BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032I24

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342676.1|  PREDICTED: TMV resistance protein N-like           172   3e-50   
ref|XP_009613117.1|  PREDICTED: TMV resistance protein N-like iso...    177   4e-49   
ref|XP_011015316.1|  PREDICTED: TMV resistance protein N-like           169   1e-48   Populus euphratica
ref|XP_006342684.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...    173   4e-48   Solanum tuberosum [potatoes]
ref|XP_002325743.2|  hypothetical protein POPTR_0019s00880g             167   6e-48   
gb|AAL07542.1|  resistance gene analog NBS7                             168   2e-47   Helianthus annuus
ref|XP_006367322.1|  PREDICTED: TMV resistance protein N-like           169   5e-47   
ref|XP_004253017.1|  PREDICTED: TMV resistance protein N-like           165   7e-47   Solanum lycopersicum
ref|XP_004237202.1|  PREDICTED: TMV resistance protein N-like           177   9e-47   Solanum lycopersicum
ref|XP_006371051.1|  hypothetical protein POPTR_0019s02990g             165   9e-47   
emb|CBI17021.3|  unnamed protein product                                163   1e-46   Vitis vinifera
ref|XP_006342406.1|  PREDICTED: TMV resistance protein N-like           166   3e-46   
ref|XP_007221062.1|  hypothetical protein PRUPE_ppa016235mg             164   3e-46   
ref|XP_011462237.1|  PREDICTED: TMV resistance protein N-like           163   3e-46   Fragaria vesca subsp. vesca
ref|XP_010058913.1|  PREDICTED: TMV resistance protein N-like           162   4e-46   
ref|XP_009794563.1|  PREDICTED: TMV resistance protein N-like           161   6e-46   Nicotiana sylvestris
ref|XP_010056818.1|  PREDICTED: TMV resistance protein N-like           161   6e-46   
ref|XP_006342412.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...    167   7e-46   Solanum tuberosum [potatoes]
ref|XP_011015315.1|  PREDICTED: TMV resistance protein N-like           174   1e-45   Populus euphratica
ref|XP_006441742.1|  hypothetical protein CICLE_v10024129mg             162   2e-45   
ref|XP_002310389.2|  hypothetical protein POPTR_0007s00600g             173   2e-45   
emb|CAC95120.1|  TIR/NBS/LRR protein                                    161   4e-45   Populus deltoides
emb|CDP14589.1|  unnamed protein product                                168   4e-45   Coffea canephora [robusta coffee]
gb|ABF81471.1|  TIR-NBS type disease resistance protein                 172   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010323796.1|  PREDICTED: TMV resistance protein N-like           159   5e-45   
ref|XP_009630491.1|  PREDICTED: uncharacterized protein LOC104120435    172   8e-45   
ref|XP_009599523.1|  PREDICTED: TMV resistance protein N-like           172   1e-44   
ref|XP_009613120.1|  PREDICTED: TMV resistance protein N-like iso...    171   1e-44   Nicotiana tomentosiformis
ref|XP_006371043.1|  hypothetical protein POPTR_0019s029202g            161   1e-44   
ref|XP_006342413.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A6-...    164   1e-44   
ref|XP_010041655.1|  PREDICTED: TMV resistance protein N-like           158   2e-44   Eucalyptus grandis [rose gum]
ref|XP_006371055.1|  hypothetical protein POPTR_0019s03015g             166   2e-44   
gb|KDO38417.1|  hypothetical protein CISIN_1g036738mg                   163   2e-44   Citrus sinensis [apfelsine]
ref|XP_009791999.1|  PREDICTED: TMV resistance protein N-like           162   4e-44   Nicotiana sylvestris
ref|XP_010070519.1|  PREDICTED: TMV resistance protein N-like           159   4e-44   
ref|XP_010057031.1|  PREDICTED: TMV resistance protein N-like           156   4e-44   
ref|XP_006342678.1|  PREDICTED: uncharacterized protein LOC102595828    167   5e-44   
ref|XP_006360469.1|  PREDICTED: TMV resistance protein N-like           169   8e-44   Solanum tuberosum [potatoes]
gb|KCW59235.1|  hypothetical protein EUGRSUZ_H01903                     156   8e-44   Eucalyptus grandis [rose gum]
ref|XP_010070448.1|  PREDICTED: TMV resistance protein N-like iso...    156   9e-44   Eucalyptus grandis [rose gum]
ref|XP_009628589.1|  PREDICTED: TMV resistance protein N-like iso...    169   9e-44   Nicotiana tomentosiformis
ref|XP_011012882.1|  PREDICTED: TMV resistance protein N-like           168   9e-44   Populus euphratica
pdb|3OZI|A  Chain A, Crystal Structure Of The Tir Domain From The...    157   1e-43   Linum usitatissimum
ref|XP_010026339.1|  PREDICTED: TMV resistance protein N-like           156   1e-43   
ref|XP_009628590.1|  PREDICTED: TMV resistance protein N-like iso...    168   1e-43   
ref|XP_011044953.1|  PREDICTED: TMV resistance protein N-like           164   1e-43   Populus euphratica
gb|KCW74266.1|  hypothetical protein EUGRSUZ_E02914                     164   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010650374.1|  PREDICTED: TMV resistance protein N-like           165   1e-43   
ref|XP_010070447.1|  PREDICTED: TMV resistance protein N-like iso...    155   1e-43   Eucalyptus grandis [rose gum]
ref|XP_006380260.1|  hypothetical protein POPTR_0007s00620g             163   1e-43   
ref|XP_011044910.1|  PREDICTED: TMV resistance protein N-like           166   1e-43   Populus euphratica
ref|XP_006367018.1|  PREDICTED: TMV resistance protein N-like           155   1e-43   
ref|XP_007134526.1|  hypothetical protein PHAVU_010G054800g             156   1e-43   Phaseolus vulgaris [French bean]
ref|XP_009790280.1|  PREDICTED: TMV resistance protein N-like           166   1e-43   Nicotiana sylvestris
ref|XP_006441888.1|  hypothetical protein CICLE_v10023769mg             155   1e-43   Citrus clementina [clementine]
ref|XP_006367324.1|  PREDICTED: TMV resistance protein N-like           166   2e-43   
ref|XP_006441884.1|  hypothetical protein CICLE_v10024486mg             155   2e-43   
gb|ABF81468.1|  TIR-NBS-LRR type disease resistance protein             167   2e-43   Populus trichocarpa [western balsam poplar]
emb|CDP07826.1|  unnamed protein product                                167   2e-43   Coffea canephora [robusta coffee]
ref|XP_010056575.1|  PREDICTED: TMV resistance protein N-like           163   3e-43   
ref|XP_010058743.1|  PREDICTED: TMV resistance protein N-like           164   3e-43   
ref|XP_010646047.1|  PREDICTED: TMV resistance protein N-like           156   3e-43   
ref|XP_006389335.1|  hypothetical protein POPTR_0030s00570g             166   4e-43   
ref|XP_010058909.1|  PREDICTED: TMV resistance protein N-like           164   4e-43   
ref|XP_007134525.1|  hypothetical protein PHAVU_010G054800g             155   4e-43   Phaseolus vulgaris [French bean]
ref|XP_010665467.1|  PREDICTED: TMV resistance protein N-like           166   4e-43   
ref|XP_010026474.1|  PREDICTED: TMV resistance protein N-like           154   4e-43   
ref|XP_006342679.1|  PREDICTED: TMV resistance protein N-like           166   4e-43   
emb|CAN62576.1|  hypothetical protein VITISV_038321                     167   4e-43   Vitis vinifera
gb|KCW73687.1|  hypothetical protein EUGRSUZ_E02290                     161   4e-43   Eucalyptus grandis [rose gum]
ref|XP_006367169.1|  PREDICTED: TMV resistance protein N-like iso...    154   5e-43   
ref|XP_010665341.1|  PREDICTED: TMV resistance protein N-like           167   5e-43   Vitis vinifera
ref|XP_006385995.1|  hypothetical protein POPTR_0003s19850g             167   5e-43   
gb|KCW59343.1|  hypothetical protein EUGRSUZ_H020322                    156   5e-43   Eucalyptus grandis [rose gum]
ref|XP_008232097.1|  PREDICTED: TMV resistance protein N-like           165   6e-43   
ref|XP_010058798.1|  PREDICTED: TMV resistance protein N-like           155   7e-43   
ref|XP_009803029.1|  PREDICTED: TMV resistance protein N-like iso...    166   8e-43   Nicotiana sylvestris
ref|XP_009803027.1|  PREDICTED: TMV resistance protein N-like iso...    166   8e-43   Nicotiana sylvestris
gb|KCW59155.1|  hypothetical protein EUGRSUZ_H01785                     157   8e-43   Eucalyptus grandis [rose gum]
ref|XP_010650303.1|  PREDICTED: toll/interleukin-1 receptor-like ...    154   9e-43   
ref|XP_009803028.1|  PREDICTED: TMV resistance protein N-like iso...    166   9e-43   Nicotiana sylvestris
ref|XP_008227564.1|  PREDICTED: TMV resistance protein N-like           156   9e-43   
ref|XP_006371058.1|  hypothetical protein POPTR_0019s03040g             161   1e-42   
ref|XP_008459162.1|  PREDICTED: TMV resistance protein N-like           162   1e-42   
gb|KCW73565.1|  hypothetical protein EUGRSUZ_E02103                     164   1e-42   Eucalyptus grandis [rose gum]
ref|XP_011457915.1|  PREDICTED: TMV resistance protein N-like iso...    166   1e-42   Fragaria vesca subsp. vesca
ref|XP_002325276.2|  hypothetical protein POPTR_0019s01160g             164   1e-42   
ref|XP_008351874.1|  PREDICTED: putative disease resistance prote...    154   1e-42   Malus domestica [apple tree]
ref|XP_004253023.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-...    159   1e-42   Solanum lycopersicum
ref|XP_006441912.1|  hypothetical protein CICLE_v10023609mg             154   1e-42   
ref|XP_006370866.1|  hypothetical protein POPTR_0019s01210g             161   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008236613.1|  PREDICTED: TMV resistance protein N-like           162   1e-42   Prunus mume [ume]
ref|XP_004292155.1|  PREDICTED: TMV resistance protein N-like iso...    166   1e-42   Fragaria vesca subsp. vesca
emb|CCW28746.1|  TIR NB-ARC LRR protein                                 164   1e-42   Arachis duranensis
gb|KCW54045.1|  hypothetical protein EUGRSUZ_I000292                    152   2e-42   Eucalyptus grandis [rose gum]
ref|XP_006367967.1|  PREDICTED: TMV resistance protein N-like           161   2e-42   
ref|XP_010661153.1|  PREDICTED: TMV resistance protein N-like iso...    153   2e-42   Vitis vinifera
ref|XP_010026496.1|  PREDICTED: TMV resistance protein N-like           154   2e-42   
emb|CAD36199.1|  NLS-TIR-NBS disease resistance protein                 161   2e-42   Populus tremula [European aspen]
gb|KCW59429.1|  hypothetical protein EUGRSUZ_H02155                     153   2e-42   Eucalyptus grandis [rose gum]
ref|XP_007201564.1|  hypothetical protein PRUPE_ppa018131mg             164   2e-42   
gb|KCW73676.1|  hypothetical protein EUGRSUZ_E02272                     164   2e-42   Eucalyptus grandis [rose gum]
gb|AAD25969.1|AF093642_1  flax rust resistance protein                  165   2e-42   Linum usitatissimum
gb|AAG43546.1|AF211528_1  Avr9/Cf-9 rapidly elicited protein 4          161   2e-42   Nicotiana tabacum [American tobacco]
ref|XP_004228809.1|  PREDICTED: TMV resistance protein N-like           164   2e-42   Solanum lycopersicum
ref|XP_010059085.1|  PREDICTED: TMV resistance protein N-like           164   2e-42   
gb|AAP44390.1|  nematode resistance protein                             164   2e-42   Solanum tuberosum [potatoes]
gb|ABF81460.1|  TIR-NBS type disease resistance protein                 162   3e-42   Populus trichocarpa [western balsam poplar]
dbj|BAD12595.1|  truncated N protein                                    161   3e-42   Nicotiana tabacum [American tobacco]
ref|XP_010665272.1|  PREDICTED: TMV resistance protein N-like           164   3e-42   
ref|XP_010661152.1|  PREDICTED: TMV resistance protein N-like iso...    152   3e-42   Vitis vinifera
ref|XP_004136801.1|  PREDICTED: TMV resistance protein N-like           158   3e-42   
ref|XP_011047737.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    164   4e-42   Populus euphratica
ref|XP_004159649.1|  PREDICTED: TMV resistance protein N-like           158   4e-42   
ref|XP_003617379.1|  CCP                                                164   4e-42   Medicago truncatula
gb|KCW74409.1|  hypothetical protein EUGRSUZ_E03092                     158   4e-42   Eucalyptus grandis [rose gum]
ref|XP_010056815.1|  PREDICTED: TMV resistance protein N-like           164   4e-42   
ref|XP_011005281.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    164   4e-42   Populus euphratica
ref|XP_010644041.1|  PREDICTED: uncharacterized protein LOC104877471    164   4e-42   
gb|KCW73945.1|  hypothetical protein EUGRSUZ_E02536                     164   4e-42   Eucalyptus grandis [rose gum]
ref|XP_009615050.1|  PREDICTED: TMV resistance protein N-like           164   4e-42   Nicotiana tomentosiformis
ref|XP_011012884.1|  PREDICTED: TMV resistance protein N-like           162   4e-42   Populus euphratica
ref|XP_010059091.1|  PREDICTED: TMV resistance protein N-like           151   4e-42   
ref|XP_010059182.1|  PREDICTED: TMV resistance protein N-like           159   5e-42   Eucalyptus grandis [rose gum]
gb|AAW28561.2|  TMV resistance protein N, putative                      160   5e-42   Solanum demissum
ref|XP_006356453.1|  PREDICTED: TMV resistance protein N-like           164   5e-42   Solanum tuberosum [potatoes]
emb|CAN64588.1|  hypothetical protein VITISV_008452                     154   5e-42   Vitis vinifera
ref|XP_010645859.1|  PREDICTED: protein SUPPRESSOR OF npr1-1, CON...    164   5e-42   Vitis vinifera
ref|XP_009759653.1|  PREDICTED: TMV resistance protein N-like           163   5e-42   Nicotiana sylvestris
emb|CDP20523.1|  unnamed protein product                                163   5e-42   Coffea canephora [robusta coffee]
gb|ABB82025.1|  TIR-NBS disease resistance-like protein                 161   5e-42   Populus trichocarpa [western balsam poplar]
dbj|BAF95888.1|  N-like protein                                         163   5e-42   Nicotiana tabacum [American tobacco]
ref|XP_011014417.1|  PREDICTED: TMV resistance protein N-like           162   6e-42   Populus euphratica
ref|XP_010644011.1|  PREDICTED: TMV resistance protein N-like iso...    163   6e-42   
gb|KCW59424.1|  hypothetical protein EUGRSUZ_H02148                     152   6e-42   Eucalyptus grandis [rose gum]
gb|AAP44393.1|  nematode resistance-like protein                        163   6e-42   Solanum tuberosum [potatoes]
gb|AAP44392.1|  nematode resistance-like protein                        163   7e-42   Solanum tuberosum [potatoes]
emb|CAN79900.1|  hypothetical protein VITISV_007865                     162   7e-42   Vitis vinifera
emb|CAA08798.1|  NL27                                                   162   7e-42   Solanum tuberosum [potatoes]
ref|XP_010058804.1|  PREDICTED: toll/interleukin-1 receptor-like ...    153   8e-42   
ref|XP_010665222.1|  PREDICTED: toll/interleukin-1 receptor-like ...    155   8e-42   Vitis vinifera
ref|XP_006359571.1|  PREDICTED: TMV resistance protein N-like           162   9e-42   
gb|AAL07537.1|  resistance gene analog NBS2                             152   9e-42   Helianthus annuus
ref|XP_010058828.1|  PREDICTED: TMV resistance protein N-like           153   9e-42   Eucalyptus grandis [rose gum]
ref|XP_002524855.1|  ATP binding protein, putative                      160   1e-41   
ref|XP_008236726.1|  PREDICTED: TMV resistance protein N-like           150   1e-41   Prunus mume [ume]
emb|CAC95127.1|  part I of G08 TIR/NBS/LRR protein                      152   1e-41   Populus deltoides
ref|XP_006380263.1|  hypothetical protein POPTR_0007s00680g             156   1e-41   
ref|XP_006478373.1|  PREDICTED: TMV resistance protein N-like           162   1e-41   
ref|XP_010646831.1|  PREDICTED: TMV resistance protein N-like           151   1e-41   
gb|AEE43928.1|  TIR-NBS-LRR resistance protein muRdr1D                  162   1e-41   Rosa multiflora [Japanese rose]
ref|XP_004243783.1|  PREDICTED: TMV resistance protein N-like           162   1e-41   Solanum lycopersicum
emb|CDP04904.1|  unnamed protein product                                162   1e-41   Coffea canephora [robusta coffee]
ref|XP_004253177.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A5-...    156   1e-41   Solanum lycopersicum
gb|KCW59403.1|  hypothetical protein EUGRSUZ_H02116                     152   1e-41   Eucalyptus grandis [rose gum]
gb|KCW73586.1|  hypothetical protein EUGRSUZ_E02144                     161   2e-41   Eucalyptus grandis [rose gum]
emb|CAA08797.1|  NL25                                                   158   2e-41   Solanum tuberosum [potatoes]
ref|XP_008343950.1|  PREDICTED: TMV resistance protein N-like           150   2e-41   
ref|XP_006441908.1|  hypothetical protein CICLE_v10023272mg             157   2e-41   
ref|XP_010050815.1|  PREDICTED: TMV resistance protein N-like           151   2e-41   
gb|KCW59442.1|  hypothetical protein EUGRSUZ_H02176                     151   2e-41   Eucalyptus grandis [rose gum]
gb|AAT37497.1|  N-like protein                                          161   2e-41   Nicotiana tabacum [American tobacco]
sp|Q40392.1|TMVRN_NICGU  RecName: Full=TMV resistance protein N         162   2e-41   Nicotiana glutinosa
ref|XP_011013491.1|  PREDICTED: TMV resistance protein N-like iso...    161   2e-41   Populus euphratica
ref|XP_011013492.1|  PREDICTED: TMV resistance protein N-like iso...    161   2e-41   Populus euphratica
ref|XP_010070567.1|  PREDICTED: TMV resistance protein N-like           150   2e-41   
gb|ABB82027.1|  TIR-NBS disease resistance-like protein                 161   2e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006348979.1|  PREDICTED: TMV resistance protein N-like           161   2e-41   
dbj|BAD12594.1|  N protein                                              161   2e-41   Nicotiana tabacum [American tobacco]
ref|XP_006380156.1|  hypothetical protein POPTR_0008s22420g             150   2e-41   
ref|XP_008236760.1|  PREDICTED: TMV resistance protein N-like           150   3e-41   Prunus mume [ume]
emb|CAC95124.1|  TIR/NBS/LRR protein                                    161   3e-41   Populus deltoides
ref|XP_010644030.1|  PREDICTED: uncharacterized protein LOC100253289    162   3e-41   
ref|XP_011013490.1|  PREDICTED: TMV resistance protein N-like iso...    161   3e-41   Populus euphratica
ref|XP_011457567.1|  PREDICTED: TMV resistance protein N-like           152   3e-41   Fragaria vesca subsp. vesca
ref|XP_010650377.1|  PREDICTED: uncharacterized protein LOC104879391    158   3e-41   
gb|KCW73616.1|  hypothetical protein EUGRSUZ_E02189                     160   3e-41   Eucalyptus grandis [rose gum]
ref|XP_010042728.1|  PREDICTED: TMV resistance protein N-like           149   3e-41   
ref|XP_007226709.1|  hypothetical protein PRUPE_ppa020033mg             161   3e-41   
ref|XP_010070517.1|  PREDICTED: TMV resistance protein N-like           158   3e-41   Eucalyptus grandis [rose gum]
ref|XP_010026217.1|  PREDICTED: TMV resistance protein N-like           160   3e-41   Eucalyptus grandis [rose gum]
gb|KEH15762.1|  disease resistance protein (TIR-NBS-LRR class)          149   3e-41   Medicago truncatula
ref|XP_010058765.1|  PREDICTED: TMV resistance protein N-like           149   3e-41   
gb|KCW73976.1|  hypothetical protein EUGRSUZ_E02587                     156   3e-41   Eucalyptus grandis [rose gum]
ref|XP_011013488.1|  PREDICTED: TMV resistance protein N-like iso...    161   4e-41   Populus euphratica
ref|XP_006371227.1|  hypothetical protein POPTR_0019s06300g             160   4e-41   
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    159   4e-41   
ref|XP_009779694.1|  PREDICTED: TMV resistance protein N-like           161   4e-41   Nicotiana sylvestris
ref|XP_011013487.1|  PREDICTED: TMV resistance protein N-like iso...    160   4e-41   Populus euphratica
ref|XP_011013489.1|  PREDICTED: TMV resistance protein N-like iso...    160   4e-41   Populus euphratica
ref|XP_010058776.1|  PREDICTED: TMV resistance protein N-like           150   4e-41   Eucalyptus grandis [rose gum]
ref|XP_011011693.1|  PREDICTED: TMV resistance protein N-like           160   4e-41   Populus euphratica
gb|KCW59447.1|  hypothetical protein EUGRSUZ_H02184                     150   4e-41   Eucalyptus grandis [rose gum]
ref|XP_010026210.1|  PREDICTED: TMV resistance protein N-like           158   4e-41   
ref|XP_009794564.1|  PREDICTED: TMV resistance protein N-like iso...    160   4e-41   Nicotiana sylvestris
ref|XP_002264704.2|  PREDICTED: TMV resistance protein N                161   4e-41   Vitis vinifera
gb|KDO42946.1|  hypothetical protein CISIN_1g043319mg                   149   5e-41   Citrus sinensis [apfelsine]
ref|XP_010665340.1|  PREDICTED: TMV resistance protein N-like           161   5e-41   
ref|XP_010058786.1|  PREDICTED: TMV resistance protein N-like           160   5e-41   
ref|XP_006371054.1|  hypothetical protein POPTR_0019s03010g             160   5e-41   
ref|XP_010057020.1|  PREDICTED: TMV resistance protein N-like           156   5e-41   
ref|XP_010648148.1|  PREDICTED: TMV resistance protein N-like           160   5e-41   Vitis vinifera
ref|XP_008228037.1|  PREDICTED: TMV resistance protein N-like           156   5e-41   
ref|XP_009794566.1|  PREDICTED: TMV resistance protein N-like iso...    160   5e-41   Nicotiana sylvestris
ref|XP_006492482.1|  PREDICTED: TMV resistance protein N-like           149   5e-41   
ref|XP_006494655.1|  PREDICTED: putative disease resistance prote...    157   6e-41   
ref|XP_010070572.1|  PREDICTED: TMV resistance protein N-like           152   6e-41   
gb|KGN59549.1|  hypothetical protein Csa_3G824940                       157   6e-41   Cucumis sativus [cucumbers]
ref|XP_010650378.1|  PREDICTED: toll/interleukin-1 receptor-like ...    149   6e-41   
ref|XP_008344573.1|  PREDICTED: TMV resistance protein N-like           149   6e-41   
ref|XP_006371041.1|  hypothetical protein POPTR_0019s02900g             160   6e-41   
gb|KEH38848.1|  disease resistance protein (TIR-NBS-LRR class), p...    160   6e-41   Medicago truncatula
ref|XP_006355113.1|  PREDICTED: TMV resistance protein N-like iso...    160   6e-41   Solanum tuberosum [potatoes]
ref|XP_006388458.1|  hypothetical protein POPTR_0182s00230g             149   6e-41   
ref|XP_006355114.1|  PREDICTED: TMV resistance protein N-like iso...    160   7e-41   Solanum tuberosum [potatoes]
gb|ABB82029.1|  TIR-NBS disease resistance-like protein                 160   7e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010646175.1|  PREDICTED: TMV resistance protein N-like           157   7e-41   
gb|KCW59177.1|  hypothetical protein EUGRSUZ_H01824                     148   7e-41   Eucalyptus grandis [rose gum]
ref|XP_006371049.1|  hypothetical protein POPTR_0019s02970g             159   7e-41   
gb|KDO43806.1|  hypothetical protein CISIN_1g0018052mg                  157   7e-41   Citrus sinensis [apfelsine]
gb|KCW73956.1|  hypothetical protein EUGRSUZ_E02550                     159   7e-41   Eucalyptus grandis [rose gum]
ref|XP_010058762.1|  PREDICTED: TMV resistance protein N-like           155   7e-41   
ref|XP_010070386.1|  PREDICTED: TMV resistance protein N-like iso...    159   7e-41   
ref|XP_010070522.1|  PREDICTED: TMV resistance protein N-like           157   7e-41   Eucalyptus grandis [rose gum]
ref|XP_006494647.1|  PREDICTED: TMV resistance protein N-like           154   8e-41   
ref|XP_006370854.1|  hypothetical protein POPTR_0019s00940g             149   8e-41   
emb|CAN78476.1|  hypothetical protein VITISV_009816                     159   8e-41   Vitis vinifera
gb|AEI27416.1|  TIR_3                                                   160   8e-41   Helianthus annuus
ref|XP_010058821.1|  PREDICTED: TMV resistance protein N-like           148   8e-41   
gb|ADL36719.1|  HD domain class transcription factor                    149   9e-41   Malus domestica [apple tree]
ref|XP_003596679.1|  TIR-NBS-LRR type disease resistance protein        160   9e-41   
ref|XP_010070408.1|  PREDICTED: TMV resistance protein N-like           151   9e-41   
ref|XP_006371047.1|  hypothetical protein POPTR_0019s02950g             157   9e-41   
gb|KCW73973.1|  hypothetical protein EUGRSUZ_E02576                     150   9e-41   Eucalyptus grandis [rose gum]
ref|XP_006370864.1|  hypothetical protein POPTR_0019s01170g             159   1e-40   
