQAVVSNLKEYAVKALVNTVDHLGSISFK  93

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            + + + ++  E +   LR SC++QR+++ Q  +++ G+ QQS V   PKY K  I PG+D
Sbjct  94   VSSLVGQRFDEVAEANLRVSCIQQRTQASQACMNKEGLTQQSLVITAPKYHKRYILPGND  153

Query  485  --VDTVSDLGKSNRRSPMMTILYPG  553
               D V +  + N+     T ++P 
Sbjct  154  SIPDAVPNFSEMNKVKNRTTQMHPA  178



>ref|NP_001150525.1| protein ABIL1 [Zea mays]
 gb|ACG39415.1| protein ABIL1 [Zea mays]
Length=311

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 99/168 (59%), Gaps = 7/168 (4%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D++K LK LR Q YSAAEYFE++Y + + KQ + + +K Y  KA++NTVDHLGSI+ K+
Sbjct  18   SDTIKGLKTLRSQLYSAAEYFELAYMQQDEKQAVTNNLKEYAVKALVNTVDHLGSISFKV  77

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDV  487
             + +D++  E +  +LR SC+ QR+++ Q  +DR GI QQ+ +   PKY K  I P    
Sbjct  78   SSLIDQRFSEATDADLRISCIHQRTQASQACVDREGISQQALLITAPKYHKRYILPAQGQ  137

Query  488  DTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQLQQGFLATKTKEHPT  631
               S +   N R  M  ++  GR     +Q HQ+       K K+ P+
Sbjct  138  SMPSAMP--NFRE-MDKVVVTGR----ASQMHQVFSAETRAKEKKQPS  178



>ref|XP_009419651.1| PREDICTED: probable protein ABIL3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
            ++D L+ L+N+R Q YSAAEYFE+SY  D+ K+ ++ T+K Y  +AV+N VDHLGS++ K
Sbjct  32   LSDGLEALRNMRSQLYSAAEYFELSYINDDRKETVMRTLKDYAVEAVVNAVDHLGSVSHK  91

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCI  469
            ++  L+E+V E S  E   SC+EQR R+CQ  ID+ G+ QQS +   PKY K  I
Sbjct  92   VNNLLNEEVDEVSVAESEVSCIEQRLRTCQACIDQEGLSQQSLLIRPPKYHKRYI  146



>ref|XP_009419650.1| PREDICTED: probable protein ABIL3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=321

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
            ++D L+ L+N+R Q YSAAEYFE+SY  D+ K+ ++ T+K Y  +AV+N VDHLGS++ K
Sbjct  32   LSDGLEALRNMRSQLYSAAEYFELSYINDDRKETVMRTLKDYAVEAVVNAVDHLGSVSHK  91

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCI  469
            ++  L+E+V E S  E   SC+EQR R+CQ  ID+ G+ QQS +   PKY K  I
Sbjct  92   VNNLLNEEVDEVSVAESEVSCIEQRLRTCQACIDQEGLSQQSLLIRPPKYHKRYI  146



>tpg|DAA59035.1| TPA: hypothetical protein ZEAMMB73_813280, partial [Zea mays]
Length=130

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            ++++K LK LR Q YSAAEYFE++Y + + KQ + + +K Y  KA++NTVDHLGSI+ K+
Sbjct  18   SETIKGLKTLRSQLYSAAEYFELAYTQQDEKQAVTNNLKEYAVKALVNTVDHLGSISFKV  77

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLK  460
             + +D++  E +  +LR SC+ QR+++ Q  +DR GI QQS V   PKY K
Sbjct  78   SSLIDQRFSEATDADLRISCIHQRTQASQACVDREGISQQSLVITAPKYHK  128



>ref|XP_011081455.1| PREDICTED: protein ABIL4-like [Sesamum indicum]
Length=307

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E  M +SL       DSLKDLKN+R+Q YSAA+YFE SY K +HKQ +V++ K YV+KA+
Sbjct  16   EIFMQQSL----QFADSLKDLKNIRQQLYSAAQYFESSYNKVDHKQFVVESSKNYVAKAL  71