gb|AAL07544.1|  resistance gene analog NBS9                             152   1e-40   Helianthus annuus
gb|AES66930.2|  disease resistance protein (TIR-NBS-LRR class), p...    160   1e-40   Medicago truncatula
ref|XP_008222878.1|  PREDICTED: TMV resistance protein N-like           156   1e-40   
gb|AAA91021.1|  L6tr                                                    157   1e-40   Linum usitatissimum
gb|ABF81459.1|  TIR-NBS type disease resistance protein                 160   1e-40   Populus trichocarpa [western balsam poplar]
gb|KCW59105.1|  hypothetical protein EUGRSUZ_H01726                     159   1e-40   Eucalyptus grandis [rose gum]
ref|XP_003526343.1|  PREDICTED: TMV resistance protein N-like           160   1e-40   Glycine max [soybeans]
ref|XP_008236673.1|  PREDICTED: TMV resistance protein N-like           150   1e-40   Prunus mume [ume]
gb|KDO36433.1|  hypothetical protein CISIN_1g031540mg                   148   1e-40   Citrus sinensis [apfelsine]
gb|KDP34368.1|  hypothetical protein JCGZ_11251                         159   1e-40   Jatropha curcas
ref|XP_006441919.1|  hypothetical protein CICLE_v100186892mg            147   1e-40   
ref|XP_009374162.1|  PREDICTED: TMV resistance protein N-like           157   1e-40   
gb|AFP55548.1|  TIR-NBS-LRR                                             159   1e-40   Rosa rugosa [Japanese rose]
gb|KCW73653.1|  hypothetical protein EUGRSUZ_E02234                     158   1e-40   Eucalyptus grandis [rose gum]
ref|XP_006353757.1|  PREDICTED: TMV resistance protein N-like           159   1e-40   Solanum tuberosum [potatoes]
ref|XP_010242717.1|  PREDICTED: TMV resistance protein N-like iso...    159   1e-40   Nelumbo nucifera [Indian lotus]
gb|AEL30372.1|  TIR-NBS-LRR type disease resistance protein             159   1e-40   Arachis hypogaea [goober]
ref|XP_010665437.1|  PREDICTED: TMV resistance protein N-like           148   1e-40   
ref|XP_010057010.1|  PREDICTED: TMV resistance protein N-like           159   1e-40   
ref|XP_008349077.1|  PREDICTED: TMV resistance protein N-like           148   1e-40   
ref|XP_010070385.1|  PREDICTED: TMV resistance protein N-like iso...    159   1e-40   
gb|AEE43925.1|  TIR-NBS-LRR resistance protein muRdr1A                  159   1e-40   Rosa multiflora [Japanese rose]
ref|XP_010243120.1|  PREDICTED: TMV resistance protein N-like           159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_006385998.1|  hypothetical protein POPTR_0003s19870g             159   2e-40   
gb|KCW80715.1|  hypothetical protein EUGRSUZ_C021121                    147   2e-40   Eucalyptus grandis [rose gum]
ref|XP_006441904.1|  hypothetical protein CICLE_v10023772mg             148   2e-40   
ref|XP_010263414.1|  PREDICTED: TMV resistance protein N-like           159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010320697.1|  PREDICTED: TMV resistance protein N-like iso...    159   2e-40   
gb|KCW74410.1|  hypothetical protein EUGRSUZ_E03094                     147   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010026363.1|  PREDICTED: TMV resistance protein N-like           155   2e-40   
emb|CAN68030.1|  hypothetical protein VITISV_003124                     159   2e-40   Vitis vinifera
gb|KCW44198.1|  hypothetical protein EUGRSUZ_L02373                     159   2e-40   Eucalyptus grandis [rose gum]
gb|KCW73943.1|  hypothetical protein EUGRSUZ_E02532                     155   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010070381.1|  PREDICTED: TMV resistance protein N-like iso...    159   2e-40   
gb|KCW59180.1|  hypothetical protein EUGRSUZ_H01829                     156   2e-40   Eucalyptus grandis [rose gum]
gb|KCW59373.1|  hypothetical protein EUGRSUZ_H020741                    153   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010242716.1|  PREDICTED: TMV resistance protein N-like iso...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_002304785.2|  hypothetical protein POPTR_0003s19950g             159   2e-40   
ref|XP_010650203.1|  PREDICTED: TMV resistance protein N-like           155   2e-40   
ref|XP_010242715.1|  PREDICTED: TMV resistance protein N-like iso...    159   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_007134521.1|  hypothetical protein PHAVU_010G054400g             152   2e-40   Phaseolus vulgaris [French bean]
gb|AAP44391.1|  nematode resistance-like protein                        159   2e-40   Solanum tuberosum [potatoes]
gb|ABF81464.1|  TIR-NBS-LRR type disease resistance protein             159   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_010645836.1|  PREDICTED: toll/interleukin-1 receptor-like ...    147   2e-40   Vitis vinifera
ref|XP_010650380.1|  PREDICTED: TMV resistance protein N-like           159   2e-40   
ref|XP_010026382.1|  PREDICTED: TMV resistance protein N-like           159   2e-40   
gb|AAN73010.1|  NBS-LRR resistance protein RAS5-1                       154   2e-40   
ref|XP_010320695.1|  PREDICTED: TMV resistance protein N-like iso...    159   2e-40   
ref|XP_004295629.1|  PREDICTED: TMV resistance protein N-like           153   2e-40   
ref|XP_010646756.1|  PREDICTED: TMV resistance protein N-like           155   2e-40   
ref|XP_009586757.1|  PREDICTED: TMV resistance protein N-like           158   3e-40   
ref|XP_006478284.1|  PREDICTED: TMV resistance protein N-like           158   3e-40   
gb|KCW59142.1|  hypothetical protein EUGRSUZ_H017722                    149   3e-40   
ref|XP_008237764.1|  PREDICTED: TMV resistance protein N-like           147   3e-40   
ref|XP_006385250.1|  hypothetical protein POPTR_0003s02110g             158   3e-40   
ref|XP_006478372.1|  PREDICTED: TMV resistance protein N-like           159   3e-40   
gb|KCW59088.1|  hypothetical protein EUGRSUZ_H017051                    155   3e-40   
ref|XP_006494661.1|  PREDICTED: TMV resistance protein N-like           154   3e-40   
ref|XP_010644037.1|  PREDICTED: TMV resistance protein N-like           155   3e-40   
ref|XP_007158353.1|  hypothetical protein PHAVU_002G145600g             150   3e-40   
ref|XP_010059089.1|  PREDICTED: TMV resistance protein N-like           154   3e-40   
gb|KCW58791.1|  hypothetical protein EUGRSUZ_H01427                     157   3e-40   
ref|XP_006362839.1|  PREDICTED: TMV resistance protein N-like           158   3e-40   
ref|XP_006364843.1|  PREDICTED: TMV resistance protein N-like           158   3e-40   
gb|KDO42542.1|  hypothetical protein CISIN_1g042466mg                   147   3e-40   
gb|AEL30358.1|  TIR disease resistance protein                          147   3e-40   
ref|XP_010059266.1|  PREDICTED: TMV resistance protein N-like           154   3e-40   
gb|KCW73986.1|  hypothetical protein EUGRSUZ_E02599                     157   3e-40   
ref|XP_010026503.1|  PREDICTED: TMV resistance protein N-like           155   3e-40   
gb|KHN26393.1|  TMV resistance protein N                                158   4e-40   
ref|XP_010070368.1|  PREDICTED: TMV resistance protein N-like iso...    155   4e-40   
ref|XP_006366334.1|  PREDICTED: TMV resistance protein N-like           158   4e-40   
emb|CAD36200.1|  TIR-NBS disease resistance protein                     155   4e-40   
ref|XP_010069694.1|  PREDICTED: toll/interleukin-1 receptor-like ...    149   4e-40   
gb|ABM55687.1|  TIR-NBS-LRR class disease resistance protein            155   4e-40   
ref|XP_010056751.1|  PREDICTED: TMV resistance protein N-like iso...    158   4e-40   
ref|XP_007134520.1|  hypothetical protein PHAVU_010G054300g             149   4e-40   
ref|XP_011457584.1|  PREDICTED: TMV resistance protein N-like           146   4e-40   
gb|KCW80709.1|  hypothetical protein EUGRSUZ_C02108                     155   4e-40   
gb|KCW73592.1|  hypothetical protein EUGRSUZ_E02152                     157   4e-40   
emb|CAN61899.1|  hypothetical protein VITISV_029813                     146   4e-40   
gb|KHN01586.1|  TMV resistance protein N                                152   5e-40   
ref|XP_006492498.1|  PREDICTED: TMV resistance protein N-like           154   5e-40   
ref|XP_010645853.1|  PREDICTED: TMV resistance protein N-like           157   5e-40   
ref|XP_010058787.1|  PREDICTED: TMV resistance protein N-like           153   5e-40   
ref|XP_006386003.1|  hypothetical protein POPTR_0003s19910g             158   5e-40   
gb|KCW73642.1|  hypothetical protein EUGRSUZ_E02219                     156   5e-40   
gb|KDO39318.1|  hypothetical protein CISIN_1g031151mg                   146   5e-40   
ref|XP_006495109.1|  PREDICTED: TMV resistance protein N-like           149   5e-40   
ref|XP_007219199.1|  hypothetical protein PRUPE_ppa016991mg             150   5e-40   
ref|XP_010056755.1|  PREDICTED: TMV resistance protein N-like iso...    157   5e-40   
gb|AAD25968.1|AF093641_2  flax rust resistance protein                  158   5e-40   
ref|XP_009785918.1|  PREDICTED: TMV resistance protein N-like           158   5e-40   
ref|XP_008339367.1|  PREDICTED: toll/interleukin-1 receptor-like ...    150   5e-40   
ref|XP_008244454.1|  PREDICTED: TMV resistance protein N-like           149   5e-40   
ref|XP_002263928.2|  PREDICTED: toll/interleukin-1 receptor-like ...    149   5e-40   
gb|ABO21407.1|  TMV resistance protein N                                157   6e-40   
ref|XP_004246918.2|  PREDICTED: TMV resistance protein N-like           157   6e-40   
ref|XP_010026325.1|  PREDICTED: TMV resistance protein N-like           149   6e-40   
gb|AAA91022.1|  L6                                                      157   6e-40   
ref|XP_009353817.1|  PREDICTED: TMV resistance protein N-like           147   6e-40   
gb|ABF81466.1|  TIR-NBS type disease resistance protein                 158   6e-40   
ref|XP_009622249.1|  PREDICTED: TMV resistance protein N-like           157   6e-40   
ref|XP_009368500.1|  PREDICTED: TMV resistance protein N-like           151   6e-40   
ref|XP_006371052.1|  hypothetical protein POPTR_0019s03000g             156   6e-40   
emb|CAC82811.1|  resistance gene-like                                   157   6e-40   
ref|XP_010263365.1|  PREDICTED: TMV resistance protein N-like           156   7e-40   
ref|XP_010050897.1|  PREDICTED: TMV resistance protein N-like           154   7e-40   
gb|AAY43787.1|  disease resistance protein                              152   7e-40   
gb|AAL07539.1|  resistance gene analog NBS4                             149   7e-40   
ref|XP_010245185.1|  PREDICTED: TMV resistance protein N-like           157   7e-40   
gb|AFP55577.1|  TIR-NBS-LRR                                             157   8e-40   
ref|XP_010058773.1|  PREDICTED: TMV resistance protein N-like           145   8e-40   
gb|KCW59360.1|  hypothetical protein EUGRSUZ_H02058                     154   8e-40   
ref|XP_010058800.1|  PREDICTED: TMV resistance protein N-like           156   8e-40   
ref|XP_008344093.1|  PREDICTED: TMV resistance protein N-like           147   8e-40   
emb|CAN82451.1|  hypothetical protein VITISV_003325                     145   9e-40   
ref|XP_010026443.1|  PREDICTED: TMV resistance protein N-like           154   9e-40   
ref|XP_010661151.1|  PREDICTED: TMV resistance protein N-like           157   9e-40   
gb|KCW80713.1|  hypothetical protein EUGRSUZ_C021111                    153   9e-40   
ref|XP_011013098.1|  PREDICTED: TMV resistance protein N-like iso...    157   1e-39   
ref|XP_011013099.1|  PREDICTED: TMV resistance protein N-like iso...    157   1e-39   
ref|XP_010059172.1|  PREDICTED: TMV resistance protein N-like           148   1e-39   
gb|KEH15216.1|  disease resistance protein (TIR-NBS-LRR class)          145   1e-39   
ref|XP_010424142.1|  PREDICTED: toll/interleukin-1 receptor-like ...    145   1e-39   
ref|XP_010056760.1|  PREDICTED: TMV resistance protein N-like iso...    155   1e-39   
gb|AEE43927.1|  TIR-NBS-LRR resistance protein muRdr1C                  157   1e-39   
ref|XP_011470603.1|  PREDICTED: TMV resistance protein N-like           156   1e-39   
gb|KCW59329.1|  hypothetical protein EUGRSUZ_H02019                     155   1e-39   
gb|AAL07535.1|  resistance gene analog PU3                              155   1e-39   
ref|XP_010059181.1|  PREDICTED: TMV resistance protein N-like           145   1e-39   
ref|XP_010057039.1|  PREDICTED: TMV resistance protein N-like           156   1e-39   
ref|XP_010034174.1|  PREDICTED: TMV resistance protein N-like           151   1e-39   
ref|XP_010026473.1|  PREDICTED: TMV resistance protein N-like           152   1e-39   
ref|XP_008368587.1|  PREDICTED: TMV resistance protein N-like           156   1e-39   
emb|CAN71926.1|  hypothetical protein VITISV_006195                     145   1e-39   
ref|XP_010051443.1|  PREDICTED: uncharacterized protein LOC104440170    150   1e-39   
ref|XP_010026359.1|  PREDICTED: TMV resistance protein N-like           148   1e-39   
gb|AAM89998.1|AF403250_1  disease resistance-like protein GS0-1         145   1e-39   
ref|XP_009373229.1|  PREDICTED: TMV resistance protein N-like iso...    155   1e-39   
ref|XP_008231763.1|  PREDICTED: TMV resistance protein N-like           153   1e-39   
gb|KDO48212.1|  hypothetical protein CISIN_1g045657mg                   147   1e-39   
gb|AAL07541.1|  resistance gene analog NBS6                             149   1e-39   
ref|XP_008238088.1|  PREDICTED: LOW QUALITY PROTEIN: TMV resistan...    156   1e-39   
ref|XP_010070367.1|  PREDICTED: TMV resistance protein N-like iso...    155   2e-39   
ref|XP_006494953.1|  PREDICTED: putative disease resistance prote...    153   2e-39   
gb|AEE43929.1|  TIR-NBS-LRR resistance protein muRdr1E                  156   2e-39   
ref|XP_010059301.1|  PREDICTED: TMV resistance protein N-like           146   2e-39   
ref|XP_010058906.1|  PREDICTED: putative disease resistance prote...    153   2e-39   
gb|AFP55552.1|  TIR-NBS-LRR                                             156   2e-39   
ref|XP_007201658.1|  hypothetical protein PRUPE_ppa022091mg             156   2e-39   
ref|XP_006388467.1|  hypothetical protein POPTR_0178s00240g             156   2e-39   
ref|XP_006478321.1|  PREDICTED: TMV resistance protein N-like iso...    154   2e-39   
gb|KCW74283.1|  hypothetical protein EUGRSUZ_E02936                     153   2e-39   
ref|XP_006389333.1|  hypothetical protein POPTR_0030s00550g             155   2e-39   
ref|XP_010256441.1|  PREDICTED: TMV resistance protein N-like iso...    155   2e-39   
gb|KCW73580.1|  hypothetical protein EUGRSUZ_E02138                     155   2e-39   
ref|XP_006352448.1|  PREDICTED: TMV resistance protein N-like           156   2e-39   
gb|AAL07536.1|  resistance gene analog NBS1                             149   2e-39   
ref|XP_010256443.1|  PREDICTED: TMV resistance protein N-like iso...    155   2e-39   
ref|XP_010041148.1|  PREDICTED: TMV resistance protein N-like           144   2e-39   
ref|XP_009373216.1|  PREDICTED: TMV resistance protein N-like iso...    155   2e-39   
ref|XP_006441740.1|  hypothetical protein CICLE_v100235051mg            144   2e-39   
ref|XP_010026383.1|  PREDICTED: TMV resistance protein N-like           147   2e-39   
ref|XP_002325273.2|  hypothetical protein POPTR_0019s01200g             154   2e-39   
ref|XP_006441925.1|  hypothetical protein CICLE_v10024092mg             154   3e-39   
ref|XP_008245338.1|  PREDICTED: TMV resistance protein N-like           146   3e-39   
emb|CAN65187.1|  hypothetical protein VITISV_026856                     144   3e-39   
ref|XP_006366255.1|  PREDICTED: TMV resistance protein N-like iso...    155   3e-39   
ref|XP_008227883.1|  PREDICTED: TMV resistance protein N-like           155   3e-39   
ref|XP_011001241.1|  PREDICTED: TMV resistance protein N-like           155   3e-39   
gb|ABF81462.1|  TIR-NBS-LRR type disease resistance protein             155   3e-39   
ref|XP_006441898.1|  hypothetical protein CICLE_v10019142mg             153   3e-39   
ref|XP_010026480.1|  PREDICTED: TMV resistance protein N-like           154   3e-39   
ref|XP_007221574.1|  hypothetical protein PRUPE_ppa025931mg             155   3e-39   
ref|XP_010058796.1|  PREDICTED: TMV resistance protein N-like           144   3e-39   
ref|XP_010059166.1|  PREDICTED: TMV resistance protein N-like           155   3e-39   
ref|XP_009802254.1|  PREDICTED: toll/interleukin-1 receptor-like ...    147   3e-39   
ref|XP_010030254.1|  PREDICTED: TMV resistance protein N-like           144   3e-39   
gb|KCW73596.1|  hypothetical protein EUGRSUZ_E02157                     155   3e-39   
ref|XP_010312671.1|  PREDICTED: uncharacterized protein LOC101265700    156   3e-39   
ref|XP_010312683.1|  PREDICTED: TMV resistance protein N-like iso...    155   3e-39   
gb|ABM55688.1|  TIR-NBS class disease resistance protein                152   3e-39   
ref|XP_010312685.1|  PREDICTED: TMV resistance protein N-like iso...    155   3e-39   
ref|XP_004233763.1|  PREDICTED: TMV resistance protein N-like           155   3e-39   
gb|KCW73657.1|  hypothetical protein EUGRSUZ_E02243                     147   3e-39   
gb|KEH30741.1|  disease resistance protein (TIR-NBS-LRR class), p...    155   3e-39   
ref|XP_010026450.1|  PREDICTED: TMV resistance protein N-like           144   3e-39   
ref|XP_008227885.1|  PREDICTED: TMV resistance protein N-like           155   3e-39   
ref|XP_010312682.1|  PREDICTED: TMV resistance protein N-like iso...    155   4e-39   
gb|KCW45053.1|  hypothetical protein EUGRSUZ_L01349                     155   4e-39   
ref|XP_010665294.1|  PREDICTED: TMV resistance protein N-like           152   4e-39   
ref|XP_010109975.1|  TMV resistance protein N                           155   4e-39   
ref|XP_007148814.1|  hypothetical protein PHAVU_005G016500g             155   4e-39   
ref|XP_008342527.1|  PREDICTED: TMV resistance protein N-like iso...    154   4e-39   
ref|XP_010058810.1|  PREDICTED: TMV resistance protein N-like           152   4e-39   
ref|XP_006441881.1|  hypothetical protein CICLE_v10024604mg             154   4e-39   
ref|XP_008351316.1|  PREDICTED: TMV resistance protein N-like           155   4e-39   
ref|NP_001237821.1|  candidate disease-resistance protein               152   4e-39   
ref|XP_006370843.1|  hypothetical protein POPTR_0019s00720g             152   4e-39   
ref|XP_008237765.1|  PREDICTED: TMV resistance protein N-like           154   4e-39   
ref|XP_008237268.1|  PREDICTED: TMV resistance protein N-like           154   4e-39   
ref|XP_007199954.1|  hypothetical protein PRUPE_ppa1027179mg            155   4e-39   
ref|XP_010056758.1|  PREDICTED: TMV resistance protein N-like iso...    155   4e-39   
ref|XP_010057237.1|  PREDICTED: TMV resistance protein N-like iso...    154   4e-39   
gb|AAL07540.1|  resistance gene analog NBS5                             147   4e-39   
ref|XP_006600001.1|  PREDICTED: TMV resistance protein N-like           155   4e-39   
ref|XP_008375888.1|  PREDICTED: TMV resistance protein N-like           155   4e-39   
ref|XP_010057285.1|  PREDICTED: TMV resistance protein N-like           152   4e-39   
gb|ABF81465.1|  TIR-NBS-LRR type disease resistance protein             155   4e-39   
ref|XP_008228036.1|  PREDICTED: TMV resistance protein N-like           154   4e-39   
gb|KEH25115.1|  disease resistance protein (TIR-NBS-LRR class)          155   4e-39   
ref|XP_003622506.1|  TMV resistance protein N                           155   4e-39   
ref|XP_008339116.1|  PREDICTED: TMV resistance protein N-like           149   4e-39   
ref|XP_010040614.1|  PREDICTED: TMV resistance protein N-like           155   4e-39   
gb|AFP55568.1|  TIR-NBS-LRR                                             155   5e-39   
ref|XP_009361379.1|  PREDICTED: TMV resistance protein N-like           152   5e-39   
ref|XP_010059096.1|  PREDICTED: TMV resistance protein N-like           144   5e-39   
ref|XP_006478320.1|  PREDICTED: TMV resistance protein N-like iso...    154   5e-39   
ref|XP_006385577.1|  hypothetical protein POPTR_0003s08250g             155   5e-39   
ref|XP_010026368.1|  PREDICTED: TMV resistance protein N-like           153   5e-39   
ref|XP_010057231.1|  PREDICTED: TMV resistance protein N-like iso...    154   5e-39   
gb|AAD25974.1|AF093647_1  flax rust resistance protein                  154   5e-39   
emb|CBI39287.3|  unnamed protein product                                155   5e-39   
gb|ABC55465.1|  TIR-NBS disease resistance-like protein                 152   5e-39   
gb|KCW59434.1|  hypothetical protein EUGRSUZ_H02164                     152   5e-39   
ref|XP_004492775.1|  PREDICTED: TMV resistance protein N-like iso...    154   6e-39   
gb|AEE43933.1|  TIR-NBS-LRR resistance protein muRdr1I                  152   6e-39   
ref|XP_011457572.1|  PREDICTED: TMV resistance protein N-like iso...    155   6e-39   
gb|KCW73602.1|  hypothetical protein EUGRSUZ_E02169                     154   6e-39   
ref|XP_004310272.2|  PREDICTED: TMV resistance protein N-like iso...    155   6e-39   
ref|XP_006431776.1|  hypothetical protein CICLE_v10002432mg             144   6e-39   
ref|XP_009105585.1|  PREDICTED: putative disease resistance prote...    155   6e-39   
ref|XP_010058927.1|  PREDICTED: TMV resistance protein N-like           152   6e-39   
gb|AAD25965.1|AF093638_1  flax rust resistance protein                  155   6e-39   
ref|XP_008233348.1|  PREDICTED: TMV resistance protein N-like           151   6e-39   
ref|XP_008339368.1|  PREDICTED: TMV resistance protein N-like           148   6e-39   
ref|XP_010026456.1|  PREDICTED: toll/interleukin-1 receptor-like ...    143   6e-39   
ref|XP_004492774.1|  PREDICTED: TMV resistance protein N-like iso...    154   7e-39   
ref|XP_004228499.1|  PREDICTED: TMV resistance protein N-like           155   7e-39   
gb|ACJ86274.1|  unknown                                                 144   7e-39   
ref|XP_010644028.1|  PREDICTED: uncharacterized protein LOC100261885    155   7e-39   
ref|XP_010058768.1|  PREDICTED: TMV resistance protein N-like           149   7e-39   
gb|KCW74573.1|  hypothetical protein EUGRSUZ_E032912                    149   7e-39   
ref|XP_008342525.1|  PREDICTED: TMV resistance protein N-like iso...    154   7e-39   
emb|CDY00371.1|  BnaC07g14550D                                          154   7e-39   
ref|XP_010048469.1|  PREDICTED: TMV resistance protein N-like           154   7e-39   
gb|KCW59127.1|  hypothetical protein EUGRSUZ_H01749                     146   7e-39   
ref|XP_010657879.1|  PREDICTED: TMV resistance protein N-like           143   8e-39   
gb|KDO36672.1|  hypothetical protein CISIN_1g035646mg                   151   8e-39   
ref|XP_011470189.1|  PREDICTED: TMV resistance protein N-like iso...    153   8e-39   
ref|XP_006370852.1|  hypothetical protein POPTR_0019s00910g             142   8e-39   
ref|XP_007227135.1|  hypothetical protein PRUPE_ppa026101mg             154   8e-39   
ref|XP_006494031.1|  PREDICTED: TMV resistance protein N-like           144   8e-39   
gb|AAD25972.1|AF093645_1  flax rust resistance protein                  154   8e-39   
gb|AAD25976.1|AF093649_1  flax rust resistance protein                  154   8e-39   
gb|KCW73659.1|  hypothetical protein EUGRSUZ_E02245                     153   8e-39   
gb|KDO37805.1|  hypothetical protein CISIN_1g044964mg                   143   8e-39   
ref|XP_010103475.1|  TMV resistance protein N                           143   8e-39   
ref|XP_008236759.1|  PREDICTED: TMV resistance protein N-like           151   8e-39   
ref|XP_007134516.1|  hypothetical protein PHAVU_010G054200g             154   9e-39   
ref|XP_006367172.1|  PREDICTED: TMV resistance protein N-like iso...    154   9e-39   
ref|XP_007199088.1|  hypothetical protein PRUPE_ppa018905mg             154   9e-39   
ref|XP_010650202.1|  PREDICTED: TMV resistance protein N-like           154   9e-39   
ref|XP_010070629.1|  PREDICTED: toll/interleukin-1 receptor-like ...    147   9e-39   