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVL  445
            +NTVDHLGS+A KL+  LD+K  +FS+   RFSC+EQR  + Q F++  G+  +S + V 
Sbjct  72   VNTVDHLGSVADKLNGLLDQKANQFSSMTSRFSCIEQRFSTSQGFMNLGGLS-RSMLMVE  130

Query  446  PKYLKH  463
              Y  H
Sbjct  131  ANYGHH  136



>ref|XP_001783354.1| predicted protein [Physcomitrella patens]
 gb|EDQ51849.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            +   +LK+LKNLR Q YSAAEY E SY   + KQ ++D +K Y  KA++N VDHLG++A 
Sbjct  13   HFVQALKELKNLRPQLYSAAEYCESSYLYSDQKQVVLDNLKDYSVKALVNAVDHLGTVAY  72

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG  478
            KL+  L ++  E SATELR + V QR RSCQE  DR G++QQS    +    KH + PG
Sbjct  73   KLNDLLGQQTTEISATELRAASVAQRMRSCQEHSDREGLKQQSLAKTMHANHKHYVLPG  131



>gb|KJB17382.1| hypothetical protein B456_003G074200 [Gossypium raimondii]
Length=167

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 82/133 (62%), Gaps = 21/133 (16%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYF ++Y K+  KQ + DT+K Y  K
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFAMAYTKEMQKQIVEDTLKDYAIK  74

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT  439
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+E                 QS V 
Sbjct  75   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLE-----------------QSLVL  117

Query  440  VLPKYLKHCINPG  478
              PK+ KH I PG
Sbjct  118  EAPKHHKHYIFPG  130



>ref|XP_004967360.1| PREDICTED: probable protein ABIL3-like [Setaria italica]
Length=315

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDL+NLR Q YSAAEYFEV Y  + HK  ++ ++K Y  +A+++TVDHLG ++ K
Sbjct  33   FSDTLKDLRNLRSQLYSAAEYFEVFYRNNSHKSTVMTSLKDYTVEALVSTVDHLGFVSYK  92

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            +D  + EK  E + TE   S VEQR R CQ+ ID+ G  QQ+ +   PKY +  I PG D
Sbjct  93   VDNLVSEKADEVNETEFLVSSVEQRVRICQQTIDQEGRSQQALLIKAPKYHRRYILPGVD  152

Query  485  -----VDTVSDLGKSNR  520
                 +  VS+  + NR
Sbjct  153  LLESSIHPVSEPPRYNR  169



>ref|XP_002457050.1| hypothetical protein SORBIDRAFT_03g000510 [Sorghum bicolor]
 gb|EES02170.1| hypothetical protein SORBIDRAFT_03g000510 [Sorghum bicolor]
Length=321

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDL+NLR Q YSAAEYFEV Y  + HK  ++ ++K Y  +AV++TVDHLG ++ K
Sbjct  38   FSDTLKDLRNLRSQLYSAAEYFEVFYRNNSHKSTVMTSLKDYTVEAVVSTVDHLGFVSYK  97

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG--  478
            +D  + EK  E + TE   S VEQR R CQ+  D+ G  QQ+ +   PKY +  I PG  
Sbjct  98   VDNLVSEKADEVNETEFLVSSVEQRVRICQQTTDQEGRSQQALLIKAPKYHRRYILPGLD  157

Query  479  ---SDVDTVSDLGKSNR  520
               S +  VS+  + NR
Sbjct  158  LLESSIHPVSEPPRYNR  174



>ref|XP_009413808.1| PREDICTED: probable protein ABIL3 [Musa acuminata subsp. malaccensis]
 ref|XP_009413809.1| PREDICTED: probable protein ABIL3 [Musa acuminata subsp. malaccensis]
Length=299

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
            +++SLK L+N+R Q YSAA YFE+SY  D+ K+ LV ++K Y  KA++N VDHLGS++ K
Sbjct  32   LSESLKGLRNMRSQLYSAAAYFELSYINDDQKEILVTSLKDYAVKAILNAVDHLGSVSCK  91

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            +++ + E+V E S  E   SC+EQR R+ Q  ID  G+ QQS     PKY +  I PG  
Sbjct  92   VNSVVSEEVDEVSVAESEVSCIEQRLRTWQASIDHEGLSQQSLSLRPPKYHERYILPGEF  151

Query  485  VD  490
            +D
Sbjct  152  MD  153



>ref|XP_010055770.1| PREDICTED: protein ABIL3-like isoform X2 [Eucalyptus grandis]
 gb|KCW72268.1| hypothetical protein EUGRSUZ_E00725 [Eucalyptus grandis]
Length=118

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE+SY   +HKQ +V+T++ Y++KA 
Sbjct  22   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFELSYNGQDHKQIVVNTLRDYITKAF  77

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSC  367
            INTVDHLGS+  K+++ LD+K+GE SA +LRFSC
Sbjct  78   INTVDHLGSMTYKVNSLLDDKIGEASAIDLRFSC  111



>ref|XP_010445754.1| PREDICTED: protein ABIL4-like [Camelina sativa]
Length=121

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +KAV+NTVDHLGS++ K
Sbjct  28   FSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAKAVVNTVDHLGSVSDK  87

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSC  391
             ++FL +    FS T LR S +EQ   S 
Sbjct  88   FNSFLSDNSTHFSTTHLRLSSLEQVKHSI  116



>ref|XP_007051672.1| ABI-1-like 1 isoform 2 [Theobroma cacao]
 gb|EOX95829.1| ABI-1-like 1 isoform 2 [Theobroma cacao]
Length=213

 Score =   115 bits (289),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 91/158 (58%), Gaps = 18/158 (11%)
 Frame = +2

Query  8    YPLPFSPKIRFETTPTSWGLN*LIKKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEY  187
            +P P +P + F+              E +M +S     N   +L++LKNLR Q YSAAEY
Sbjct  5    FPRPENPAMTFD--------------EVSMERS----KNFVKALQELKNLRPQLYSAAEY  46

Query  188  FEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSC  367
             E SY + E KQ ++D +K Y  +A++N VDHLG++A KL   L+++  E S  EL+ SC
Sbjct  47   CEKSYLQSEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLEVSTMELKASC  106

Query  368  VEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            + Q+   CQ + D+ G+ QQ  +  +P++ KH I P S
Sbjct  107  LNQQLLMCQTYTDKEGLRQQQLLAFIPRHHKHYILPNS  144



>emb|CBI40454.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAAEY E SY   E KQ ++D +K Y  +A++N VDHLG++A KL  
Sbjct  17   ALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTD  76

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
             LD++  + S  EL+ SCV Q+  +CQ ++D+ GI QQ  +  +P++ KH I P S
Sbjct  77   LLDQQTLDVSTMELKVSCVNQKLLTCQTYMDKEGIRQQQLLAFIPRHHKHYILPNS  132



>ref|XP_002279419.1| PREDICTED: protein ABIL1 [Vitis vinifera]
Length=302

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAAEY E SY   E KQ ++D +K Y  +A++N VDHLG++A KL  
Sbjct  29   ALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
             LD++  + S  EL+ SCV Q+  +CQ ++D+ GI QQ  +  +P++ KH I P S
Sbjct  89   LLDQQTLDVSTMELKVSCVNQKLLTCQTYMDKEGIRQQQLLAFIPRHHKHYILPNS  144



>emb|CAN69308.1| hypothetical protein VITISV_003083 [Vitis vinifera]
Length=302

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAAEY E SY   E KQ ++D +K Y  +A++N VDHLG++A KL  
Sbjct  29   ALQELKNLRPQLYSAAEYCEKSYLHSEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
             LD++  + S  EL+ SCV Q+  +CQ ++D+ GI QQ  +  +P++ KH I P S
Sbjct  89   LLDQQTLDVSTMELKVSCVNQKLLTCQTYMDKEGIRQQQLLAFIPRHHKHYILPNS  144



>ref|XP_009400658.1| PREDICTED: protein ABIL2-like [Musa acuminata subsp. malaccensis]
Length=190

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +2

Query  170  YSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLDEKVGEFSAT  349
            YSAAEYFE+SY  D++K  + +T+K Y  KA++NTVDHLGS++ K+++ L+EKV E S  
Sbjct  47   YSAAEYFELSYATDDNKLLVFNTLKEYAIKALVNTVDHLGSVSFKVNSLLEEKVDELSGV  106