>ref|XP_006342676.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=160

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD FLSFRG D RKTF+  L+ +L +  I  FKDD+RLE G+ IS  LP AI ESKF I 
Sbjct  12   YDAFLSFRGEDTRKTFVSHLYNALIQGRIDVFKDDERLETGNSISDELPKAIEESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASSKWCL+ELA +++C+++LK QIV+PIFY+V+P+DVR+Q  ++  SF +  EK
Sbjct  72   IFSESYASSKWCLDELAHIIKCRKELK-QIVIPIFYNVDPSDVRHQTQTFAESFSQHEEK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EK++RW++A  ++G++ GYHL+N
Sbjct  131  YKDDMEKIQRWRDAFAESGKISGYHLQN  158



>ref|XP_009613117.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613118.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=426

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 108/150 (72%), Gaps = 1/150 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F+  L+ +LE+RGIH FKDDDRLE G  IS  L  AI ES+F 
Sbjct  10   WKYDVFLSFRGEDTRKNFVSHLYNALEQRGIHAFKDDDRLETGKSISYELLKAIEESRFA  69

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YASSKWC EELA +++CQ +L EQ V+PIFY V P+DVR+Q   +  SF +  
Sbjct  70   VVIFSKSYASSKWCSEELAHIIKCQSEL-EQTVIPIFYDVSPSDVRHQNPPFAESFSQHE  128

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            EK   D EKV+RW++A  +AG+L G+ LKN
Sbjct  129  EKYKDDMEKVQRWRDAFAEAGKLSGHDLKN  158



>ref|XP_011015316.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=173

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 1/153 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D L+ +L + GIHTF+DD+ L +G+ IS  L  AI  S+  
Sbjct  21   WNYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRIS  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS+WCL+EL  ++EC++K+ +Q+V+PIFY  EP+DVR Q GSY  +F E  
Sbjct  81   IVVFSKHYASSRWCLDELVKILECRQKI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDEHE  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E+  ++ EKV +W+ AL +AG L G+ L N+ N
Sbjct  140  ERFKEETEKVNKWRGALAEAGNLSGWGLNNEAN  172



>ref|XP_006342684.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum tuberosum]
Length=380

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD FLSFRG D R+TF+  L+ +L +  I  FKDD+RL+ G  IS  LP AI ESKF I 
Sbjct  12   YDAFLSFRGEDTRRTFVSHLYNALIQGRIDVFKDDERLQTGKSISDELPKAIEESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASSKWCL+ELA +M+CQ++LK QIV+PIFY+V+P+DVR+Q  ++  SF +  EK
Sbjct  72   IFSESYASSKWCLDELAHIMKCQKELK-QIVIPIFYNVDPSDVRHQTQTFAESFSQHEEK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EK++RW+EA  ++G++ GYHL+N
Sbjct  131  YKDDIEKIQRWREAFEESGKISGYHLQN  158



>ref|XP_002325743.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
 gb|EEF00125.2| hypothetical protein POPTR_0019s00880g, partial [Populus trichocarpa]
Length=163

 Score =   167 bits (422),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 107/153 (70%), Gaps = 1/153 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D L+ +L + GIHTF+DD+ L +G+ IS  L  AI  S+  
Sbjct  3    WNYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLVKAIEGSRIS  62

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS+WCL+EL  ++EC++K+ +Q+V+PIFY  EP+DVR Q GSY  +F E  
Sbjct  63   IVVFSKQYASSRWCLDELVKIVECRQKI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDEHE  121

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E   ++ EKV +W+ AL +AG L G+ L N+ N
Sbjct  122  EHFKEEMEKVNKWRGALAEAGNLSGWGLNNEAN  154



>gb|AAL07542.1| resistance gene analog NBS7 [Helianthus annuus]
Length=259

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W YDVFLSFRG D RK+F+D L+ +LE+RGI+T+KDD+ L +G+ I  +L  AI+ES+
Sbjct  18   QSWNYDVFLSFRGDDTRKSFVDHLYTALEQRGIYTYKDDETLPRGESIGPALLKAIQESR  77

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              + VFSK YA S WCL+ELA +MEC +  + QIV+PIFYHV+P+DVR QKG Y  +F +
Sbjct  78   VAVIVFSKNYADSSWCLDELAHIMECMDT-RGQIVMPIFYHVDPSDVRKQKGKYGEAFTK  136

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHAS  679
             HE+  ++  KV  W++AL KAG+L G+ + +  N  +    E    D+ ++L   S
Sbjct  137  -HER--ENKLKVESWRKALEKAGKLSGWVINDIENSKDLIGIETRLQDLISKLEIGS  190



>ref|XP_006367322.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=320

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 109/148 (74%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD+FLSFRG D R+TF+  L+++LE RGIHTFKDD+RLE G  IS  L  AI E++F + 
Sbjct  50   YDIFLSFRGEDTRRTFVSHLYKALELRGIHTFKDDERLEAGQSISAELLKAIEEARFAVV  109

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YASS+WCLEELA +++C+++L EQIV+P+FY   P+DVR+Q   + +SF +   K
Sbjct  110  IFSKSYASSRWCLEELAHIIKCKKEL-EQIVIPVFYDASPSDVRHQNPPFADSFSQHEVK  168

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
                 EKV+RW+ A  +AG++ GYHL N
Sbjct  169  YKDAMEKVQRWRGAFVEAGKISGYHLLN  196



>ref|XP_004253017.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=195

 Score =   165 bits (417),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD+FLSFRG D R+TF+  L+ +LE+RGIH FKDD+RLE G  IS  L  AI +++F + 
Sbjct  12   YDIFLSFRGEDTRRTFVSHLYNALEQRGIHAFKDDERLEAGQSISAELLKAIEDARFAVV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS+ CLEELA +++C+ +L EQ+V+P+FY V P++VR+Q   + +SF + HE 
Sbjct  72   VFSKSYASSRRCLEELAHIIKCKMEL-EQVVIPVFYDVSPSNVRHQNSPFADSFFQ-HEV  129

Query  521  IGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
              KDD EKV+RW+ A  +AG+L GYHL N
Sbjct  130  EYKDDMEKVQRWRGAFAEAGKLSGYHLLN  158



>ref|XP_004237202.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1251

 Score =   177 bits (449),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 122/171 (71%), Gaps = 6/171 (4%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++GI+TFKDDD+LEKGD IS  L  AI ES+  
Sbjct  21   WSYDVFLSFRGKDVRKTFVDHLYVALQQKGINTFKDDDKLEKGDSISPGLARAIEESRIA  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA S WCL+E+  +MEC+ K+K+QIV+PIFY V+P+ VR QK S+E +F +  
Sbjct  81   LIIFSKNYAESSWCLDEVVKIMECK-KVKKQIVIPIFYDVDPSTVRKQKSSFEEAFNKYE  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARL  667
            + I     KV++W+ AL +A  L G+ L N  N +EA   + +  DI ARL
Sbjct  140  DCI-----KVQKWRGALEEAANLSGWDLPNTSNAHEAIVIKQIVEDIMARL  185



>ref|XP_006371051.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
 gb|ERP48848.1| hypothetical protein POPTR_0019s02990g, partial [Populus trichocarpa]
Length=212

 Score =   165 bits (418),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L++ GIHTF+DDD L +G+ IS+ L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYAALDQAGIHTFRDDDELPRGEEISEHLLKAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>emb|CBI17021.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W +DVFLSFRG D R  F D L+ +L  +GI TF+DD +L++G+ I+  L   I ES+  
Sbjct  15   WNHDVFLSFRGEDTRYKFTDHLYAALVNKGIRTFRDD-KLKRGEEIAPLLLKVIEESRLS  73

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YASS+WCL+EL  +MEC++K++ QI+VPIFYHV+P+D+R QKGS+E SF   H
Sbjct  74   IVVFSENYASSRWCLDELVKIMECRQKIR-QILVPIFYHVDPSDLRTQKGSFEKSFAS-H  131

Query  515  EKIGKDD-EKVRRWKEALNKAGQLKGYHLKNDY  610
            E+ G+D  EK++RW+ AL +A  L G+HL   Y
Sbjct  132  ERHGRDSKEKIQRWRAALTEASNLSGWHLFEGY  164



>ref|XP_006342406.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=282

 Score =   166 bits (420),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D  + F+  L+ +LE+RGI TFKDD+RLE G  IS  L  AI+ESKF I 
Sbjct  12   YDVFLSFRGEDTCRNFVSHLYNALEQRGIRTFKDDERLETGKSISDELLKAIQESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YASS+WCLEELA +++C+++L EQIV+P+FY V  +DV +Q   + +SF +  EK
Sbjct  72   IFSKSYASSRWCLEELAHIIKCKKEL-EQIVIPVFYDVSQSDVCHQHPPFADSFLQHEEK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EKV+RW  A  +AG++ GYHL+N
Sbjct  131  CKDDMEKVQRWTGAFAEAGKISGYHLQN  158



>ref|XP_007221062.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
 gb|EMJ22261.1| hypothetical protein PRUPE_ppa016235mg [Prunus persica]
Length=237

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 108/151 (72%), Gaps = 2/151 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q WTYDVFLS+RG D RKTFID L+ +L+R+GIHTF DD+ L +G+ IS +L NAI ESK
Sbjct  29   QSWTYDVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE-LPRGEEISPALLNAIEESK  87

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              + VFS+ YASS WCL+EL  ++E + K K+Q+V+PIFY V+P+DVRNQ+ S+ ++  +
Sbjct  88   ISVIVFSENYASSSWCLDELVKILEYK-KSKQQLVMPIFYKVDPSDVRNQRSSFGDALVD  146

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
               K   D EKV  W+ AL +A  L G H K
Sbjct  147  HEHKFKDDMEKVLEWRRALTEAANLSGLHFK  177



>ref|XP_011462237.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   163 bits (412),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 3/153 (2%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q WTYDVFLSFRG D R  F+  L  +L R+GI TF DDD L +G  IS  L  AI ESK
Sbjct  19   QSWTYDVFLSFRGDDTRNNFVAHLHSNLIRKGIRTFLDDDGLRRGVEISSELHKAIEESK  78

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              I VFS+ YASSKWCLEEL  ++EC+E  K+Q+V P+FY V+P+DVRNQ GS+  +  +
Sbjct  79   VSIVVFSETYASSKWCLEELVKILECKES-KKQMVYPVFYKVDPSDVRNQNGSFGKALAD  137

Query  509  LHEKIGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
             HE   KD  EKV RW+EAL KA  L G H  +
Sbjct  138  -HECTFKDRLEKVVRWREALTKAANLSGLHFSD  169



>ref|XP_010058913.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R G++TF+D + L+KGD IS  L NAI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHRDGVYTFRDSEELKKGDQISPVLMNAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ S      K
Sbjct  71   VFSEDYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPREVRGGRKSYQRSLARHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            +GKD EKV+R+K+AL+ AG L G+HL +
Sbjct  130  LGKDSEKVKRYKKALSDAGNLSGWHLND  157



>ref|XP_009794563.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=166

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 108/153 (71%), Gaps = 4/153 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++GIHTFKDD++LE+G  IS  L  AI ES+  
Sbjct  17   WSYDVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDEKLERGKSISPDLTRAIEESRIA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S WCL+EL  +MEC  K K QIV+P+FY V+P+ VR QK S+  +F   H
Sbjct  77   LIIFSKNYANSTWCLDELMKIMECN-KQKGQIVLPVFYDVDPSTVRKQKSSFGEAFSS-H  134

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E  G    K+++W+ AL +A  L G+ L N  N
Sbjct  135  EARGC--FKLQKWRAALVEAANLSGWDLPNTAN  165



>ref|XP_010056818.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L + GI+TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHQIGIYTFRDSEELKKGDQISPVLMKAIEESYIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS  YASS WCLEE+A ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSMNYASSMWCLEEVAKIIECKEQ-KNLIVLPVFYKVDPREVRGVRKSYQRALAKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL+ AG L G+HL +
Sbjct  130  FGKDSEKVKRWKEALSNAGNLSGWHLND  157



>ref|XP_006342412.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum tuberosum]
Length=378

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD FLSFRG D+R+TF+  L  +L + GI+ FKDD+RLE G  IS  LP AI ESKF I 
Sbjct  12   YDAFLSFRGVDIRRTFVSHLHNALIQGGINVFKDDERLETGKLISDELPKAIEESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASSKWCL+ELA +++C+++L +QIV+PIFY+V+P+DVR+Q  ++  SF +  EK
Sbjct  72   IFSESYASSKWCLDELAHIIKCRKEL-DQIVIPIFYNVDPSDVRHQTQTFAESFTKHEEK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EK++RW++A  ++G++ G+HL+N
Sbjct  131  YKDDMEKIQRWRDAFAESGKIVGHHLQN  158



>ref|XP_011015315.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1140

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 121/176 (69%), Gaps = 1/176 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D L+ +L + GIHTF+DD+ L +G+ IS  L  AI  S+  
Sbjct  21   WNYDVFLSFRGKDTRKNFTDHLYTALIQAGIHTFRDDNELPRGEEISPQLLKAIEGSRIS  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS+WCL+EL  ++EC++ + +Q+V+PIFY  EP+DVR Q GSY  +F EL 
Sbjct  81   IVVFSKNYASSRWCLDELVKIIECKQNI-DQVVLPIFYDTEPSDVRKQTGSYAKAFDELE  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHASL  682
            E+  ++ EKV +W+ AL +AG L G+ L N+ N YEA   + + +D+  +L + +L
Sbjct  140  ERFKEEMEKVNKWRGALAQAGNLSGFGLNNEANGYEAEFIKRIVSDVACKLGNKTL  195



>ref|XP_006441742.1| hypothetical protein CICLE_v10024129mg [Citrus clementina]
 gb|ESR54982.1| hypothetical protein CICLE_v10024129mg [Citrus clementina]
Length=238

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RK+FI  L+ +L  +GI+ FKDD  LEKG+ IS  L  AI  S+  
Sbjct  12   WTYDVFLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELEKGESISPRLLKAIEASRIA  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS WCL+EL  +++C+ K  +++V PIFY VEPT VRNQ G+++ +F +  
Sbjct  72   IIVFSKNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHV  131

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
            E   K  EKV++W+EAL +   + G+ LK
Sbjct  132  EVFKKSIEKVQKWREALKEVATISGWELK  160



>ref|XP_002310389.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
 gb|EEE90839.2| hypothetical protein POPTR_0007s00600g [Populus trichocarpa]
Length=1113

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ ISQ L  AI+ESK  
Sbjct  13   WAYDVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISQHLLEAIQESKIC  72

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSKGYASS+WCL+EL  +++C+ +   QI +PIFY ++P+DVR Q GS+  +F + H
Sbjct  73   IVVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVK-H  131

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E+  + +EKV+ W+EAL +AG L G++LK+  N
Sbjct  132  EE--RSEEKVKEWREALEEAGNLSGWNLKDMTN  162



>emb|CAC95120.1| TIR/NBS/LRR protein [Populus deltoides]
Length=216

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYDVFLSFRG D R TF D L+ +L + GIHTF+DDD L +G+ IS  L  AI+ESK  I
Sbjct  50   TYDVFLSFRGEDTRHTFTDHLYTALIQAGIHTFRDDDELPRGEEISDHLIRAIQESKISI  109

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  110  VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  169

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  170  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  199



>emb|CDP14589.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 122/175 (70%), Gaps = 9/175 (5%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D R+ F+ +LF++L  +GI+T+KDD RLEKG  IS  L  AI+ES F 
Sbjct  36   WTYDVFLSFRGEDTRRNFVAYLFQALCNKGIYTYKDDQRLEKGKSISPELLQAIQESLFS  95

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSKGYAS  WCLEEL  +MEC + +  Q V+PIFY V+P+DVR Q+ S+ ++F + H
Sbjct  96   VIIFSKGYASLTWCLEELVKIMECHQIIG-QFVLPIFYDVDPSDVRKQRNSFADAFAK-H  153