Query  350  ELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINP  475
            E R S +EQR R+CQE +DR G+ QQS V   P Y K    P
Sbjct  107  EFRVSSIEQRIRTCQELVDREGLLQQSLVIKAPSYSKQYTFP  148



>ref|XP_009409710.1| PREDICTED: protein ABIL2-like [Musa acuminata subsp. malaccensis]
Length=186

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 92/154 (60%), Gaps = 7/154 (5%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
            ++DS+  L+N+R + YSAAEYFE+SY  D+ K+ ++ ++K Y  KA+ N VDHLGS++ K
Sbjct  32   LSDSINGLRNMRSRLYSAAEYFELSYMNDDGKEMVMRSLKDYAVKAIANAVDHLGSVSYK  91

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSD  484
            +D  L+ +V E SA     SC++QR R+CQ  ID   + QQS +   PKY KH I  G  
Sbjct  92   VDNLLNYEVDEVSAATFEVSCMKQRLRTCQTRIDHECLSQQSLLIKPPKYHKHYILQG--  149

Query  485  VDTVSDLGKSNRRSPMMTILYPGRDEMHXNQHHQ  586
              + +D G S  +       YP ++    N HHQ
Sbjct  150  -QSTADSGISMLKCQG---FYPPKENSKLN-HHQ  178



>gb|KHG11471.1| Protein ABIL1 -like protein [Gossypium arboreum]
Length=299

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +2

Query  122  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA  301
            N   +L++LKNLR Q YSAAEY E SY  +E KQ ++D +K Y  +A++N VDHLG++A 
Sbjct  25   NFVKALQELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDYAVRALVNAVDHLGTVAY  84

Query  302  KLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            KL   L+++  E S  EL+ SC+ Q+  +CQ + D+ GI QQ  +  +P++ KH I P S
Sbjct  85   KLTDLLEQQTLEVSTIELKASCLNQKLLTCQTYTDKEGIRQQQLLAFIPRHHKHYILPNS  144



>ref|XP_010055745.1| PREDICTED: protein ABIL3-like [Eucalyptus grandis]
 ref|XP_010055768.1| PREDICTED: protein ABIL3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010055769.1| PREDICTED: protein ABIL3-like isoform X1 [Eucalyptus grandis]
Length=146

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE+SY   +HKQ +V+T++ Y++KA 
Sbjct  50   ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFELSYNGQDHKQIVVNTLRDYITKAF  105

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSC  367
            INTVDHLGS+  K+++ LD+K+GE SA +LRFSC
Sbjct  106  INTVDHLGSMTYKVNSLLDDKIGEASAIDLRFSC  139



>ref|XP_002880226.1| hypothetical protein ARALYDRAFT_483770 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56485.1| hypothetical protein ARALYDRAFT_483770 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL  
Sbjct  29   ALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
              D++  + S  ELR SCV Q+  +C+ +ID+ G+ QQ  + V+P + KH I P S
Sbjct  89   LFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNS  144



>ref|XP_006397808.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
 gb|ESQ39261.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
Length=305

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL  
Sbjct  29   ALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
              D++  + S  ELR SCV Q+  +C+ +ID+ G+ QQ  + V+P + KH I P S
Sbjct  89   LFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNS  144



>ref|XP_006439297.1| hypothetical protein CICLE_v10021975mg [Citrus clementina]
 gb|ESR52537.1| hypothetical protein CICLE_v10021975mg [Citrus clementina]
Length=239

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDLKNLRKQ  SAA++FEVSY K   KQ +V+T+K Y  KA+INTVDHLGS+A K
Sbjct  27   FSDTLKDLKNLRKQLCSAADFFEVSYMKQNQKQIVVETLKDYAIKALINTVDHLGSVAFK  86

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSC  391
            ++  LDEK+GE S TEL+F+C+EQ  + C
Sbjct  87   VNNLLDEKIGEVSETELQFTCLEQSHQDC  115



>gb|KHG10844.1| Protein ABIL2 [Gossypium arboreum]
Length=280

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 4/99 (4%)
 Frame = +2

Query  80   KKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK  259
            + E  M +SL       D+LKDLKNLR+Q YSAAEYFE++Y K+  KQ + DT+K Y  K
Sbjct  19   RDEVLMQQSLV----FADNLKDLKNLREQLYSAAEYFEMAYTKEMQKQIVEDTLKDYAIK  74