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN--DYNeyeaxcaexvaaDIHARLNH  673
            E+  +  EKV++WKEAL++A  L G+H  N  D N       E +  D+H++L+H
Sbjct  154  ER-DQSPEKVQKWKEALSQAAGLSGWHSCNFSDDN----ELVEKLVQDLHSQLHH  203



>gb|ABF81471.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1368

 Score =   172 bits (437),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ ISQ L  AI+ESK  
Sbjct  119  WAYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISQHLLEAIQESKIC  178

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSKGYASS+WCL+EL  +++C+ +   QI +PIFY ++P+DVR Q GS+  +F + H
Sbjct  179  IVVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVK-H  237

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E+  + +EKV+ W+EAL +AG L G++LK+  N
Sbjct  238  EE--RSEEKVKEWREALEEAGNLSGWNLKDMTN  268



>ref|XP_010323796.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=160

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD+FLSF G D R+TF+  L+ +LE+RGIH FKDD+RLE G  I   L  AI +++F + 
Sbjct  12   YDIFLSFGGEDTRRTFVSHLYNALEQRGIHAFKDDERLEAGQSIFAELLKAIEDARFAVV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YASS+WCLEEL  +++C+ +L EQ V+P+FY V P DVR+Q     +SF +   K
Sbjct  72   IFSKSYASSRWCLEELVHIIKCKNEL-EQAVIPVFYDVSPADVRHQNSPSVDSFFQHEVK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EKV+RW+ A  +AG + GYHL N
Sbjct  131  YKDDMEKVQRWRGAFAEAGNISGYHLLN  158



>ref|XP_009630491.1| PREDICTED: uncharacterized protein LOC104120435 [Nicotiana tomentosiformis]
Length=1980

 Score =   172 bits (436),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +2

Query  155   WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
             W+YDVFLSFRG DVRKTF+D L+ +L++RGIHTFKDD++LE+G  IS  L  AI E++  
Sbjct  1175  WSYDVFLSFRGEDVRKTFVDHLYVALQQRGIHTFKDDEKLERGKSISPDLIRAIEEARIA  1234

Query  335   IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
             + +FSK YA SKWCL+EL  +MEC ++ K QIV+P+FY V+P+ VR QK S+  +F   H
Sbjct  1235  LIIFSKNYADSKWCLDELMKIMECNKQ-KGQIVLPVFYDVDPSTVRKQKSSFGEAFSN-H  1292

Query  515   EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E     D KV +W+ AL +A  L G+ L N  N +EA   + +  DI A+L 
Sbjct  1293  EISCFKDNKVEKWRAALEEAANLSGWDLPNTANVHEAKVIKQIVEDIMAKLG  1344


 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 118/172 (69%), Gaps = 1/172 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRK F+D L+ +L+++GIHTFKDD++LE+G  IS +L  AI ES+  
Sbjct  16   WSYDVFLSFRGEDVRKKFVDHLYVALQQKGIHTFKDDEKLERGKSISPNLMRAIEESRIA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S+WCL+EL  +MEC+  LK QIV P+FY V+P+ VR QK S+  +F    
Sbjct  76   LIIFSKNYANSRWCLDELVKIMECK-NLKGQIVFPVFYDVDPSTVRKQKSSFGEAFSNHE  134

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             +    D K+++W+ AL +A  L G  L+N  N +EA   + +  D+ A+L 
Sbjct  135  ARGCIKDNKLQKWRAALEEAANLSGCDLRNTANAHEAKVIKQIVEDMMAKLG  186



>ref|XP_009599523.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599524.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599525.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
 ref|XP_009599526.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1398

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            + W YDVFLSFRG D RK F+  L+ +L++RGI  FKDD+RLE G  IS  L  AI +S+
Sbjct  8    KDWKYDVFLSFRGEDTRKNFVSHLYNALKQRGIDVFKDDERLETGKPISDELLKAIEDSR  67

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F + +FSK YASS+WCLEELA +++CQ +L EQ V+PIFY V P+DVR+Q   +  SF +
Sbjct  68   FAVVIFSKSYASSRWCLEELAHIIKCQNEL-EQTVIPIFYDVSPSDVRHQNPPFAESFSQ  126

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              EK   D EKV+RW++A  +AG+L G+ LKN
Sbjct  127  HEEKYKDDMEKVQRWRDAFAEAGKLSGHDLKN  158



>ref|XP_009613120.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613121.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613122.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613123.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009613124.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1421

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 112/151 (74%), Gaps = 3/151 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F+  L+ +LE+RGIH FKDD+RLE G  IS  L  AI ES+F 
Sbjct  30   WKYDVFLSFRGEDTRKNFVSHLYNALEQRGIHAFKDDERLETGKSISVELLKAIEESRFA  89

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YASSKWCLEELA +++C+ +L +QIV+PIFY V P+ VR+Q   +  SF + H
Sbjct  90   VVIFSKRYASSKWCLEELAHIIKCRNEL-DQIVLPIFYDVSPSVVRHQNPPFTKSFSK-H  147

Query  515  EKIGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
            E+  KDD EKV+RW++A  +AG+L G+ LKN
Sbjct  148  EETYKDDKEKVQRWRDAFAEAGKLSGHDLKN  178



>ref|XP_006371043.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
 gb|ERP48840.1| hypothetical protein POPTR_0019s029202g, partial [Populus trichocarpa]
Length=270

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  A++ESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K + QI +PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVAILKCKRKKRGQIALPIFYDIDPSDVRKQNGSFAEAFVKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  134  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  163



>ref|XP_006342413.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A6-like [Solanum tuberosum]
Length=377

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD FLSFRG D+R+TF+  L+ +L +  I+ FKDD+RLE G  IS  LP AI ESKF I 
Sbjct  12   YDAFLSFRGVDIRRTFVSHLYNALIQGRINVFKDDERLETGKSISDELPKAIEESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASSKWCL+ELA +++C+++  + IV+PIFY+V+P+DVR+Q  ++  SF +  EK
Sbjct  72   IFSESYASSKWCLDELAHIIKCRKEF-DLIVIPIFYNVDPSDVRHQTQTFAESFSKHEEK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EK++RW++A  ++G++ GYHL+N
Sbjct  131  YKDDMEKIQRWRDAFAESGKISGYHLQN  158



>ref|XP_010041655.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=160

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRGPDVR  F+  L+ +L++ GI+T+ D++ L+KG+ IS +L  AI ES+  I
Sbjct  12   SYDVFLSFRGPDVRNHFLGHLYTALDQTGIYTYIDNEELKKGEQISPALMKAIEESRIAI  71

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCLEE+A VMEC+ + K  +V P+FY VEP +VR Q+ SY  +  +   
Sbjct  72   VVFSEDYASSPWCLEEVAKVMECRGERK-LMVFPVFYKVEPREVRGQRQSYAEAMAKHEV  130

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV+RW++AL  AG L G+H  +
Sbjct  131  KFGKDSEKVKRWRKALFDAGSLSGWHFTD  159



>ref|XP_006371055.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
 gb|ERP48852.1| hypothetical protein POPTR_0019s03015g [Populus trichocarpa]
Length=512

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 109/152 (72%), Gaps = 1/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF+D L+ +L + GIHTF+DDD L +G+ IS+ L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFVDHLYTALVQAGIHTFRDDDELPRGEEISEHLLEAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GS+  +F + HE
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDK-HE  132

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  133  EERFEEKLVKEWRKALEDAGNLSGWSLNDMAN  164



>gb|KDO38417.1| hypothetical protein CISIN_1g036738mg, partial [Citrus sinensis]
Length=364

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RK FI  L+ +L  +GI+ FKDD+ LEKG+ IS  L  AI  S+  
Sbjct  12   WTYDVFLSFRGADTRKNFISHLYAALNGKGIYVFKDDEELEKGESISPRLLKAIEASRIA  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS WCL+EL  +++C+ K  +++V PIFY VEPT VRNQ G+++ +F +  
Sbjct  72   IIVFSKNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHV  131

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
            E   K  EKV++W+EAL +   + G+ LK
Sbjct  132  EVFKKSIEKVQKWREALKEVANISGWELK  160



>ref|XP_009791999.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=340

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RKTF+  L   L R GI+TFKDD+ LE+G  IS  L +AI+ S+F 
Sbjct  15   WDYDVFLSFRGEDTRKTFVAHLNRELCRAGINTFKDDETLERGASISPQLISAIKRSRFA  74

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I +FSK YASSKWCL+EL  +MEC+ ++  Q VVPIFY + P++VR+Q+ S+  +F +  
Sbjct  75   IIIFSKNYASSKWCLDELVKIMECRNEIG-QAVVPIFYDINPSEVRSQRNSFAEAFSKYE  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHL  598
            E+   D  KV  W++ALNKA  L G+ L
Sbjct  134  EEFKGDTNKVHSWRKALNKAANLAGHDL  161



>ref|XP_010070519.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=231

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRGPDVR  F+  L+ +L++ GI T+ D++ L KG+ IS +L  AI ES+  I 
Sbjct  73   YDVFLSFRGPDVRNHFLSHLYAALDQVGISTYIDNEELRKGEQISPALMKAIEESQIAIV  132

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCLEE++ +MEC+EK K  +V+P+FY VEP +VR QK SY  +  E   K
Sbjct  133  VFSENYASSTWCLEEISKIMECKEK-KGLMVLPVFYKVEPREVRGQKQSYGKAMGEHEVK  191

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
             GK+ E+V+RWK+AL  AG L G+   + Y
Sbjct  192  FGKNSEQVKRWKKALYDAGGLSGWPYTDGY  221



>ref|XP_010057031.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   156 bits (395),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L   G++TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGADLRNNFIGHLYQALHHNGVYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P++VR  + SY+ S  +   K
Sbjct  71   VFSEDYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPSEVREGRKSYQRSLAKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              KD EKV+RWK+AL  AG L G+HL +
Sbjct  130  FRKDSEKVKRWKKALFDAGNLSGWHLND  157



>ref|XP_006342678.1| PREDICTED: uncharacterized protein LOC102595828 [Solanum tuberosum]
Length=766

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 111/149 (74%), Gaps = 7/149 (5%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D R+ F+  L+ SLE RGI TFKDD+RLE G  IS  L  AI+ESKF I 
Sbjct  12   YDVFLSFRGEDTRRNFVSHLYNSLELRGIRTFKDDERLETGKSISDDLLKAIQESKFSIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YASS+WCL+ELA +++C+++L EQIV+P+FY V P+DVR+Q   +++SF +    
Sbjct  72   IFSKSYASSRWCLKELAHIIKCKKEL-EQIVIPVFYDVSPSDVRHQNPPFDDSFSQ----  126

Query  521  IGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
              KDD EKV+RW+ A  +AG++ GYHL N
Sbjct  127  -HKDDMEKVQRWRGAFVEAGKISGYHLLN  154



>ref|XP_006360469.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1239

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 121/171 (71%), Gaps = 6/171 (4%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++GI+TFKD ++LEKG+ IS  L  AI ES+  
Sbjct  22   WSYDVFLSFRGEDVRKTFVDHLYVALQQKGINTFKDSEKLEKGNSISPGLMRAIEESRIS  81

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S+WCL+E+A +MEC+  +K QIV+P+FY V+P+ VR QK S+E +F    
Sbjct  82   LIIFSKNYANSRWCLDEVAKIMECK-NVKGQIVIPVFYDVDPSTVRKQKSSFEEAFNNY-  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARL  667
                +D  KV++W+ AL +A  L G+ L N  N +EA   + +  DI ARL
Sbjct  140  ----EDCFKVQKWRGALEEAANLSGWDLPNTSNAHEAIVIKQIVEDIMARL  186



>gb|KCW59235.1| hypothetical protein EUGRSUZ_H01903, partial [Eucalyptus grandis]
Length=158

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +Y VFLSFRGPDVR  F+  L+ +L + GI+T+KDD+ L KG+ IS  L  AI ES+  I
Sbjct  11   SYHVFLSFRGPDVRNYFLGHLYTALNQAGINTYKDDEELRKGEHISTELQKAIEESRIAI  70

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCL+EL  +MEC+E+ +  +V P+FY VEP +VR  + SY     +  +
Sbjct  71   VVFSEHYASSTWCLKELGKIMECKEQ-RHLMVYPVFYKVEPCEVRTPRESYLQDMAKHED  129

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV+RWK+AL  AG L G+H  +
Sbjct  130  KFGKDSEKVKRWKKALLDAGSLSGWHFTD  158



>ref|XP_010070448.1| PREDICTED: TMV resistance protein N-like isoform X2 [Eucalyptus 
grandis]
Length=160

 Score =   156 bits (394),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +Y VFLSFRGPDVR  F+  L+ +L + GI+T+KDD+ L KG+ IS  L  AI ES+  I
Sbjct  11   SYHVFLSFRGPDVRNYFLGHLYTALNQAGINTYKDDEELRKGEHISTELQKAIEESRIAI  70

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCL+EL  +MEC+E+ +  +V P+FY VEP +VR  + SY     +  +
Sbjct  71   VVFSEHYASSTWCLKELGKIMECKEQ-RHLMVYPVFYKVEPCEVRTPRESYLQDMAKHED  129

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV+RWK+AL  AG L G+H  +
Sbjct  130  KFGKDSEKVKRWKKALLDAGSLSGWHFTD  158



>ref|XP_009628589.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1364

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L+ +L+ +G+HTFKDD RLE+G  IS  L  AI +S+
Sbjct  9    QNWKNDVFLSFRGKDTRKTFVGHLYYALKHKGVHTFKDDVRLERGKSISPELVKAIEQSR  68

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +M+C+++L  Q V+PIFY V+P+DV  Q G++  SF  
Sbjct  69   FAIVVFSKNYASSTWCLDELVKIMKCKKELG-QTVIPIFYDVDPSDVSKQSGTFAESFAR  127

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHAS  679
              E    D EKV+ W++A  +AG+  GY L N Y+ YE+ C + V  DI  +L   +
Sbjct  128  HEENFRDDLEKVQSWRDAFGEAGKTAGYDLPNGYDGYESNCIQHVVEDILGKLCQVT  184



>ref|XP_011012882.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=1103

 Score =   168 bits (426),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D L+ +L+  GIHTF+DD+ L KG+ IS  L  AI+ESK 
Sbjct  16   GWHYDVFLSFRGEDTRKNFTDHLYTALQNAGIHTFRDDNELPKGEEISSHLLKAIKESKI  75

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL+ +++C++    QIV+P+FY ++P+D+R Q GS+  +F   
Sbjct  76   SIVVFSKGYASSTWCLDELSEILDCRQT-AGQIVLPVFYDIDPSDIRKQTGSFAEAFDRH  134

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E+  ++ EKV++W++AL +AG+L G  L +  N +E+   + +  ++ ++LN
Sbjct  135  EERFKEEMEKVQKWRKALVEAGRLSGLDLHSIANGHESRLIQMIVEEVLSKLN  187



>pdb|3OZI|A Chain A, Crystal Structure Of The Tir Domain From The Flax Disease 
Resistance Protein L6
 pdb|3OZI|B Chain B, Crystal Structure Of The Tir Domain From The Flax Disease 
Resistance Protein L6
Length=204

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            Y+VFLSFRGPD R+ F DFL++SL R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct  36   YEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVP  95

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G Y+ +F++   K
Sbjct  96   IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK  155

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHL-KND  607
               D + ++ WK+AL K G LKG+H+ KND
Sbjct  156  F--DGQTIQNWKDALKKVGDLKGWHIGKND  183



>ref|XP_010026339.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=178

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 106/154 (69%), Gaps = 5/154 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG DVR  F+  L+ +L + GI+T+ D++ L+KG+ IS +L  AI+ES+  I 
Sbjct  17   YDVFLSFRGTDVRNYFLGHLYTALVQNGINTYMDNEDLKKGEQISLALMEAIKESQMAIV  76

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL---  511
            VFSK YASS WCLEE+A +MEC+EK +  +V P+FY VEP +VR QK  Y   + E+   
Sbjct  77   VFSKDYASSTWCLEEVAKIMECKEK-RGLMVFPVFYKVEPREVRGQKQDYGEDYGEVMAK  135

Query  512  HE-KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            HE K GKD EKV+RWK+AL   G L G H  + Y
Sbjct  136  HEVKFGKDSEKVKRWKKALLDVGNLSGLHFVDGY  169



>ref|XP_009628590.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1337

 Score =   168 bits (426),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L+ +L+ +G+HTFKDD RLE+G  IS  L  AI +S+
Sbjct  9    QNWKNDVFLSFRGKDTRKTFVGHLYYALKHKGVHTFKDDVRLERGKSISPELVKAIEQSR  68

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +M+C+++L  Q V+PIFY V+P+DV  Q G++  SF  
Sbjct  69   FAIVVFSKNYASSTWCLDELVKIMKCKKELG-QTVIPIFYDVDPSDVSKQSGTFAESFAR  127

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHAS  679
              E    D EKV+ W++A  +AG+  GY L N Y+ YE+ C + V  DI  +L   +
Sbjct  128  HEENFRDDLEKVQSWRDAFGEAGKTAGYDLPNGYDGYESNCIQHVVEDILGKLCQVT  184



>ref|XP_011044953.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=542

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D L+ +L + GIHTF+DD+ L KG+ IS  L  AI+ESK 
Sbjct  11   GWHYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSHLLKAIQESKI  70

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL+ +++C++    QIV+P+FY ++P+D+R QK S+  +F   
Sbjct  71   SIVVFSKGYASSTWCLDELSEILDCRQT-AGQIVLPVFYDIDPSDIRKQKRSFAEAFDRH  129

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E   ++ EKV++W++AL +AG+L G+ L +  N +E+   + +  ++ ++LN
Sbjct  130  EELFKEEMEKVQKWRKALVEAGRLTGFDLHSIANGHESKLIQMIVEEVLSKLN  182



>gb|KCW74266.1| hypothetical protein EUGRSUZ_E02914 [Eucalyptus grandis]
Length=518

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHRIGIYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSENYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPKEVRGGRKSYQRALAKHKSK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL  AG L G+HL +
Sbjct  130  FGKDSEKVKRWKEALFDAGNLSGWHLND  157



>ref|XP_010650374.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=639

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R  F D L+ +L RRGIHTF+DDD L++G+ I+  L  AI ES+F 
Sbjct  18   WKYDVFLSFRGEDTRFNFTDHLYANLIRRGIHTFRDDDSLKRGEEIAPELLKAIEESRFS  77

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YA S+WCL+EL  +MEC++++K Q VVPIFYHV+P+ VRNQ G +  +F    
Sbjct  78   LIVFSENYAGSRWCLDELVKIMECKKEMK-QTVVPIFYHVDPSHVRNQTGRFGEAFSYYK  136

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            E   +  EKVR W+ AL +A    G H+K+ Y
Sbjct  137  EDTEEMKEKVRSWRSALTEAANTSGEHVKDGY  168



>ref|XP_010070447.1| PREDICTED: TMV resistance protein N-like isoform X1 [Eucalyptus 
grandis]
Length=163

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +Y VFLSFRGPDVR  F+  L+ +L + GI+T+KDD+ L KG+ IS  L  AI ES+  I
Sbjct  11   SYHVFLSFRGPDVRNYFLGHLYTALNQAGINTYKDDEELRKGEHISTELQKAIEESRIAI  70

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCL+EL  +MEC+E+ +  +V P+FY VEP +VR  + SY     +  +
Sbjct  71   VVFSEHYASSTWCLKELGKIMECKEQ-RHLMVYPVFYKVEPCEVRTPRESYLQDMAKHED  129

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV+RWK+AL  AG L G+H  +
Sbjct  130  KFGKDSEKVKRWKKALLDAGSLSGWHFTD  158



>ref|XP_006380260.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
 gb|ERP58057.1| hypothetical protein POPTR_0007s00620g, partial [Populus trichocarpa]
Length=470

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 117/171 (68%), Gaps = 3/171 (2%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L  +L + GIHTF+DDD L +G+ IS  L  AIRESK   
Sbjct  42   AYDVFLSFRGEDTRKTFTDHLHTALVQAGIHTFQDDDELPRGEEISDHLLKAIRESKIST  101

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+++   QI +PIFY ++P+DVR Q GS+  +F + HE
Sbjct  102  VVFSKGYASSRWCLNELVEILKCRKRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVK-HE  160

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
            +  K  EKV+ W+E L +AG L G++LK+  N +EA   + +  D+  +L+
Sbjct  161  ERSK--EKVKEWRETLEEAGNLSGWNLKDMANGHEAKFIQEIIKDVLTKLD  209



>ref|XP_011044910.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=787

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 121/173 (70%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D L+ +L + GIHTF+DD+ L KG+ IS  L  AI+ESK 
Sbjct  11   GWHYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSHLLKAIQESKI  70

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL+ +++C +    QIV+P+FY ++P+D+R QK S+  +F   
Sbjct  71   SIVVFSKGYASSTWCLDELSEILDCSQT-AGQIVLPVFYDIDPSDIRKQKRSFAEAFDRH  129

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E+  ++ EKV++W++AL +AG+L G+ L +  N +E+   + +  ++ ++LN
Sbjct  130  EERFKEEMEKVQKWRKALVEAGRLTGFDLHSIANGHESKLIQMIVEEVLSKLN  182



>ref|XP_006367018.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=156

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 105/149 (70%), Gaps = 7/149 (5%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D R+TF+  L ++LE+ GI  FKDD+RLE G  IS  L  AI ESK  I 
Sbjct  12   YDVFLSFRGEDTRRTFVSHLHKALEQSGICIFKDDERLETGKSISNELLKAIEESKIAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK Y SS+WCLEELA +++C+ +L E IV+P+FY V P+DVR+Q   + +SF +    
Sbjct  72   IFSKSYESSRWCLEELAHIIKCKNEL-ELIVIPVFYDVTPSDVRHQNTPFADSFLQY---  127

Query  521  IGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
              KDD +KV+RW+ A  +AG++ GYHL N
Sbjct  128  --KDDMDKVQRWRAAFVEAGKIAGYHLLN  154



>ref|XP_007134526.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 ref|XP_007134527.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06520.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06521.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
Length=185

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 104/152 (68%), Gaps = 4/152 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R TF DFLF SL  +GI+ FKDD+ L+KG+ I+  L  AI+ S+ FI 
Sbjct  21   YDVFVSFRGEDTRNTFTDFLFHSLRTKGINVFKDDEDLKKGESIAPELLQAIQVSRLFIV  80

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCL ELA +  C E     +++PIFY V+P+ VR Q G YE +F E  ++
Sbjct  81   VFSENYASSTWCLRELAEICNCCET-SPSVIIPIFYDVDPSVVRKQSGRYEKAFAEHEKR  139