Query  260  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQ  376
            A++NTVDHLGSIA K++TFLDEK+ ++S  ELR  C+EQ
Sbjct  75   ALVNTVDHLGSIAYKINTFLDEKINDYSVMELRLFCLEQ  113



>ref|XP_006397807.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
 gb|ESQ39260.1| hypothetical protein EUTSA_v10001562mg [Eutrema salsugineum]
Length=293

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL  
Sbjct  29   ALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
              D++  + S  ELR SCV Q+  +C+ +ID+ G+ QQ  + V+P + KH I P S
Sbjct  89   LFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNS  144



>ref|XP_006294665.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
 gb|EOA27563.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
Length=306

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL  
Sbjct  29   ALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
              D++  + S  ELR SCV Q+  +C+ +ID+ G+ QQ  + V+P + KH I P S
Sbjct  89   LFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNS  144



>ref|XP_006294664.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
 gb|EOA27562.1| hypothetical protein CARUB_v10023702mg [Capsella rubella]
Length=294

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL  
Sbjct  29   ALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
              D++  + S  ELR SCV Q+  +C+ +ID+ G+ QQ  + V+P + KH I P S
Sbjct  89   LFDQQNSDISTMELRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNS  144



>ref|XP_006842582.1| hypothetical protein AMTR_s00077p00158760 [Amborella trichopoda]
 gb|ERN04257.1| hypothetical protein AMTR_s00077p00158760 [Amborella trichopoda]
Length=307

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 86/128 (67%), Gaps = 2/128 (2%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L +LKNLR Q YSAAEY E SY  +E KQ ++D +K Y  +A++N VDHLG++A KL  
Sbjct  28   ALLELKNLRPQLYSAAEYCEKSYLHNEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTD  87

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGSDVDT  493
              +++  + S+ EL+ SC+ Q  ++CQ + D+ G++QQ   TV+P++ KH + P   +DT
Sbjct  88   LFEQQTVDASSVELKISCLNQHLQTCQAYTDKEGLKQQQLFTVIPRHHKHYVLP--KLDT  145

Query  494  VSDLGKSN  517
            V+   +SN
Sbjct  146  VNKKSQSN  153



>gb|ACF86655.1| unknown [Zea mays]
 tpg|DAA52711.1| TPA: protein ABIL1 [Zea mays]
Length=314

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = +2

Query  128  TDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKL  307
            +D+LKDL+NLR Q YSAAEYFEV Y  + HK  ++ ++K Y  +A+++TVDHLG ++ K+
Sbjct  37   SDTLKDLRNLRSQLYSAAEYFEVFYRNNSHKSTVMTSLKDYTVEALVSTVDHLGFVSYKV  96

Query  308  DTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG---  478
            D  + EK  E   TE   S VEQR R CQ+  D+    QQ+ +   PKY +  I PG   
Sbjct  97   DNLVSEKAVEVKETEFLVSSVEQRVRICQQTTDQEARSQQALLIKAPKYHRRYILPGLDL  156

Query  479  --SDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQ  577
              S +  VS+  + +R+       Y GR +MH +Q
Sbjct  157  LESSIHPVSEPPRYSRQ-------YTGR-KMHKSQ  183



>ref|NP_001148582.1| protein ABIL1 [Zea mays]
 gb|ACG32122.1| protein ABIL1 [Zea mays]
Length=314

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (59%), Gaps = 13/156 (8%)
 Frame = +2

Query  125  ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAK  304
             +D+LKDL+NLR Q YSAAEYFEV Y  + HK  ++ ++K Y  +A+++TVDHLG ++ K
Sbjct  36   FSDTLKDLRNLRSQLYSAAEYFEVFYRNNSHKSTVMTSLKDYTVEALVSTVDHLGFVSYK  95

Query  305  LDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG--  478
            +D  + EK  E   TE   S VEQR R CQ+  D+    QQ+ +   PKY +  I PG  
Sbjct  96   VDNLVSEKAVEVKETEFLVSSVEQRVRICQQTTDQEARSQQALLIKAPKYHRRYILPGLD  155