Query  521  IGKDD---EKVRRWKEALNKAGQLKGYHLKND  607
             G+D+   E+V+RW++AL +   + G+ ++N+
Sbjct  140  FGEDEVKMEEVQRWRQALTQVANISGWDIRNN  171



>ref|XP_009790280.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=826

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            + W YDVFLSFRG D RKTF+  L+  L R GI+TFKDD+ LE+G  IS  L NAI+ S+
Sbjct  13   EQWDYDVFLSFRGEDTRKTFVAHLYRELRRAGINTFKDDETLERGASISPQLVNAIKRSR  72

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I +FSK YASSKWCL+EL  +MEC+ ++  Q V+PIFY + P++VR+Q+ S+  +F +
Sbjct  73   FAIIIFSKNYASSKWCLDELVKIMECRNEIG-QAVIPIFYDINPSEVRSQRNSFAEAFSK  131

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHL-KNDYN  613
              E+   D  KV  W++ALNKA  L G+ L    YN
Sbjct  132  YEEEFKGDTNKVHSWRKALNKAANLAGHDLHSTTYN  167



>ref|XP_006441888.1| hypothetical protein CICLE_v10023769mg [Citrus clementina]
 gb|ESR55128.1| hypothetical protein CICLE_v10023769mg [Citrus clementina]
Length=158

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L+ SL R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  11   YDVFVSFRGEDTRDNFTSHLYSSLSRQNIQTFIDD-QLNRGDEISESLVNAIEASAVSVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC+++   QIV+P+FY V+P+D RNQ G +  SF +L E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKEYA-QIVIPVFYRVDPSDARNQTGPFGISFSKLEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              ++ EK+R W++AL +A  L G+H  N
Sbjct  129  FKENTEKLRTWRKALKEAASLSGFHSLN  156



>ref|XP_006367324.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=871

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 113/149 (76%), Gaps = 7/149 (5%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD+FLSFRG D R+TF+  L+++LE+RGIHTFKDD+ LE G  IS  L  AI +++F + 
Sbjct  17   YDIFLSFRGEDTRRTFVSHLYKALEQRGIHTFKDDEWLEAGKSISAELLKAIEDARFAVV  76

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YASS+WCLEELA +++C+++L EQIV+P+FY V P+DVR+Q   + +SF +    
Sbjct  77   IFSKSYASSRWCLEELAHIIKCKKEL-EQIVIPVFYDVSPSDVRHQNPPFADSFSQ----  131

Query  521  IGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
              KDD EKV+RW++A  +AG++ GYHL N
Sbjct  132  -HKDDMEKVQRWRDAFVEAGKISGYHLLN  159



>ref|XP_006441884.1| hypothetical protein CICLE_v10024486mg, partial [Citrus clementina]
 gb|ESR55124.1| hypothetical protein CICLE_v10024486mg, partial [Citrus clementina]
Length=148

 Score =   155 bits (391),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 102/145 (70%), Gaps = 2/145 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L+ +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  2    YDVFVSFRGEDTRDNFTSHLYSALSRQNIQTFIDD-QLNRGDEISESLGNAIEASAISVI  60

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASS+WCL+EL  ++EC+++   QI++P+FY V+P+DVRNQ GS+ NSF +L E+
Sbjct  61   IFSESYASSRWCLDELVKILECKKEYA-QILIPVFYRVDPSDVRNQTGSFGNSFSKLEER  119

Query  521  IGKDDEKVRRWKEALNKAGQLKGYH  595
              ++ EK+R W+  L +A  L G+H
Sbjct  120  SKENTEKLRSWRTVLKEAASLSGFH  144



>gb|ABF81468.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1021

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D LF +L++ GI TF+DDD L  G+ IS  LP AI+ESK 
Sbjct  36   GWVYDVFLSFRGEDTRKNFTDHLFTALQKAGIRTFRDDDELRIGEEISFQLPKAIQESKI  95

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL  +++C++    QIV+P+FY ++P+D+R Q GS+  +F   
Sbjct  96   SIVVFSKGYASSTWCLDELEKILDCRQPTG-QIVLPVFYDIDPSDIRKQTGSFAEAFDRH  154

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E+  ++ EKV++W++AL +A  + G  L++  N +E+   + +  ++ ++LN
Sbjct  155  EERFKEEMEKVQKWRKALVEAANISGLDLRSFANGHESKLIQKIVEEVSSKLN  207



>emb|CDP07826.1| unnamed protein product [Coffea canephora]
Length=1159

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 125/173 (72%), Gaps = 2/173 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG DVRK F+DFL+ SL+++GI+TFKDD++LE+G  IS +L  AI+ES+  
Sbjct  19   WTYDVFLSFRGEDVRKNFVDFLYSSLQQKGIYTFKDDEKLERGRSISSALLQAIKESRIA  78

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS+ YA+S WCL+ELA ++ C + L  Q ++P+FY+V+P+ VR QKGS+  +F + H
Sbjct  79   VIIFSENYAASSWCLDELAEIIYCNQALG-QTILPVFYYVDPSVVRKQKGSFGQAFVK-H  136

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNH  673
            E   +D E++RRW+ AL +A  + G+ + +  + +E+ C + +  D+  +L +
Sbjct  137  EDEIEDKERIRRWRAALAEAASISGWDVPSTADGHESKCIQQIVEDVMGKLKN  189



>ref|XP_010056575.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=540

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R G++TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGADLRNNFIGHLYQALHRDGVYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ S  +   K
Sbjct  71   VFSEDYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPREVREGRKSYQRSLAKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWK+AL+ AG L G+HL +
Sbjct  130  FGKDSEKVKRWKKALSDAGNLSGWHLND  157



>ref|XP_010058743.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=625

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D + L+KGD IS  +  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFISHLYQALHRIGIYTFRDSEELKKGDQISPVVMKAIEESCIAIT  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSENYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPKEVRGGRKSYQRALAKHKSK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL+ AG L G+HL +
Sbjct  130  FGKDLEKVKRWKEALSDAGNLSGWHLND  157



>ref|XP_010646047.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=205

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GWTYDVFLSFRG D R  F   L+  L R+GI TF+DD +L +G+ I+  L NAI +S+ 
Sbjct  18   GWTYDVFLSFRGEDTRNNFTSHLYTDLVRKGIRTFRDD-KLPRGEKIAPELLNAIEKSRS  76

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSK YA S+WCL+ELA +MEC+++ + Q V+PIFYHV+P+DVR Q G +  +F   
Sbjct  77   SIIVFSKTYADSRWCLDELAKIMECRQEYR-QKVLPIFYHVDPSDVRKQTGRFGEAFTR-  134

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
            HE+  K+  KV+ W+EAL +AG + G+H+K
Sbjct  135  HEENWKN--KVQSWREALTEAGNISGWHVK  162



>ref|XP_006389335.1| hypothetical protein POPTR_0030s00570g, partial [Populus trichocarpa]
 gb|ERP48249.1| hypothetical protein POPTR_0030s00570g, partial [Populus trichocarpa]
Length=1016

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D L+ +L+  GIHTF+DD+ L KG+ IS  L  AI+ESK 
Sbjct  16   GWHYDVFLSFRGEDTRKNFTDHLYTALQNAGIHTFRDDNELPKGEEISSHLLKAIKESKI  75

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL+ +++C++    QIV+P+FY ++P+D+R Q GS+  +F   
Sbjct  76   SIVVFSKGYASSTWCLDELSEILDCRQT-AGQIVLPVFYDIDPSDIRKQTGSFAEAFDRH  134

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
             E+  ++ EKV++W++AL +AG+L G+  K
Sbjct  135  EERFKEEMEKVQKWRKALVEAGRLSGHESK  164



>ref|XP_010058909.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=671

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D++ L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHRIGIYTFRDNEELKKGDQISPVLMKAIEESYIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS  YASS+WCLEE+A ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSVNYASSRWCLEEVAKIIECKEE-KNLIVLPVFYKVDPREVRGCRKSYQRALAKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL+ AG+L G+HL +
Sbjct  130  FGKDSEKVKRWKEALSDAGKLSGWHLND  157



>ref|XP_007134525.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
 gb|ESW06519.1| hypothetical protein PHAVU_010G054800g [Phaseolus vulgaris]
Length=205

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 104/152 (68%), Gaps = 4/152 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R TF DFLF SL  +GI+ FKDD+ L+KG+ I+  L  AI+ S+ FI 
Sbjct  21   YDVFVSFRGEDTRNTFTDFLFHSLRTKGINVFKDDEDLKKGESIAPELLQAIQVSRLFIV  80

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCL ELA +  C E     +++PIFY V+P+ VR Q G YE +F E  ++
Sbjct  81   VFSENYASSTWCLRELAEICNCCET-SPSVIIPIFYDVDPSVVRKQSGRYEKAFAEHEKR  139

Query  521  IGKDD---EKVRRWKEALNKAGQLKGYHLKND  607
             G+D+   E+V+RW++AL +   + G+ ++N+
Sbjct  140  FGEDEVKMEEVQRWRQALTQVANISGWDIRNN  171



>ref|XP_010665467.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1134

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 125/174 (72%), Gaps = 6/174 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            ++VFLSFRG D R  F D LF +L+R+GI+TF+DD RLE+G+ I+  L   I ES+  + 
Sbjct  20   FEVFLSFRGEDTRYNFTDHLFVNLDRKGINTFRDD-RLERGEEITSELLKTIEESRISVV  78

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YA SKWCL+ELA +MEC+EK+ EQIV+P+FYHV+P+DV  Q GS+  +F  +HE+
Sbjct  79   VFSKNYAHSKWCLDELAKIMECKEKM-EQIVLPVFYHVDPSDVEEQTGSFGEAFS-IHER  136

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHASL  682
               D++K++RW+ +L  A  L GYH+KND   YE+   + +A DIH +L+H  L
Sbjct  137  -NVDEKKMQRWRASLTAASNLSGYHVKND--GYESEIIKEIADDIHRKLDHKIL  187



>ref|XP_010026474.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=174

 Score =   154 bits (390),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG DVR  F+  L+ +L + GI+T+ D + L+KG+ IS +L  AI ES+  I 
Sbjct  16   YDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLKKGEKISPALMEAIEESQIAIV  75

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR Q+  Y  +  +   K
Sbjct  76   VFSKDYASSPWCLEEVAKIMECKEQ-RGLMVFPVFYKVEPREVRGQRQGYAEAMNKHEVK  134

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
             G D EKV+RWK+AL  AG L G+H  + Y
Sbjct  135  FGTDSEKVKRWKKALLDAGSLSGWHFMDGY  164



>ref|XP_006342679.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=1028

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D R+ F+  L+ SLE RGI TFKDD+RLE G  IS  L  AI+ESKF I 
Sbjct  12   YDVFLSFRGEDTRRNFVSHLYNSLELRGIRTFKDDERLETGKSISDELLKAIQESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YASS+WCL+ELA +++C+++L EQIV+P+FY V  +DV +Q   + +SF +  EK
Sbjct  72   IFSKSYASSRWCLKELAHIIKCKKEL-EQIVIPVFYDVSQSDVCHQHPPFADSFLQHEEK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EKV+RW+ A  +AG++ GYHL N
Sbjct  131  CKDDMEKVQRWRGAFVEAGKISGYHLLN  158



>emb|CAN62576.1| hypothetical protein VITISV_038321 [Vitis vinifera]
Length=1256

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 105/153 (69%), Gaps = 4/153 (3%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG D RK F D L+ SL  RGIHTF+DD+ LEKG  I+  L  AI ES+ FI
Sbjct  18   SYDVFLSFRGDDTRKNFTDHLYTSLVTRGIHTFRDDEELEKGGDIAADLSRAIEESRIFI  77

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             +FSK YA S+WCL EL  +++C  + KE +VVPIFYHV P+DVRNQ GS++ +F   HE
Sbjct  78   IIFSKNYAYSRWCLNELLKIIDCVTQ-KESMVVPIFYHVPPSDVRNQSGSFDYAFT-FHE  135

Query  518  KIG--KDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            K    K  E V +W+ AL KA  + G+H+ N Y
Sbjct  136  KDADQKKKEMVEKWRTALTKAANISGWHVXNQY  168



>gb|KCW73687.1| hypothetical protein EUGRSUZ_E02290 [Eucalyptus grandis]
Length=430

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L + GI+TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHQIGIYTFRDSEELKKGDQISPVLMKAIEESYIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS  YASS WCLEE+A ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSMNYASSMWCLEEVAKIIECKEQ-KNLIVLPVFYKVDPREVRGVRKSYQRALAKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL+ AG L G+HL +
Sbjct  130  FGKDSEKVKRWKEALSNAGNLSGWHLND  157



>ref|XP_006367169.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006367170.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=168

 Score =   154 bits (390),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 105/154 (68%), Gaps = 7/154 (5%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W +DVFLSFRG D R+TF   L+E L+ RGI TF+DD RLE+GD I + L  AI ES+  
Sbjct  17   WKFDVFLSFRGTDTRRTFTGHLYEGLKNRGIFTFQDDKRLEQGDSIPEELLKAIEESQVA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S+WCL EL  +M+C+E  + Q ++PIFY V+P+ VRNQ  S+  +F + H
Sbjct  77   LIIFSKNYATSRWCLNELVKIMKCKE--EGQTIIPIFYDVDPSHVRNQSESFAEAFAK-H  133

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD    +KV+ W+ +L  A  LKGY +++
Sbjct  134  ESTYKDDVDGMQKVQGWRTSLTAAANLKGYDIRD  167



>ref|XP_010665341.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665342.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665343.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665344.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
 ref|XP_010665346.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1630

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG D RK F D L+ SL  RGIHTF+DD+ LEKG  I+  L  AI ES+ FI
Sbjct  18   SYDVFLSFRGDDTRKNFTDHLYTSLVTRGIHTFRDDEELEKGGDIAADLSRAIEESRIFI  77

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             +FSK YA S+WCL EL  +++C  + KE +VVPIFYHV P+DVRNQ GS++ +F   HE
Sbjct  78   IIFSKNYAYSRWCLNELLKIIDCVTQ-KESMVVPIFYHVPPSDVRNQSGSFDYAFT-FHE  135

Query  518  KIG--KDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            K    K  E V +W+ AL KA  + G+H++N Y
Sbjct  136  KDADQKKKEMVEKWRTALTKAANISGWHVENQY  168



>ref|XP_006385995.1| hypothetical protein POPTR_0003s19850g, partial [Populus trichocarpa]
 gb|ERP63792.1| hypothetical protein POPTR_0003s19850g, partial [Populus trichocarpa]
Length=1354

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D LF +L++ GI TF+DDD L  G+ IS  LP AI+ESK 
Sbjct  14   GWVYDVFLSFRGEDTRKNFTDHLFTALQKAGIRTFRDDDELRIGEEISFQLPKAIQESKI  73

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL  +++C++    QIV+P+FY ++P+D+R Q GS+  +F   
Sbjct  74   SIVVFSKGYASSTWCLDELEKILDCRQP-TGQIVLPVFYDIDPSDIRKQTGSFAEAFDRH  132

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E+  ++ EKV++W++AL +A  + G  L++  N +E+   + +  ++ ++LN
Sbjct  133  EERFKEEMEKVQKWRKALVEAANISGLDLRSFANGHESKLIQKIVEEVSSKLN  185



>gb|KCW59343.1| hypothetical protein EUGRSUZ_H020322, partial [Eucalyptus grandis]
Length=220

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 103/145 (71%), Gaps = 1/145 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRGPDVR  F+  L+ +L++ GI T+ D++ L KG+ IS +L  AI ES+  I
Sbjct  72   SYDVFLSFRGPDVRNHFLSHLYAALDQVGISTYIDNEELRKGEQISPALMKAIEESQIAI  131

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCLEE++ +MEC+EK K   V+P+FY VEP +VR QK SY  +  E   
Sbjct  132  VVFSENYASSTWCLEEISKIMECKEK-KGLKVLPVFYKVEPREVRGQKQSYGKAMGEHEI  190

Query  518  KIGKDDEKVRRWKEALNKAGQLKGY  592
            K GK+ E+V+RWK+AL  AG L G+
Sbjct  191  KFGKNSEQVKRWKKALYDAGGLSGW  215



>ref|XP_008232097.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=845

 Score =   165 bits (417),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 112/152 (74%), Gaps = 4/152 (3%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q WTYDVFLS+RG D RKTFID L+ +L+R+GIHTF DD+ L +G+ IS +L NAI ESK
Sbjct  22   QSWTYDVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDE-LPRGEEISPALLNAIEESK  80

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              + VFS+ YASS WCL+EL  ++E  +K K+Q+V+PIFY V+P+DVRNQ+ S+ ++  +
Sbjct  81   ISVIVFSENYASSSWCLDELVKILE-YKKSKQQLVMPIFYKVDPSDVRNQRSSFGDALAD  139

Query  509  LHEKIGKDD-EKVRRWKEALNKAGQLKGYHLK  601
             HE+  KDD EKV  W+ AL +A  L G H K
Sbjct  140  -HERKFKDDMEKVLEWRRALTEAANLSGLHFK  170



>ref|XP_010058798.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=199

 Score =   155 bits (391),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 105/148 (71%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D R +F+  L+++L R GI+TF+D D L+KG+ IS  L  AI+ES   I 
Sbjct  11   YDVFLSFRGMDSRNSFVGHLYQALHRNGIYTFRDSDELKKGEQISM-LMKAIKESCIAII  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YAS+ WCLEE+A +MEC+E+ K+ IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  70   VFSENYASAMWCLEEVAKIMECKEQ-KDLIVLPVFYKVDPKEVRGGRKSYQKAMAKHEFK  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EK++RWK AL   G L G+HL +
Sbjct  129  FGKDSEKLKRWKTALLNVGNLSGWHLND  156



>ref|XP_009803029.1| PREDICTED: TMV resistance protein N-like isoform X3 [Nicotiana 
sylvestris]
Length=1368

 Score =   166 bits (420),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L+ +L+ +GIHTFKDD RLE+G  IS  L  AI +S+
Sbjct  9    QNWKNDVFLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRLERGKSISPELVKAIEQSR  68

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +M+C+++L    V+PIFY V+P+DV  Q G++  SF  
Sbjct  69   FAIVVFSKNYASSTWCLDELVKIMKCKKELG-LTVMPIFYDVDPSDVSKQSGTFAESFSR  127

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHAS  679
              E +  D EKV+ W++A  +AG+  GY L N Y+ YE+ C + V  DI  +L   +
Sbjct  128  HEENLRDDLEKVQCWRDAFGEAGKTAGYDLPNGYDGYESNCIQHVVEDILGKLCQVT  184



>ref|XP_009803027.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1399

 Score =   166 bits (420),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L+ +L+ +GIHTFKDD RLE+G  IS  L  AI +S+
Sbjct  9    QNWKNDVFLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRLERGKSISPELVKAIEQSR  68

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +M+C+++L    V+PIFY V+P+DV  Q G++  SF  
Sbjct  69   FAIVVFSKNYASSTWCLDELVKIMKCKKELG-LTVMPIFYDVDPSDVSKQSGTFAESFSR  127

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHAS  679
              E +  D EKV+ W++A  +AG+  GY L N Y+ YE+ C + V  DI  +L   +
Sbjct  128  HEENLRDDLEKVQCWRDAFGEAGKTAGYDLPNGYDGYESNCIQHVVEDILGKLCQVT  184



>gb|KCW59155.1| hypothetical protein EUGRSUZ_H01785 [Eucalyptus grandis]
Length=267

 Score =   157 bits (396),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 107/155 (69%), Gaps = 5/155 (3%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG DVR  F+  L+ +L + GI+T+ D++ L+KG+ IS +L  AI+ES+  I
Sbjct  105  SYDVFLSFRGTDVRNYFLGHLYTALVQNGINTYMDNEDLKKGEQISLALMEAIKESQMAI  164

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL--  511
             VFSK YASS WCLEE+A +MEC+EK +  +V P+FY VEP +VR QK  Y   + E+  
Sbjct  165  VVFSKDYASSTWCLEEVAKIMECKEK-RGLMVFPVFYKVEPREVRGQKQDYGEDYGEVMA  223

Query  512  -HE-KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
             HE K GKD EKV+RWK+AL   G L G H  + Y
Sbjct  224  KHEVKFGKDSEKVKRWKKALLDVGNLSGLHFVDGY  258



>ref|XP_010650303.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=169

 Score =   154 bits (388),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 103/149 (69%), Gaps = 2/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             +DVFLSFRG D R  F D L+E+L RRGIHTF+DD  LE+G+ I   L  AI ES+F +
Sbjct  21   NFDVFLSFRGEDTRFNFTDHLYENLIRRGIHTFRDDS-LERGEEIEPELLKAIEESRFSL  79

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YA S+WCL+EL  +M+C++++K Q VVPIFYHV+P+ VRNQ G +  +F    E
Sbjct  80   IVFSENYAGSRWCLDELVKIMKCRKEMK-QTVVPIFYHVDPSHVRNQTGKFGEAFSNYKE  138

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               +  EKVR W+ AL +A  + G H+K+
Sbjct  139  DSEEMKEKVRSWRSALTEATNISGEHVKD  167



>ref|XP_009803028.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1372

 Score =   166 bits (420),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 1/177 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L+ +L+ +GIHTFKDD RLE+G  IS  L  AI +S+
Sbjct  9    QNWKNDVFLSFRGEDTRKTFVGHLYYALKHKGIHTFKDDVRLERGKSISPELVKAIEQSR  68

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +M+C+++L    V+PIFY V+P+DV  Q G++  SF  
Sbjct  69   FAIVVFSKNYASSTWCLDELVKIMKCKKELG-LTVMPIFYDVDPSDVSKQSGTFAESFSR  127

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHAS  679
              E +  D EKV+ W++A  +AG+  GY L N Y+ YE+ C + V  DI  +L   +
Sbjct  128  HEENLRDDLEKVQCWRDAFGEAGKTAGYDLPNGYDGYESNCIQHVVEDILGKLCQVT  184



>ref|XP_008227564.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=245

 Score =   156 bits (394),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 105/150 (70%), Gaps = 1/150 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            + W Y V LSFRG D R  F D L+ +L ++GI+TF+DDD L +G+ IS +L  AI ESK
Sbjct  19   KSWKYHVVLSFRGEDTRHNFTDHLYSALCQQGINTFRDDDELIRGEEISSALFTAIEESK  78

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              + VFSK YASSKWCL+EL  +++C+ K K+Q+V+P+FY V P+DVRNQ+GS+ ++   
Sbjct  79   ISVVVFSKNYASSKWCLDELVKILDCK-KSKQQLVIPVFYKVNPSDVRNQRGSFGDALAN  137