Query  479  ---SDVDTVSDLGKSNRRSPMMTILYPGRDEMHXNQ  577
               S +  VS+  + +R+       Y GR +MH +Q
Sbjct  156  LLESSIHPVSEPPRYSRQ-------YTGR-KMHKSQ  183



>ref|XP_002981240.1| hypothetical protein SELMODRAFT_113760 [Selaginella moellendorffii]
 gb|EFJ17941.1| hypothetical protein SELMODRAFT_113760 [Selaginella moellendorffii]
Length=150

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q +SAAEY E SY   E KQ +++ +K Y  KA++N VDHLG++A KL+ 
Sbjct  34   ALQELKNLRPQLHSAAEYCESSYLYSEQKQAVLENLKDYSVKALVNAVDHLGTVACKLND  93

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG  478
             LD++  E  + +LR S + QR R+CQE+ DR  ++QQ      P++ KH   PG
Sbjct  94   LLDQQNSEIVSADLRISSLAQRYRTCQEYTDREALKQQCLYKTYPRHHKHYSFPG  148



>ref|XP_007051671.1| ABI-1-like 1 isoform 1 [Theobroma cacao]
 gb|EOX95828.1| ABI-1-like 1 isoform 1 [Theobroma cacao]
Length=299

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 91/158 (58%), Gaps = 18/158 (11%)
 Frame = +2

Query  8    YPLPFSPKIRFETTPTSWGLN*LIKKETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEY  187
            +P P +P + F+              E +M +S     N   +L++LKNLR Q YSAAEY
Sbjct  5    FPRPENPAMTFD--------------EVSMERS----KNFVKALQELKNLRPQLYSAAEY  46

Query  188  FEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSC  367
             E SY + E KQ ++D +K Y  +A++N VDHLG++A KL   L+++  E S  EL+ SC
Sbjct  47   CEKSYLQSEQKQMVLDNLKDYAVRALVNAVDHLGTVAYKLTDLLEQQTLEVSTMELKASC  106

Query  368  VEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
            + Q+   CQ + D+ G+ QQ  +  +P++ KH I P S
Sbjct  107  LNQQLLMCQTYTDKEGLRQQQLLAFIPRHHKHYILPNS  144



>ref|XP_002982709.1| hypothetical protein SELMODRAFT_116820 [Selaginella moellendorffii]
 gb|EFJ16462.1| hypothetical protein SELMODRAFT_116820 [Selaginella moellendorffii]
Length=150

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 76/115 (66%), Gaps = 0/115 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q +SAAEY E SY   E KQ +++ +K Y  KA++N VDHLG++A KL+ 
Sbjct  34   ALQELKNLRPQLHSAAEYCESSYLYSEQKQAVLENLKDYSVKALVNAVDHLGTVACKLND  93

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPG  478
             LD++  E  + +LR S + QR R+CQE+ DR  ++QQ      P++ KH   PG
Sbjct  94   LLDQQNSEIVSADLRISSLAQRYRTCQEYTDREALKQQCLYKTYPRHHKHYSFPG  148



>ref|XP_010058112.1| PREDICTED: uncharacterized protein LOC104445868 [Eucalyptus grandis]
Length=289

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 76/97 (78%), Gaps = 4/97 (4%)
 Frame = +2

Query  86   ETTMMKSLCNRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAV  265
            E +M +SL      +DSLKDLK+LRKQ YSAAEYFE+SY   +HKQ +V+T++ Y +KA 
Sbjct  175  ELSMKESLI----FSDSLKDLKDLRKQLYSAAEYFELSYNGQDHKQIVVNTLRDYTTKAF  230

Query  266  INTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQ  376
            INTVDHLGS+  K+++ LD+K+GE SA +L+FSCV+Q
Sbjct  231  INTVDHLGSMTYKVNSLLDDKIGEASAIDLKFSCVQQ  267



>emb|CDY42020.1| BnaC04g00980D [Brassica napus]
Length=303

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 78/116 (67%), Gaps = 0/116 (0%)
 Frame = +2

Query  134  SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT  313
            +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL  
Sbjct  29   ALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTD  88

Query  314  FLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCINPGS  481
              D++  + S  E+R SCV Q+  +C+ +ID+ G+ QQ  + V+P + KH I P S
Sbjct  89   LFDQQSSDVSIMEMRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLHHKHYILPNS  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500