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHL  598
            +  K  ++ +KV +W+ AL++   L G+ L
Sbjct  138  MECKYKENMQKVNKWRAALSQVAALSGFTL  167



>ref|XP_006371058.1| hypothetical protein POPTR_0019s03040g [Populus trichocarpa]
 gb|ERP48855.1| hypothetical protein POPTR_0019s03040g [Populus trichocarpa]
Length=509

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RKTF D L+ +L +  IHTF+DDD L +G+ IS  +  AI+ESK  
Sbjct  13   WTYDVFLSFRGEDTRKTFTDHLYAALVQAKIHTFRDDDELPRGEEISDHVLRAIQESKIS  72

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSKGYASS+WCL+EL  +++C+ K   QIV+PIFY ++P DVR Q G +  +F +  
Sbjct  73   IVVFSKGYASSRWCLDELVEILKCKRKKTGQIVLPIFYDIDPLDVRKQTGRFAEAFVKHE  132

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E+   +++ V+ W++AL +AG L G++L +  N
Sbjct  133  ERF--EEKLVKEWRKALKEAGNLSGWNLNDMAN  163



>ref|XP_008459162.1| PREDICTED: TMV resistance protein N-like [Cucumis melo]
Length=625

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 103/150 (69%), Gaps = 0/150 (0%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
              W+YDVFLSFRG D RK+F+  L+E+L R GI+ F+D + L++G  ISQ L  AI  S+
Sbjct  7    SSWSYDVFLSFRGEDTRKSFMGHLYEALVRAGINVFRDTEELKRGMQISQELCEAINGSR  66

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            FF+ VFSK YASS WCL+E+  +M C E  K Q+V P+FYH++P++VR Q G +  +F  
Sbjct  67   FFVVVFSKNYASSSWCLDEVVQIMSCMEGGKGQMVWPLFYHIDPSEVRKQTGLFGEAFIV  126

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHL  598
              E+  +D +KV RW+EAL KA  L  +HL
Sbjct  127  HKERFKEDLKKVERWREALTKAANLSSWHL  156



>gb|KCW73565.1| hypothetical protein EUGRSUZ_E02103, partial [Eucalyptus grandis]
Length=860

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D + L+KGD IS  +  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFISHLYQALHRIGIYTFRDSEELKKGDQISPVVMKAIEESCIAIT  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSENYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPKEVRGGRKSYQRALAKHKSK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL+ AG L G+HL +
Sbjct  130  FGKDLEKVKRWKEALSDAGNLSGWHLND  157



>ref|XP_011457915.1| PREDICTED: TMV resistance protein N-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1273

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R +F DFL+ +L+++GI+TF+D++ LE+G  I+  L  AI ES++ 
Sbjct  21   WIYDVFLSFRGTDTRNSFTDFLYNTLKQKGINTFRDNEELERGKEIAPELLKAIEESRYV  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I V S+ YA S WCL+E+A V+EC  KL  Q VVP+FYHV+P +VR QKGS+E +F +  
Sbjct  81   IVVLSENYADSSWCLDEVAKVVECM-KLMGQTVVPVFYHVDPFEVRRQKGSFEKAFAKHE  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             ++  + EKV+RW+ AL     L G+HLK+
Sbjct  140  IRLKDNPEKVKRWRSALTDVANLSGWHLKD  169



>ref|XP_002325276.2| hypothetical protein POPTR_0019s01160g [Populus trichocarpa]
 gb|EEE99657.2| hypothetical protein POPTR_0019s01160g [Populus trichocarpa]
Length=829

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIH F+DDD L +G+ IS  L  AI+ESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYSALVQAGIHAFRDDDDLPRGEEISDHLLRAIQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  ++EC+ +   QIV+PIFYH++P+DVR Q GS+  +F    E
Sbjct  74   VVFSKGYASSRWCLNELVEILECKNRKTGQIVLPIFYHIDPSDVRKQNGSFAEAFANNEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  134  RF--EEKLVKEWRKALEEAGNLSGWNLNHMAN  163



>ref|XP_008351874.1| PREDICTED: putative disease resistance protein At4g11170 [Malus 
domestica]
Length=192

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 104/152 (68%), Gaps = 2/152 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
             W YDVFLSFRG D R  F D L+++L  +GI+TF D + L +G+ IS +L   I ES+ 
Sbjct  14   SWRYDVFLSFRGEDTRTNFTDHLYKALVDKGINTFIDRE-LRRGEEISPTLLQVIEESRI  72

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             + +FS+ YASS WCL+EL  +++C+E  K+QIV+P+FY VEP+ VR Q+ S+ N+F EL
Sbjct  73   SLVIFSRTYASSSWCLDELVKILQCRES-KQQIVLPVFYKVEPSHVRKQESSFGNAFTEL  131

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKND  607
              K G ++EKV  WK AL +   L G+H+K +
Sbjct  132  VSKSGNNNEKVPVWKRALTEVANLSGHHVKEE  163



>ref|XP_004253023.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A8-like [Solanum lycopersicum]
Length=380

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD FLSFRG D+RKTF+  L+ +L +RGI+ FKDD+RLE G  IS  L  AI ESKF I 
Sbjct  12   YDAFLSFRGVDIRKTFVSHLYNALVQRGINVFKDDERLETGKSISDELLKAIEESKFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASSKWCL ELA +++C+++L +  ++PIF+ V P+DV +Q  S+  SF +  E+
Sbjct  72   IFSESYASSKWCLNELAHIIKCRKEL-DLTLIPIFFDVNPSDVSHQTQSFAESFSKHEEQ  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D EK+ RW++A   +G++KG+HL+N
Sbjct  131  YKDDMEKIHRWRDAFAVSGEIKGHHLQN  158



>ref|XP_006441912.1| hypothetical protein CICLE_v10023609mg, partial [Citrus clementina]
 gb|ESR55152.1| hypothetical protein CICLE_v10023609mg, partial [Citrus clementina]
Length=189

 Score =   154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L+ +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  11   YDVFVSFRGEDTRDNFSSHLYSALSRQNIQTFIDD-QLNRGDEISESLVNAIEASAISVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC+++   QIV+P+FY V+P+DVRNQ GS+ NSF +  E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKEYA-QIVIPVFYRVDPSDVRNQTGSFGNSFSKFEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              ++ +K++ W+ AL +A  L G+  +N
Sbjct  129  FKENSKKLQTWRNALKEAATLSGFPSQN  156



>ref|XP_006370866.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
 gb|ABB82032.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
 gb|ERP48663.1| hypothetical protein POPTR_0019s01210g [Populus trichocarpa]
Length=509

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AI+ESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAIQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+   F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEPFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG+L G++L +  N
Sbjct  134  RF--EEKLVKEWRKALEEAGKLSGWNLNDMAN  163



>ref|XP_008236613.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=701

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 105/151 (70%), Gaps = 3/151 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R  F D L  SL RRGI+TF DDD+LE+G  IS+ +  AIRES+ F
Sbjct  27   WKYDVFLSFRGADTRYGFTDHLHSSLLRRGINTFMDDDQLERGQDISEVINPAIRESRIF  86

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I +FS+ YASS WCLEELA ++E +   ++QIV+P++Y V+P DVRNQKG +  +F + H
Sbjct  87   IIIFSENYASSSWCLEELARIIEYKNP-QQQIVIPVYYKVDPADVRNQKGPFGEAFVQ-H  144

Query  515  EKIGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD EKV RW+ AL +A    G  + N
Sbjct  145  ENRFKDDLEKVSRWRAALTEAANFPGMEVNN  175



>ref|XP_004292155.1| PREDICTED: TMV resistance protein N-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1648

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R +F DFL+ +L+++GI+TF+D++ LE+G  I+  L  AI ES++ 
Sbjct  21   WIYDVFLSFRGTDTRNSFTDFLYNTLKQKGINTFRDNEELERGKEIAPELLKAIEESRYV  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I V S+ YA S WCL+E+A V+EC  KL  Q VVP+FYHV+P +VR QKGS+E +F +  
Sbjct  81   IVVLSENYADSSWCLDEVAKVVECM-KLMGQTVVPVFYHVDPFEVRRQKGSFEKAFAKHE  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             ++  + EKV+RW+ AL     L G+HLK+
Sbjct  140  IRLKDNPEKVKRWRSALTDVANLSGWHLKD  169



>emb|CCW28746.1| TIR NB-ARC LRR protein, partial [Arachis duranensis]
Length=903

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 106/154 (69%), Gaps = 1/154 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            + WTY VFLSFRG D RK F D L+ SL+R+GI  F+DD  LE+G+ IS  L  AI ES 
Sbjct  17   RSWTYHVFLSFRGQDTRKGFTDHLYASLQRKGITNFRDDMNLERGEVISHELLRAIEESM  76

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F + V S  YASS WCL+EL  ++EC+  L  QI VP+FY V+P DVR+QKG++E++F++
Sbjct  77   FAVVVLSPNYASSPWCLDELQKIVECKNNLGLQI-VPVFYGVDPCDVRHQKGTFEDAFRK  135

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
              E+ G D EKV+RW++AL +     G+  KN +
Sbjct  136  QEERFGGDSEKVKRWRDALIQVAIYSGWDSKNQH  169



>gb|KCW54045.1| hypothetical protein EUGRSUZ_I000292 [Eucalyptus grandis]
 gb|KCW54046.1| hypothetical protein EUGRSUZ_I000292 [Eucalyptus grandis]
Length=157

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG ++R  FI  L+++L + GIHTF D + L+KGD IS  L  AI+ES   + 
Sbjct  11   YDVFLSFRGAELRLNFISHLYQALIQNGIHTFWDSEELKKGDQISM-LMEAIKESCIAVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEE+A +MEC+E+ +   V+P+FY V+P +VR  + SY  +  +   K
Sbjct  70   VFSQDYASSEWCLEEVAKIMECKEQ-RNLTVLPVFYKVDPKEVREGRESYRRALDKHESK  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKND  607
             GKD +KV+RWKEAL  AG L G+HL ++
Sbjct  129  FGKDSDKVKRWKEALFNAGSLSGWHLNDE  157



>ref|XP_006367967.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=542

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RKTF   L+E L+ RGI TF+DD RLE+GD IS+ L  AI ES+  
Sbjct  17   WKYDVFLSFRGEDTRKTFTSHLYEGLKNRGIFTFQDDKRLEQGDSISKELLKAIEESQVA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YA+S+WCL EL  VMEC+E+   Q V+PIFY V+P+ VR Q  S+   F + H
Sbjct  77   LIVFSRNYATSRWCLNELVKVMECKEEENGQTVIPIFYDVDPSHVRYQSESFAEVFAK-H  135

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD    +KV+ W+ AL  A  LKGY +++
Sbjct  136  ESRYKDDVEGMQKVQGWRTALTAAANLKGYDIRD  169



>ref|XP_010661153.1| PREDICTED: TMV resistance protein N-like isoform X2 [Vitis vinifera]
Length=170

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 110/150 (73%), Gaps = 4/150 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            +DVFLSFRG D R  F D LF +L+  GI TF+DD +LE+G+ I+Q L   I  S+F I 
Sbjct  21   FDVFLSFRGEDTRYNFTDHLFVNLDWMGIGTFRDD-KLERGEEIAQELLGTIEGSRFSII  79

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YA SKWCL+E A +MEC++++ +QIV+P+FYHVEP+DVR +  S+E++F  +HEK
Sbjct  80   VFSEKYAHSKWCLDEFAKIMECRKEM-DQIVLPVFYHVEPSDVRKKTESFEDAFA-VHEK  137

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
               D E V+RW+ A+ +AG L G+H+K+ +
Sbjct  138  -NVDKETVQRWRAAMTEAGNLGGWHVKDGF  166



>ref|XP_010026496.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=226

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 103/151 (68%), Gaps = 1/151 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG DVR  F+  L+ +L++ GI+T+ D + L+KG+ IS +L   I+ES+  I
Sbjct  67   NYDVFLSFRGMDVRNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEVIKESQIAI  126

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSK YASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR QK  Y  +  +   
Sbjct  127  VVFSKDYASSPWCLEEVANIMECKEQ-RGLMVFPVFYKVEPREVRGQKQGYGEAMAKHEV  185

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            K GKD EKV+RWK+AL+  G L G H  + Y
Sbjct  186  KFGKDSEKVKRWKKALHDVGSLSGLHFIDGY  216



>emb|CAD36199.1| NLS-TIR-NBS disease resistance protein [Populus tremula]
Length=516

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF SFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I 
Sbjct  1    YDVFFSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLKAIRESKICIV  60

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSKGYASS+WCL+EL  +++C+ +   QI +PIFY ++P+ VR Q GS+  +F + HE+
Sbjct  61   VFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSYVRKQTGSFAEAFVK-HEE  119

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              K  EKV+ W+EAL +AG L G++LK+
Sbjct  120  RSK--EKVKEWREALEEAGNLSGWNLKD  145



>gb|KCW59429.1| hypothetical protein EUGRSUZ_H02155 [Eucalyptus grandis]
Length=176

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            +DVFLSFRG DVR  F+  L+ +L + GI+T+ D + L+KG+ IS +L  AI +S+  I 
Sbjct  15   HDVFLSFRGMDVRNYFLSHLYTALVQSGINTYMDSEDLKKGEQISPALMEAIEDSQIAIV  74

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR Q+  Y  +  E   K
Sbjct  75   VFSKDYASSPWCLEEVAKIMECKEQ-RGLMVFPVFYKVEPREVRGQRQGYAEAMAEHEVK  133

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
             GKD EKV+RWK+AL   G L G H  N Y
Sbjct  134  FGKDSEKVKRWKKALLDVGSLSGLHFINGY  163



>ref|XP_007201564.1| hypothetical protein PRUPE_ppa018131mg [Prunus persica]
 gb|EMJ02763.1| hypothetical protein PRUPE_ppa018131mg [Prunus persica]
Length=1093

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D R  F D L+ +L R+GI TF+DD++L+KG  IS+ L NAI ES++ 
Sbjct  20   WTYDVFLSFRGTDTRTGFTDHLYAALNRKGIITFRDDEKLKKGKSISE-LFNAIEESRYV  78

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            +AV S  YA S WCLEELA  +EC+E L  Q ++PIFYHV P++V NQ GS+E +F +  
Sbjct  79   VAVISSNYADSTWCLEELAKAVECKE-LMGQTLIPIFYHVHPSEVGNQTGSFEIAFSKHE  137

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            +    + EKV+RW+ AL++   L  YHL N Y
Sbjct  138  QGFKGNLEKVKRWRAALSQVAGLSRYHLHNGY  169



>gb|KCW73676.1| hypothetical protein EUGRSUZ_E02272 [Eucalyptus grandis]
Length=885

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             Y VFLSFRG D+RK+F+  L+++L+++GIHTF+D++ LEKGD IS  L  AI ES   I
Sbjct  10   AYHVFLSFRGADLRKSFVSHLYQALKQKGIHTFRDNEELEKGDEISPVLMKAIEESCIAI  69

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS  YASS+WCLEELA +MEC+E  K   V+P+FY V+P +VR  + SY+ +  +   
Sbjct  70   IVFSDDYASSRWCLEELAKIMECREP-KNLTVLPVFYKVDPREVREGRNSYQRALNKHES  128

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K+GK+ EKV RWK+AL  AG L G+HL +
Sbjct  129  KLGKNSEKVLRWKKALFAAGNLSGWHLND  157



>gb|AAD25969.1|AF093642_1 flax rust resistance protein [Linum usitatissimum]
Length=1581

 Score =   165 bits (417),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 76/150 (51%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            Y+VFLSFRGPD R+ F DFL++ L R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct  61   YEVFLSFRGPDTREQFTDFLYQFLRRYKIHTFRDDDELRKGKEIGPNLLRAIDQSKIYVP  120

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G Y+ +F++   K
Sbjct  121  IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK  180

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHL-KND  607
               D + ++ WK+AL K G LKG+H+ KND
Sbjct  181  F--DGQTIQNWKDALKKVGDLKGWHIGKND  208



>gb|AAG43546.1|AF211528_1 Avr9/Cf-9 rapidly elicited protein 4 [Nicotiana tabacum]
Length=536

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L  RGI TF+DD RLE G  IS+ L  AI ES+F 
Sbjct  9    WSYDVFLSFRGEDTRKTFTSHLYEVLNDRGIKTFQDDKRLEYGATISEELCKAIEESQFS  68

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I +FSK Y +S+WC+ EL  +MEC+ +   QIV+PIFY V+P+ VRNQK S+  +F+E  
Sbjct  69   IVIFSKNYTTSRWCMNELVKIMECKTQFG-QIVIPIFYDVDPSHVRNQKESFAKAFEEHV  127

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ AL  A  LKG
Sbjct  128  TKYKDDVEGIQRWRIALTAAANLKG  152



>ref|XP_004228809.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1326

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L  +L+++GIHTFKDD+RLE+G  IS  L  AI ES+
Sbjct  7    QNWKNDVFLSFRGKDTRKTFVGHLNYALKQKGIHTFKDDERLERGKTISPELVKAIEESR  66

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +MEC+++L  Q V+PIFY V+P+ V  Q  ++  SF  
Sbjct  67   FAIVVFSKNYASSTWCLDELVKIMECKKELG-QTVIPIFYDVDPSHVTKQSETFAKSFA-  124

Query  509  LHEKIGKDD-EKVRRWKEALNKAGQLKGYHLKNDYN  613
            +HE+  KDD EKV  W++A  +AG++ GY L N Y+
Sbjct  125  IHEENLKDDVEKVLCWRDAFRQAGKIAGYDLPNGYD  160



>ref|XP_010059085.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=906

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHRIGIYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSENYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPKEVRGGRKSYQRALAKHKSK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL  AG L G+HL +
Sbjct  130  FGKDSEKVKRWKEALFDAGNLSGWHLND  157



>gb|AAP44390.1| nematode resistance protein [Solanum tuberosum]
Length=1136

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +LE++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct  16   WSYDVFLSFRGEDVRKTFVDHLYLALEQKCINTFKDDEKLEKGKFISPELVSSIEESRIA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S WCL+EL  +MEC+  +K QIVVP+FY V+P+ VR QK  +  +F + H
Sbjct  76   LIIFSKNYANSTWCLDELTKIMECKN-VKGQIVVPVFYDVDPSTVRKQKSIFGEAFSK-H  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN---HASLA  685
            E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS A
Sbjct  134  EARFQED-KVQKWRAALEEAANISGWDLPNTANGHEARVMEKIAEDIMARLGSQRHASNA  192



>gb|ABF81460.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=697

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 108/153 (71%), Gaps = 2/153 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RKTF D L+ +L +  IHTF+DDD L +G+ IS  +  AI+ESK  
Sbjct  67   WTYDVFLSFRGEDTRKTFTDHLYAALVQAKIHTFRDDDELPRGEEISDHVLRAIQESKIS  126

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSKGYASS+WCL+EL  +++C+ K   QIV+PIFY ++P DVR Q G +  +F +  
Sbjct  127  IVVFSKGYASSRWCLDELVEILKCKRKKTGQIVLPIFYDIDPLDVRKQTGRFAEAFVKHE  186

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E+   +++ V+ W++AL +AG L G++L +  N
Sbjct  187  ERF--EEKLVKEWRKALKEAGNLSGWNLNDMAN  217



>dbj|BAD12595.1| truncated N protein [Nicotiana tabacum]
Length=638

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L  +GI TF+DD RLE G  I   L  AI ES+F 
Sbjct  2    WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA  61

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YA+S+WCL EL  +MEC+ + K Q V+PIFY V+P+ VRNQK S+  +F+E  
Sbjct  62   IVVFSENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE  120

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ ALN+A  LKG
Sbjct  121  TKYKDDVEGIQRWRIALNEAANLKG  145



>ref|XP_010665272.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1164

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 112/154 (73%), Gaps = 5/154 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESL-ERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            GW++DVFLSFRG D R TF D L+ +L +++GI TF+D++ L +G+ I  SL  AI ES+
Sbjct  13   GWSWDVFLSFRGEDTRFTFTDHLYSALCQQKGIRTFRDNEGLHRGEEIGSSLLKAIEESR  72

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              I VFSK YA SKWCL+ELA +MEC+ + K QIVVP+FYHV+P DVRNQ  S+  +F +
Sbjct  73   MCIVVFSKTYAHSKWCLDELAKIMECKTQ-KGQIVVPVFYHVDPCDVRNQTRSFGEAFDK  131

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
             ++K+ +D  KV RWK AL +A  L GYH+++ Y
Sbjct  132  -YQKVPED--KVMRWKAALTEAANLSGYHVQDGY  162



>ref|XP_010661152.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=185

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 109/148 (74%), Gaps = 4/148 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            +DVFLSFRG D R  F D LF +L+  GI TF+DD +LE+G+ I+Q L   I  S+F I 
Sbjct  21   FDVFLSFRGEDTRYNFTDHLFVNLDWMGIGTFRDD-KLERGEEIAQELLGTIEGSRFSII  79

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YA SKWCL+E A +MEC++++ +QIV+P+FYHVEP+DVR +  S+E++F  +HEK
Sbjct  80   VFSEKYAHSKWCLDEFAKIMECRKEM-DQIVLPVFYHVEPSDVRKKTESFEDAFA-VHEK  137

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               D E V+RW+ A+ +AG L G+H+K+
Sbjct  138  -NVDKETVQRWRAAMTEAGNLGGWHVKD  164



>ref|XP_004136801.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=381

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RK F D L+ +L+  GI+ F+DD  L++G+ IS  L  AI  SK  
Sbjct  12   WTYDVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPELQRGEDISSGLERAIEGSKVA  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YA S WCLEEL  +MEC+  L+ Q+V+P+FY+V+P+ VR QKG +E +F + H
Sbjct  72   VIVFSERYAESGWCLEELVKIMECRRTLR-QMVLPVFYNVDPSCVRKQKGEFEEAFVK-H  129

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            EK GKD +KVRRW+ AL +A  + G  L  + N
Sbjct  130  EK-GKDIDKVRRWRMALTEAANVAGLGLTQNAN  161



>ref|XP_011047737.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Populus euphratica]
Length=1507

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 3/152 (2%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF++DD L +G+ IS  L  AI+ESK  I
Sbjct  197  AYDVFLSFRGEDTRKTFTDHLYTALVKAGIHTFREDDELPRGEEISDHLLKAIQESKISI  256

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL+EL  +++C+ +   QI +PIFY ++P+DVR Q GS+  +F +  E
Sbjct  257  VVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVKHEE  316

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +     EKV+ WKEAL +AG L G++LK+  N
Sbjct  317  RY---KEKVKEWKEALEEAGNLSGWNLKDMAN  345



>ref|XP_004159649.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus]
Length=380

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RK F D L+ +L+  GI+ F+DD  L++G+ IS  L  AI  SK  
Sbjct  12   WTYDVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPELQRGEDISSGLERAIEGSKVA  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YA S WCLEEL  +MEC+  L+ Q+V+P+FY+V+P+ VR QKG +E +F + H
Sbjct  72   VIVFSERYAESGWCLEELVKIMECRRTLR-QMVLPVFYNVDPSCVRKQKGEFEEAFVK-H  129

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            EK GKD +KVRRW+ AL +A  + G  L  + N
Sbjct  130  EK-GKDIDKVRRWRMALTEAANVAGLGLTQNAN  161



>ref|XP_003617379.1| CCP [Medicago truncatula]
 gb|AET00338.1| disease resistance protein (TIR-NBS-LRR class) [Medicago truncatula]
Length=1651

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 106/149 (71%), Gaps = 0/149 (0%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            G+TYDVFLSFRG DVR  FI +L ++L+ RGI+ F DD  L  G+ IS +L  AI ESK 
Sbjct  12   GFTYDVFLSFRGEDVRHNFIGYLRDALQHRGINAFFDDKNLRIGEDISPALSKAIEESKI  71

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             + VFS+ YASS+WCL EL  ++EC ++ K+QI  PIF+HV+P+DVR+QK SYE +  + 
Sbjct  72   AVIVFSENYASSRWCLGELVKIIECTKRNKKQISFPIFFHVDPSDVRHQKNSYEKAMVDH  131

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHL  598
              K GKD E V+ W  AL++A  LKG+H+
Sbjct  132  EVKFGKDSENVKAWITALSEAADLKGHHI  160



>gb|KCW74409.1| hypothetical protein EUGRSUZ_E03092 [Eucalyptus grandis]
Length=416

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             Y VFLSFRG DVR +F+  L+ +L++RGIHTF D   L KG+ IS +L  AI +S+  I
Sbjct  4    NYHVFLSFRGTDVRHSFLSHLYAALDQRGIHTFVDRKELRKGEEISPALMRAIEQSRVVI  63

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCLEEL  +MEC+E+  + IV P+FY VEP +VR  + SY+ +  E   
Sbjct  64   IVFSENYASSPWCLEELLKIMECEER-NDLIVFPVFYKVEPREVRKGRDSYKRAMAEHES  122

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV+RWK+AL  AG L G+H  +
Sbjct  123  KFGKDSEKVKRWKKALLDAGSLSGWHFND  151



>ref|XP_010056815.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1075

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             Y VFLSFRG D+RK+F+  L+++L+++GIHTF+D++ LEKGD IS  L  AI ES   I
Sbjct  10   AYHVFLSFRGADLRKSFVSHLYQALKQKGIHTFRDNEELEKGDEISPVLMKAIEESCIAI  69

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS  YASS+WCLEELA +MEC+E  K   V+P+FY V+P +VR  + SY+ +  +   
Sbjct  70   IVFSDDYASSRWCLEELAKIMECREP-KNLTVLPVFYKVDPREVREGRNSYQRALNKHES  128

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K+GK+ EKV RWK+AL  AG L G+HL +
Sbjct  129  KLGKNSEKVLRWKKALFAAGNLSGWHLND  157



>ref|XP_011005281.1| PREDICTED: LOW QUALITY PROTEIN: TMV resistance protein N-like 
[Populus euphratica]
Length=1609

 Score =   164 bits (415),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 108/152 (71%), Gaps = 3/152 (2%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF++DD L +G+ IS  L  AI+ESK  I
Sbjct  299  AYDVFLSFRGEDTRKTFTDHLYTALVKAGIHTFREDDELPRGEEISDHLLKAIQESKISI  358

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL+EL  +++C+ +   QI +PIFY ++P+DVR Q GS+  +F +  E
Sbjct  359  VVFSKGYASSRWCLDELVEILKCKYRKTGQIALPIFYDIDPSDVRKQTGSFAEAFVKHEE  418

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +     EKV+ WKEAL +AG L G++LK+  N
Sbjct  419  RY---KEKVKEWKEALEEAGNLSGWNLKDMAN  447



>ref|XP_010644041.1| PREDICTED: uncharacterized protein LOC104877471 [Vitis vinifera]
Length=2027

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RK+F D L+ +L R  IHTF+DD+ L +G+ I+  L  AI ES+  
Sbjct  19   WSYDVFLSFRGEDTRKSFTDHLYSALIRNNIHTFRDDEELPRGEEIAPELLKAIEESRSA  78

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA SKWCLEEL  +M+C+E+ ++ +V+PIFYHV+P++VRNQ   Y  +F   H
Sbjct  79   IIVFSKTYAHSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSEVRNQSEIYGEAFSH-H  137

Query  515  EKIGKDD--EKVRRWKEALNKAGQLKGYHLKNDY  610
            EK   ++  EK+R+WK AL +A  L GY  K+ Y
Sbjct  138  EKNADEERKEKIRKWKTALRQASNLAGYDAKDRY  171



>gb|KCW73945.1| hypothetical protein EUGRSUZ_E02536 [Eucalyptus grandis]
Length=1126

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D++ L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGVDLRNNFIGHLYQALHRIGIYTFRDNEELKKGDQISPVLMKAIEESYIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS  YASS+WCLEE+A ++EC+E+ K  IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  71   VFSVNYASSRWCLEEVAKIIECKEE-KNLIVLPVFYKVDPREVRGCRKSYQRALAKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWKEAL+ AG+L G+HL +
Sbjct  130  FGKDSEKVKRWKEALSDAGKLSGWHLND  157



>ref|XP_009615050.1| PREDICTED: TMV resistance protein N-like [Nicotiana tomentosiformis]
Length=1311

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            G +Y+VFLSFRG D RKTF+  LF +L  +GIHTF DD  L++G  IS  L  AI ESKF
Sbjct  14   GRSYEVFLSFRGEDTRKTFVGHLFNALIEKGIHTFMDDKELKRGRSISSELMKAIGESKF  73

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             + VFSK YASS WCLEEL  ++E  EK  E IVVP+FY V+P+ VR Q G Y   F + 
Sbjct  74   AVVVFSKNYASSTWCLEELVKILEIHEKF-ELIVVPVFYDVDPSTVRKQNGEYAVFFTKF  132

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
              ++  D +KV RW+EAL K   + G+ L+N YN
Sbjct  133  EAELVDDKDKVIRWREALTKVANISGHDLRNTYN  166



>ref|XP_011012884.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=867

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D RK F D L+ +L + GIHTF+DD+ L KG+ IS  L  AI+ESK 
Sbjct  13   GWPYDVFLSFRGEDTRKNFTDHLYTALLQAGIHTFRDDNELRKGEEISSHLLKAIQESKI  72

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSKGYASS WCL+EL+ +++C++    QIV+P+FY ++P+D+R QK S+  +F   
Sbjct  73   SIVVFSKGYASSTWCLDELSEILDCRQT-AGQIVLPVFYDIDPSDIRKQKRSFAEAFDRH  131

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
             E   ++ EKV++W+ AL +AG L G+ L +  N +E+   + +  ++ ++LN
Sbjct  132  EELFKEEMEKVQKWRTALLEAGILCGFDLHSIANGHESKLIQMIVEEVLSKLN  184



>ref|XP_010059091.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=155

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D+RK F+  L+ +L+++G++TF D + L KGD IS +L  AI+ES+  I
Sbjct  10   NYDVFLSFRGIDLRKNFVGHLYTALDQKGVYTFIDSEELRKGDQISAALMKAIKESRIAI  69

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             +FSK YASS WCLEE A +MEC+E+  + IV  +FY VEP +VR  + SY+ + K+   
Sbjct  70   IIFSKDYASSSWCLEEAAEIMECKEQ-GDLIVFSVFYKVEPKEVRTPRESYDKAMKKHEF  128

Query  518  KIGKDDEKVRRWKEALNKAGQLKG  589
            K GK  EKV+RWK+AL  AG L G
Sbjct  129  KFGKGSEKVKRWKKALFDAGGLSG  152



>ref|XP_010059182.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=443

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             Y VFLSFRG DVR +F+  L+ +L++RGIHTF D   L KG+ IS +L  AI +S+  I
Sbjct  10   NYHVFLSFRGTDVRHSFLSHLYAALDQRGIHTFVDRKELRKGEEISPALMRAIEQSRVVI  69

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCLEEL  +MEC+E+  + IV P+FY VEP +VR  + SY+ +  E   
Sbjct  70   IVFSENYASSPWCLEELLKIMECEER-NDLIVFPVFYKVEPREVRKGRDSYKRAMAEHES  128

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV+RWK+AL  AG L G+H  +
Sbjct  129  KFGKDSEKVKRWKKALLDAGSLSGWHFND  157



>gb|AAW28561.2| TMV resistance protein N, putative [Solanum demissum]
Length=645

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W Y VFLSFRG D RKTF   L+E L+ RGI TF+DD RLE GD I + L  AI ES+  
Sbjct  17   WKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFSK YA+SKWCL EL  +MEC+++   Q V+PIFY V+P+ VRNQ  S+  +F E H
Sbjct  77   LIVFSKNYATSKWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAE-H  135

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD    +KV+RW+ AL  A  LKGY +++
Sbjct  136  ELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRD  169



>ref|XP_006356453.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1324

 Score =   164 bits (414),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q W  DVFLSFRG D RKTF+  L+ +L+++GIHTFKDD+RLE+G  IS  L  AI ES+
Sbjct  7    QNWKNDVFLSFRGEDTRKTFVGHLYYALKQKGIHTFKDDERLERGKSISPELVKAIEESR  66

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
            F I VFSK YASS WCL+EL  +MEC++    Q V+PIFY V+P+ V  Q  S+  SF  
Sbjct  67   FAIVVFSKNYASSTWCLDELGKIMECKKDFG-QTVIPIFYDVDPSHVTKQSESFAKSFAT  125

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
              E +  D EKV  W++A  +AG++ GY L   Y+
Sbjct  126  HEENLKDDVEKVLCWRDAFRQAGKIAGYDLPKGYD  160



>emb|CAN64588.1| hypothetical protein VITISV_008452 [Vitis vinifera]
Length=259

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 104/151 (69%), Gaps = 4/151 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D R  F D L+ +L   G+HTF+DD+ LE+GD I+  L  AI +S+  I 
Sbjct  110  YDVFLSFRGEDTRYHFTDHLYSALRDNGVHTFRDDEELERGDVIAPGLLKAIEQSRISIV  169

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YA S+WCL+EL  ++EC  + K QIV+P+FYHV+P+ VR Q GSY  +F + HEK
Sbjct  170  VFSEKYAQSRWCLDELVKIIECMTERK-QIVLPVFYHVDPSHVRKQMGSYGEAFAD-HEK  227

Query  521  IG--KDDEKVRRWKEALNKAGQLKGYHLKND  607
                K  EK+++W+ AL +   L G+HL+++
Sbjct  228  DADLKKREKIQKWRTALTETSNLSGWHLRDN  258



>ref|XP_010645859.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Vitis vinifera]
 ref|XP_010645860.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Vitis vinifera]
 ref|XP_010645861.1| PREDICTED: protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1-like 
[Vitis vinifera]
Length=1473

 Score =   164 bits (414),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            + +DVFLSFRG D R  F D LF +L R GI+TF+DD +LE+G+ I   L   I ES+  
Sbjct  19   YNFDVFLSFRGEDTRNNFTDHLFVNLHRMGINTFRDD-QLERGEEIKSELLKTIEESRIS  77

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA SKWCL+ELA +MEC+E++ EQIV+P+FYHV+P+DVR Q GS+  +F  +H
Sbjct  78   IVVFSKDYAQSKWCLDELAKIMECREEM-EQIVLPVFYHVDPSDVRKQTGSFGEAFS-IH  135

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            E+   D++KV+RWK++L KA  L G+H+ + Y
Sbjct  136  ER-NVDEKKVQRWKDSLTKASNLSGFHVNDGY  166



>ref|XP_009759653.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
 ref|XP_009759654.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
 ref|XP_009759655.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
 ref|XP_009759656.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1165

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L+ RGI TF+D+ RLE G  I + L  AI ES+F 
Sbjct  14   WSYDVFLSFRGEDTRKTFTSHLYEVLKDRGIKTFQDEKRLEYGATIPEELSKAIEESQFA  73

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA+S+WCL EL  +MEC+ + + Q V+PIFY V+P+ VRNQK S+  +F+E  
Sbjct  74   IVVFSKNYATSRWCLNELVKIMECKTQFR-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE  132

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ ALN A  LKG
Sbjct  133  TKYKDDAEGIQRWRIALNAAANLKG  157



>emb|CDP20523.1| unnamed protein product [Coffea canephora]
Length=1150

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 124/172 (72%), Gaps = 2/172 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG DVRK  +D L+ +LE++GIHTFKDD++LE+G  IS +L  AI+ES+  
Sbjct  24   WTYDVFLSFRGEDVRKGIVDHLYSALEQKGIHTFKDDEKLERGRSISPTLLQAIKESRIA  83

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS+ YA+S WCL+ELA +++C+  L  Q V+P+FY+V+P+ VR QKGS++ +F + H
Sbjct  84   VIIFSENYATSSWCLDELAEIIDCKHVLG-QTVLPVFYYVDPSVVRRQKGSFDRAFVK-H  141

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
            E   +D E++++W+ AL +A  + G+ +    + +E+ C + +  D+ A+L 
Sbjct  142  EDEIEDKERIQKWRAALTEAASISGWDVPKTADGHESKCIQEIVGDVIAKLG  193



>gb|ABB82025.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=735

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GI  F+DDD L +G+ IS  L  AI+ESK  I
Sbjct  51   AYDVFLSFRGEDTRKTFTDHLYSALVQAGIRAFRDDDDLPRGEEISDHLLRAIQESKISI  110

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  ++EC+ +   QIV+PIFYH++P+DVR Q GS+  +F    E
Sbjct  111  VVFSKGYASSRWCLNELVEILECKNRKTGQIVLPIFYHIDPSDVRKQNGSFAEAFANNEE  170

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  171  RF--EEKLVKEWRKALEEAGNLSGWNLNHMAN  200



>dbj|BAF95888.1| N-like protein [Nicotiana tabacum]
Length=1165

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L+ RGI TF+D+ RLE G  I + L  AI ES+F 
Sbjct  14   WSYDVFLSFRGEDTRKTFTSHLYEVLKDRGIKTFQDEKRLEYGATIPEELSKAIEESQFA  73

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA+S+WCL EL  +MEC+ + + Q V+PIFY V+P+ VRNQK S+  +F+E  
Sbjct  74   IVVFSKNYATSRWCLNELVKIMECKTQFR-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE  132

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ ALN A  LKG
Sbjct  133  TKYKDDAEGIQRWRIALNAAANLKG  157



>ref|XP_011014417.1| PREDICTED: TMV resistance protein N-like [Populus euphratica]
Length=901

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  42   AYDVFLSFRGKDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  101

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  102  VVFSKGYASSRWCLNELVEILKCKRKKTSQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  161

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  162  RF--EEKLVKEWRKALEDAGNLSGWSLNDMEN  191



>ref|XP_010644011.1| PREDICTED: TMV resistance protein N-like isoform X1 [Vitis vinifera]
Length=1373

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            G+ Y VFLSFRG D R+TF   L+ +L  RGIHTF+DD+ LEKG  I+  L  AI ESK 
Sbjct  18   GYNYHVFLSFRGEDTRQTFTGHLYANLVARGIHTFRDDEELEKGGDIASDLSRAIEESKI  77

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
            FI +FSK YA SKWCL EL  +++C  + K+ +V+P+FYHVEPTDVRNQ GS++++F E 
Sbjct  78   FIIIFSKHYADSKWCLNELVKIIDCMTE-KKSVVLPVFYHVEPTDVRNQGGSFKDAFLE-  135

Query  512  HEKIGKDD--EKVRRWKEALNKAGQLKGYHLKN  604
            H K    +  +K+  WK AL  A  L G+HL+N
Sbjct  136  HAKDADQEKKKKIETWKNALKIAANLSGFHLQN  168



>gb|KCW59424.1| hypothetical protein EUGRSUZ_H02148 [Eucalyptus grandis]
Length=193

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG DVR  F+  L+ +L + GI+T+ D + L+KG+ IS +L  AI ES+  I 
Sbjct  16   YDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLKKGEKISPALMEAIEESQIAIV  75

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR Q+  Y  +  +   K
Sbjct  76   VFSKDYASSPWCLEEVAKIMECKEQ-RGLMVFPVFYKVEPREVRGQRQGYAEAMNKHEVK  134

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             G D EKV+RWK+AL  AG L G+H  +
Sbjct  135  FGTDSEKVKRWKKALLDAGSLSGWHFMD  162



>gb|AAP44393.1| nematode resistance-like protein [Solanum tuberosum]
Length=1136

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct  16   WSYDVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELVSSIEESRIA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S WCL+EL  +MEC+  +K QIVVP+FY V+P+ VR QK  +  +F + H
Sbjct  76   LIIFSKNYANSTWCLDELTKIMECK-NVKGQIVVPVFYDVDPSTVRKQKSIFGEAFSK-H  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN---HASLA  685
            E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS A
Sbjct  134  EARFQED-KVQKWRAALEEAANISGWDLPNTSNGHEARVMEKIAEDIMARLGSQRHASNA  192



>gb|AAP44392.1| nematode resistance-like protein [Solanum tuberosum]
Length=1136

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct  16   WSYDVFLSFRGEDVRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELMSSIEESRIA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S WCL+EL  +MEC+  +K QIVVP+FY V+P+ VR QK  +  +F + H
Sbjct  76   LIIFSKNYANSTWCLDELTKIMECKN-VKGQIVVPVFYDVDPSTVRKQKSIFGEAFSK-H  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN---HASLA  685
            E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS A
Sbjct  134  EARFQED-KVQKWRAALEEAANISGWDLPNTSNGHEARVMEKIAEDIMARLGSQRHASNA  192



>emb|CAN79900.1| hypothetical protein VITISV_007865 [Vitis vinifera]
Length=826

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            +TYDVFLSFRG D R TF D L+ +L   GIHTF+DD+ LEKG  I+  L NAI ES+ F
Sbjct  674  FTYDVFLSFRGEDTRSTFTDHLYSALVSNGIHTFRDDEELEKGGVIAGELLNAIEESRIF  733

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I +FSK YA+S WCL EL  + EC     +QI++PIFYHV+P++VR Q G+Y  +F + H
Sbjct  734  IIIFSKDYANSSWCLNELEKITECMATNDQQIILPIFYHVDPSEVRKQTGTYGEAFAD-H  792

Query  515  EKIGKDD--EKVRRWKEALNKAGQLKGY  592
            EK    +  EK+++W+ AL +A  L GY
Sbjct  793  EKDADQEKKEKIQKWRIALTEASNLAGY  820



>emb|CAA08798.1| NL27 [Solanum tuberosum]
Length=821

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 103/153 (67%), Gaps = 4/153 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R+TF   L+E L+ RGI TF+DD RLE GD I + L  AI ES+  
Sbjct  18   WKYDVFLSFRGVDTRRTFTSHLYEGLKNRGIFTFQDDKRLENGDSIPEELLKAIEESQVA  77

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S+WCL EL  +MEC+E+ K QIV+PIFY V+P++VR Q  S+  +F E  
Sbjct  78   LIIFSKNYATSRWCLNELVKIMECKEE-KGQIVIPIFYDVDPSEVRKQTKSFAEAFTEHE  136

Query  515  EKIGKDDE---KVRRWKEALNKAGQLKGYHLKN  604
             K   D E   KV+ W+ AL+ A  LKGY + N
Sbjct  137  SKYANDIEGMQKVKGWRTALSDAADLKGYDISN  169



>ref|XP_010058804.1| PREDICTED: toll/interleukin-1 receptor-like protein [Eucalyptus 
grandis]
Length=222

 Score =   153 bits (386),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 99/146 (68%), Gaps = 1/146 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+ +L + G+HTF D + L KGD IS +L  AI+ES+  I 
Sbjct  11   YDVFLSFRGTDLRNNFIGHLYTALNQNGVHTFIDSEELRKGDQISVALMKAIKESRIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCLEE A +MEC+ +  + IV  +FY VEP +VR  + SY  +  +   K
Sbjct  71   VFSEDYASSPWCLEEAAKIMECKAQ-GDLIVFSVFYKVEPKEVRTPRESYNKAMDKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHL  598
             GKD EKV+RWK+AL  AG L G+HL
Sbjct  130  FGKDSEKVKRWKKALFDAGGLSGWHL  155



>ref|XP_010665222.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=318

 Score =   155 bits (392),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFR  D R  F D L+ +L  R I TF+DD +L++G+ I+  L   I ES+  
Sbjct  18   WNYDVFLSFRAEDTRYKFTDHLYAALRNRSIRTFRDD-KLKRGEEIAPELLKVIEESRLS  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YASS+WCL+EL  +MEC++K++ QIVVPIFYHV+P+D+R QKGS+  +F   +
Sbjct  77   IVVFSENYASSRWCLDELVKIMECRQKIR-QIVVPIFYHVDPSDLRKQKGSFGKAFAS-Y  134

Query  515  EKIGKDD-EKVRRWKEALNKAGQLKGYHLKNDY  610
            E+ G+D  EK++RW+ AL +A  L G+ L   Y
Sbjct  135  ERHGRDSKEKIQRWRAALTEASNLSGWRLFEGY  167



>ref|XP_006359571.1| PREDICTED: TMV resistance protein N-like, partial [Solanum tuberosum]
Length=1132

 Score =   162 bits (411),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 104/153 (68%), Gaps = 5/153 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R TF   L+E L+ RGI TF+DD RLE+GD IS+ L  AI ES+  
Sbjct  17   WKYDVFLSFRGADTRATFTSHLYEGLKNRGIFTFQDDKRLEQGDSISEELLKAIEESQVA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S+WCL EL  +MEC+E+   Q V+PIFY V+P++VR Q  S+  +F + H
Sbjct  77   LIIFSKNYATSRWCLNELVKIMECKEEENGQTVIPIFYDVDPSNVRYQSESFAEAFAK-H  135

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLK  601
            E   KDD    +KV+ W+ AL   G LKGY ++
Sbjct  136  ESTYKDDVEGMQKVQGWRNALTATGNLKGYDIR  168



>gb|AAL07537.1| resistance gene analog NBS2 [Helianthus annuus]
Length=226

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 102/144 (71%), Gaps = 4/144 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            ++VFLSFRG D R+ F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES   + 
Sbjct  37   HEVFLSFRGEDTRRNFVDHLYKDLAQQGIQTYKDDETLPRGERIGPALLKAIQESHIAVV  96

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YA S WCL+ELA +MEC +   EQIV+P+FYHV P+DVRNQKG Y  +  + HE+
Sbjct  97   VFSQNYADSSWCLDELAHIMECMDP-SEQIVMPVFYHVNPSDVRNQKGKYGKALSK-HER  154

Query  521  IGKDDEKVRRWKEALNKAGQLKGY  592
              K+ +KV  W+ AL KAG L G+
Sbjct  155  --KNKQKVESWRNALEKAGNLSGW  176



>ref|XP_010058828.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=232

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+  L++ G+ TF D + L KGD ISQ+L   I ES   I 
Sbjct  11   YDVFLSFRGTDLRNNFIGHLYNGLDQNGVFTFIDSEELRKGDQISQALMKTIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS  YASS+WCLEELA +MEC+E+ K+ IV+P+FY V+P +VR  + SY  +  +   K
Sbjct  71   VFSDDYASSRWCLEELAKIMECKEQ-KDLIVLPVFYKVDPREVRGGRESYGRALAKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GK+ ++V+RWK+AL  AG L G+HL +
Sbjct  130  FGKNSKEVKRWKKALFDAGNLSGWHLGD  157



>ref|XP_002524855.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF37479.1| ATP binding protein, putative [Ricinus communis]
Length=673

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 114/176 (65%), Gaps = 3/176 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RK F D L+ +L + GIH F+DD  L +G+ IS  L  AI+ESK  
Sbjct  21   WSYDVFLSFRGEDTRKNFTDHLYNALLQAGIHAFRDDKHLSRGNHISSELLKAIQESKVS  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSKGYASS+WCL+EL  +M+C+     QIVVPIFY V P+DVR Q GS+  + +  H
Sbjct  81   IVVFSKGYASSRWCLDELVKIMQCKNT-AGQIVVPIFYDVSPSDVRKQTGSFAEALQR-H  138

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNHASL  682
            E+   + EKV  W+ AL +A  L G+ L+N  N +E+     V  D+ ++L+   L
Sbjct  139  EQFS-EREKVNDWRNALLEAANLSGWDLQNVANGHESKNIRKVVEDVLSKLSRNCL  193



>ref|XP_008236726.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=167

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 103/152 (68%), Gaps = 4/152 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW YDVFLSFRG D R +F D L  SL R+GIHTF DD  L +G+ ISQ+L  AI  S  
Sbjct  18   GWKYDVFLSFRGEDTRYSFTDHLHSSLVRKGIHTFIDDG-LVRGEEISQALLKAIEGSMI  76

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             + +FS+ YASSKWCL+ELA +M+C+ K  +Q V+PIFY V P+D+R+Q G +  +    
Sbjct  77   SLIIFSENYASSKWCLDELAHIMQCK-KSDQQKVIPIFYKVNPSDLRHQTGCFGKALAS-  134

Query  512  HEKIGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
            HE   KDD EKV RWK AL +A  L G+HL +
Sbjct  135  HECNFKDDPEKVIRWKAALTEAANLSGWHLTS  166



>emb|CAC95127.1| part I of G08 TIR/NBS/LRR protein [Populus deltoides]
Length=226

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D RKTF D L+ +L + GI+TF+DDD L +G+ IS  L  AI+ESK  I 
Sbjct  15   YDVFLSFRGEDTRKTFTDHLYTALVQAGIYTFRDDDELPRGEEISYHLLRAIQESKISIV  74

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSKGYASS+WCL EL  +++C+     QIV+PIFY ++P+ VR Q GS+  +F +  E+
Sbjct  75   VFSKGYASSRWCLNELVEILKCKNGKTGQIVLPIFYDIDPSYVRKQNGSFAEAFVKHEER  134

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
               ++  V+ W++AL +AG L G++L +  N
Sbjct  135  F--EETLVKEWRKALAEAGNLSGWNLNDMAN  163



>ref|XP_006380263.1| hypothetical protein POPTR_0007s00680g [Populus trichocarpa]
 gb|ERP58060.1| hypothetical protein POPTR_0007s00680g [Populus trichocarpa]
Length=377

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 117/171 (68%), Gaps = 4/171 (2%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GI TF+DDD L +G  ISQ L  AI+ESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIQTFRDDDELPRGKEISQHLLEAIQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYA S+WCL+EL  +++C+ +    I +PIFY ++P+DVR Q GS+  +F + HE
Sbjct  74   VVFSKGYA-SRWCLDELVEIIKCKYRKTGHIALPIFYDIDPSDVRKQTGSFAEAFVK-HE  131

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
            +  K  EKV+ W+EAL +AG L G++LK+  N +EA   + +  D+  +L+
Sbjct  132  ERSK--EKVKEWREALEEAGNLSGWNLKDMANGHEAKFIQEIIKDVLTKLD  180



>ref|XP_006478373.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=1239

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RK FI  L+ +L  +GI+ FKDD+ LEKG+ IS  L  AI  S+  
Sbjct  12   WTYDVFLSFRGADTRKNFISHLYAALNGKGIYVFKDDEELEKGESISPRLLKAIEASRIA  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS WCL+EL  +++C+ K  +++V PIFY VEPT VRNQ G+++ +F +  
Sbjct  72   IIVFSKNYASSTWCLDELVHILDCKNKNAQRMVYPIFYDVEPTVVRNQTGNFQEAFAKHV  131

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
            E   K  EKV++W+EAL +   + G+ LK
Sbjct  132  EVFKKSIEKVQKWREALKEVANISGWELK  160



>ref|XP_010646831.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera]
Length=195

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 102/150 (68%), Gaps = 5/150 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GWT+DVFLSFRG D R +F D L  +L  +GI TF+DD +L++G+ I+  L NAI +S+ 
Sbjct  18   GWTHDVFLSFRGEDTRYSFTDHLHNALVGKGIITFRDD-KLKRGEKIAPELLNAIEKSRS  76

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSK YA S+WCL+ELA +MEC  K   QIV+PIFYHV+P+DVR Q G +  +F   
Sbjct  77   SIVVFSKTYAHSRWCLDELAKIMECSRKYG-QIVLPIFYHVDPSDVRKQTGRFGEAFTRY  135

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
             E       KV+ WKEAL + G + G+H+K
Sbjct  136  EENW---KNKVQSWKEALTETGNISGWHVK  162



>gb|AEE43928.1| TIR-NBS-LRR resistance protein muRdr1D [Rosa multiflora]
Length=1156

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D+L+  LER+GI TF+DD +LE+G  IS  L  AI +S+F 
Sbjct  17   WKYDVFLSFRGEDTRKGFTDYLYHELERQGIRTFRDDPQLERGTAISPELLTAIEQSRFA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I V S  YASS WCL EL+ ++EC E  +   ++PIFY V+P+ VR+Q+GS+  +F+E  
Sbjct  77   IIVLSPNYASSTWCLLELSKILECME--ERGTILPIFYEVDPSHVRHQRGSFAEAFQEYE  134

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            EK G+D+E+V  W++AL K   L G+  ++ Y
Sbjct  135  EKFGEDNEEVEGWRDALTKVASLAGWTSESYY  166



>ref|XP_004243783.1| PREDICTED: TMV resistance protein N-like [Solanum lycopersicum]
Length=1147

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 124/178 (70%), Gaps = 6/178 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +LE++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct  16   WSYDVFLSFRGEDVRKTFVDHLYLALEQKCIYTFKDDEKLEKGKFISPELESSIEESRIA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA S WCL+EL  +MEC+  +K QIVVP+FY V+P+ VR QK  +  +F + H
Sbjct  76   LIIFSKNYADSTWCLDELTKIMECK-NVKGQIVVPVFYDVDPSTVRKQKMIFGEAFSK-H  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN---HAS  679
            E   ++D KV++W+ AL +A  + G+ + N  N +EA   E +A DI ARL    HAS
Sbjct  134  EARFQED-KVQKWRAALEEAANISGWDMPNTSNGHEARVIEKIAEDIMARLGSQRHAS  190



>emb|CDP04904.1| unnamed protein product [Coffea canephora]
Length=1201

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG DVRK F+DFL+ SL+++ I+TFKDD++LE+G  IS +L  AI+ES+  
Sbjct  26   WTYDVFLSFRGEDVRKNFVDFLYSSLQQKEIYTFKDDEKLERGRSISPALIQAIKESRIA  85

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS+ YA+S WCL+ELA +++C   L  Q V+P+FY+V+P+ VR QKGS+  +F + H
Sbjct  86   VIIFSENYATSSWCLDELAEIIDCNHVLG-QTVLPVFYYVDPSVVRRQKGSFGRAFVK-H  143

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARL  667
            E   +D E++++W+ AL +A  + G+ + N  + +E+ C + +  D+  +L
Sbjct  144  EDEIEDKERIQKWRAALTEAAAISGWDVPNTADGHESKCIQEIVGDVMVKL  194



>ref|XP_004253177.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A5-like [Solanum lycopersicum]
Length=377

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 110/148 (74%), Gaps = 4/148 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSF G DVRKTF+  L  +L + GI+ F D+ R+E G  I   LP AI+ESKF I 
Sbjct  12   YDVFLSFSGADVRKTFVSHLHNALIQVGINVFIDE-RIETGTSIPHELPKAIKESKFAIV  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FSK YA SKWCL ELA +++C+++L +QIV+PIFY+V+P+DV +Q  S+  +F +  EK
Sbjct  71   IFSKSYAWSKWCLNELAEIIKCRKEL-DQIVIPIFYNVDPSDVSHQTQSFAEAFSKHEEK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
               +DEK++RW+ AL K+G++KG+HL+N
Sbjct  130  Y--EDEKIQRWRGALAKSGKIKGHHLQN  155



>gb|KCW59403.1| hypothetical protein EUGRSUZ_H02116 [Eucalyptus grandis]
Length=214

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 6/156 (4%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG DVR  F+  L+ +L++RGI+T+ D + L KG+ IS +L  AI+ES+  I
Sbjct  47   SYDVFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAI  106

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRN----QKGSYENSFK  505
             VFS+ YASSKWCL+ELA +MEC+E+ +  +V  +FY VEP +VR      + SY  +  
Sbjct  107  VVFSENYASSKWCLDELAEIMECKEQ-RNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMA  165

Query  506  ELHEKIGKDDEKVRRWKEALNKAGQLKGYHL-KNDY  610
            E     GKD EKV+RWK+AL+  G L G+H+ +N+Y
Sbjct  166  EHEVNFGKDSEKVKRWKKALSNVGSLSGWHVTENEY  201



>gb|KCW73586.1| hypothetical protein EUGRSUZ_E02144 [Eucalyptus grandis]
Length=886

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD+FLSFRG D+R  FI  L+++L R G++TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDIFLSFRGADLRNNFIGHLYQALHRDGVYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEEL  ++EC+E+ K  IV+P+FY V+P +VR  + SYE S  +   K
Sbjct  71   VFSEDYASSRWCLEELVKIIECKEQ-KNLIVLPVFYKVDPREVREGRKSYERSLAKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+RWK+AL+ AG L G+HL +
Sbjct  130  FGKDFEKVKRWKKALSDAGNLSGWHLND  157



>emb|CAA08797.1| NL25 [Solanum tuberosum]
Length=533

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 106/152 (70%), Gaps = 6/152 (4%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W Y VFLSFRG D RKTF   LFE L+ RGI TF+DD RLEKGD I + L  AI ES+  
Sbjct  19   WKYHVFLSFRGDDTRKTFTSHLFEGLKHRGIFTFQDDKRLEKGDSIPEELLKAIEESQVA  78

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S+WCL EL  +MEC+E +K+QIV+P+FY V+P+DVR+Q GS+  +F + H
Sbjct  79   LVIFSKNYATSRWCLNELVKIMECKE-VKKQIVMPVFYDVDPSDVRHQTGSFAEAFSK-H  136

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHL  598
            +   KDD    + V+ W+ AL+ A  L G ++
Sbjct  137  KSRYKDDVDGMQMVQGWRTALSAAADLSGTNV  168



>ref|XP_008343950.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=176

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 103/158 (65%), Gaps = 9/158 (6%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F   L ++LE +G  TF D+D L++G+ I   L  AI ES+  
Sbjct  16   WKYDVFLSFRGEDTRKGFTGHLHQALEGKGYKTFIDEDDLKRGEEIKPELLRAIEESRIS  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA S WCL+EL  +MEC+ KL  Q V+PIFYHVE +D+R Q+GS    F++  
Sbjct  76   IIVFSKRYADSSWCLDELVKIMECRSKLG-QHVLPIFYHVETSDIRKQEGSLAPMFQKHE  134

Query  515  EKIGKDDEK--------VRRWKEALNKAGQLKGYHLKN  604
            E I K+D+K        V++W+EAL KA  L G+ LKN
Sbjct  135  EDIRKEDDKNGEAKRKRVKQWREALAKAANLSGHDLKN  172



>ref|XP_006441908.1| hypothetical protein CICLE_v10023272mg, partial [Citrus clementina]
 gb|ESR55148.1| hypothetical protein CICLE_v10023272mg, partial [Citrus clementina]
Length=423

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L+ +L R+ I TF DD +L +GD IS+SL  AI  S   + 
Sbjct  11   YDVFVSFRGEDTRDNFTSHLYSALCRQNIQTFIDD-QLNRGDEISESLVTAIEASAISVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC+++   QIV+P+FY V+P+DVRNQ GS+ +SF +L E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKEYA-QIVIPVFYRVDPSDVRNQTGSFGDSFSKLEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            + ++ EK+R W++AL +A  L G+H  N
Sbjct  129  LKENTEKLRSWRKALKEAASLSGFHSLN  156



>ref|XP_010050815.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=190

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            +G  Y+VFLSFRGPD R +  D L+  L   G+ TF+DD+ L  G+ I   L  AI +SK
Sbjct  2    EGCDYEVFLSFRGPDTRTSITDHLYTRLTEAGVRTFRDDEELRIGEEIGPDLIRAIEQSK  61

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              I +FSK YASSKWCL+ELA ++EC+ K + Q ++PIFY++EP++VR Q G Y ++F  
Sbjct  62   ISIPIFSKNYASSKWCLKELAQIVECR-KSRGQKIMPIFYYIEPSEVRYQTGGYGDAFHS  120

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
              +K   D+E +  WK ALN+ G LKG++++N  N
Sbjct  121  HEKKKRVDEETIPEWKAALNEVGALKGWNIENVAN  155



>gb|KCW59442.1| hypothetical protein EUGRSUZ_H02176 [Eucalyptus grandis]
Length=196

 Score =   151 bits (381),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG DVR  F+  L+ +L++ GI+++ D++ L+KG+ IS +L  AI ES+  I
Sbjct  12   SYDVFLSFRGTDVRNYFLGHLYTALDQSGINSYMDNEDLKKGEQISPALMEAIEESQIAI  71

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSK YASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR Q+  Y  +  +   
Sbjct  72   VVFSKDYASSPWCLEEVAKIMECKEQ-RGLMVFPVFYKVEPREVRGQRQGYAEAMAKHEV  130

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K G+D EKV+RWK+AL   G + G+H  +
Sbjct  131  KFGEDSEKVKRWKKALLDVGSMSGWHFMD  159



>gb|AAT37497.1| N-like protein [Nicotiana tabacum]
Length=941

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L+ RGI TF+D+ RLE G  I + L  AI ES+F 
Sbjct  10   WSYDVFLSFRGEDTRKTFTSHLYEVLKDRGIKTFQDEKRLEYGATIPEELCKAIEESQFA  69

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YA+S+WCL EL  +MEC+ + + Q ++PIFY V+P+ VRNQK S+  +F+E  
Sbjct  70   IVVFSENYATSRWCLNELVKIMECKTQFR-QTIIPIFYDVDPSHVRNQKESFAKAFEEHE  128

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ ALN A  LKG
Sbjct  129  TKYKDDVEGIQRWRTALNAAANLKG  153



>sp|Q40392.1|TMVRN_NICGU RecName: Full=TMV resistance protein N [Nicotiana glutinosa]
 gb|AAA50763.1| N [Nicotiana glutinosa]
Length=1144

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L  +GI TF+DD RLE G  I   L  AI ES+F 
Sbjct  10   WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA  69

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YA+S+WCL EL  +MEC+ + K Q V+PIFY V+P+ VRNQK S+  +F+E  
Sbjct  70   IVVFSENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE  128

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ ALN+A  LKG
Sbjct  129  TKYKDDVEGIQRWRIALNEAANLKG  153



>ref|XP_011013491.1| PREDICTED: TMV resistance protein N-like isoform X5 [Populus 
euphratica]
Length=948

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>ref|XP_011013492.1| PREDICTED: TMV resistance protein N-like isoform X6 [Populus 
euphratica]
Length=935

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>ref|XP_010070567.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=182

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/147 (50%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W +DVFLSFRG DVR+ F+  L   L  RGI+ + D + L  GD IS +L  AI ES+  
Sbjct  26   WPFDVFLSFRGDDVRRGFLADLHRCLLHRGINAYIDSEDLRPGDQISPALTKAIEESRIA  85

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YASS+WCL+EL  VMEC+E LK Q+V+P+FY VEP +VR  + S+  +     
Sbjct  86   VLVFSENYASSRWCLDELVKVMECKE-LKGQLVLPVFYGVEPREVRGHRESFGKALARHE  144

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYH  595
            EK+GKD E+V +W++AL +A  L G+H
Sbjct  145  EKLGKDSERVGKWRQALIEAANLSGWH  171



>gb|ABB82027.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1120

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG + RKTF   L+ +L++ GIHTF+DDD L +G+ IS+ L  AIRESK  I
Sbjct  14   AYDVFLSFRGEETRKTFTGHLYAALDQAGIHTFRDDDELPRGEEISEHLLEAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GS+  +F + HE
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKRKKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDK-HE  132

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  133  EERFEEKLVKEWRKALEDAGNLSGWSLNDMAN  164



>ref|XP_006348979.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=995

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 126/180 (70%), Gaps = 6/180 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSF+G D+RKTF+D L+ +L+++ I+TFKDD++LEKG  IS  L ++I ES+  
Sbjct  16   WSYDVFLSFKGEDIRKTFVDHLYLALQQKCINTFKDDEKLEKGKFISPELESSIEESRIA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FSK YA+S WCL+EL  +MEC+  +K QIVVP+FY V+P+ VR QK  +  +F + H
Sbjct  76   LIIFSKNYANSTWCLDELTKIMECK-NVKGQIVVPVFYDVDPSTVRKQKTIFGEAFSK-H  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN---HASLA  685
            E   ++D KV++W+ AL +A  + G+ L N  N +EA   E +A DI ARL    HAS A
Sbjct  134  EARFQED-KVQKWRAALEEAANISGWDLPNTANGHEARVIEKIAEDIMARLGTQRHASNA  192



>dbj|BAD12594.1| N protein [Nicotiana tabacum]
Length=1128

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L  +GI TF+DD RLE G  I   L  AI ES+F 
Sbjct  2    WSYDVFLSFRGEDTRKTFTSHLYEVLNDKGIKTFQDDKRLEYGATIPGELCKAIEESQFA  61

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YA+S+WCL EL  +MEC+ + K Q V+PIFY V+P+ VRNQK S+  +F+E  
Sbjct  62   IVVFSENYATSRWCLNELVKIMECKTRFK-QTVIPIFYDVDPSHVRNQKESFAKAFEEHE  120

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ ALN+A  LKG
Sbjct  121  TKYKDDVEGIQRWRIALNEAANLKG  145



>ref|XP_006380156.1| hypothetical protein POPTR_0008s22420g, partial [Populus trichocarpa]
 gb|ERP57953.1| hypothetical protein POPTR_0008s22420g, partial [Populus trichocarpa]
Length=174

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK+F D L+ +L  RG+ TF+DD  LE+G+ IS+ L  AI++S+F 
Sbjct  12   WKYDVFLSFRGEDTRKSFTDHLYTALCHRGVITFRDDQELERGNEISRELLQAIQDSRFS  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ Y SS WCL EL  ++EC  K   Q V+P+FY V+P++VRNQ G  + +F + H
Sbjct  72   VIVFSRNYTSSTWCLNELVKIVECM-KQGRQTVIPVFYDVDPSEVRNQTGRLQQAFAD-H  129

Query  515  EKIGKDD-EKVRRWKEALNKAGQLKGYHLKN  604
            E++ KD+ EKV+ W+ A+     L G+ L++
Sbjct  130  EEVFKDNIEKVQTWRIAMKLVANLSGWDLQD  160



>ref|XP_008236760.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=171

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D R  F D L  SL+R+GI+TF D+D LE+G  IS  L  AI+ S   
Sbjct  22   WTYDVFLSFRGEDTRYNFTDHLHSSLDRKGINTFIDNDELERGTDISPVLLKAIQGSMIS  81

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS+ YASS WCL+ELA +++C+E LK+Q+V PIFY V+P+ VR+Q+GS+  +     
Sbjct  82   LIIFSENYASSTWCLDELAHIIQCRE-LKQQLVFPIFYKVDPSHVRHQRGSFGEAIANHE  140

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYH  595
                 D  KV RWK AL +   L G+H
Sbjct  141  CNFKNDMNKVLRWKAALVEVANLSGWH  167



>emb|CAC95124.1| TIR/NBS/LRR protein [Populus deltoides]
Length=1147

 Score =   161 bits (408),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS     AI+ESK  I
Sbjct  38   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHFLRAIQESKISI  97

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
            AVFSKGYASS+WCL EL  +++C+++   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  98   AVFSKGYASSRWCLNELVEILKCKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  157

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  158  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  187



>ref|XP_010644030.1| PREDICTED: uncharacterized protein LOC100253289 [Vitis vinifera]
Length=2539

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RK+F D L+ +L R  IHTF+DD+ L +G+ I+  L  AI ES+  
Sbjct  19   WSYDVFLSFRGEDTRKSFTDHLYSALIRNNIHTFRDDEELPRGEEIAPELLKAIEESRSA  78

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA SKWCLEEL  +M+C+E+ ++ +V+PIFYHV+P+++RNQ   Y  +F   H
Sbjct  79   IIVFSKTYAHSKWCLEELVKIMKCKEEREQMVVIPIFYHVDPSELRNQTEIYGEAFTH-H  137

Query  515  EKIGKDD--EKVRRWKEALNKAGQLKGYHLKNDY  610
            EK   ++  EK+R+WK AL +A  L GY  K+ Y
Sbjct  138  EKNADEERKEKIRKWKIALRQASNLAGYDAKDRY  171



>ref|XP_011013490.1| PREDICTED: TMV resistance protein N-like isoform X4 [Populus 
euphratica]
Length=975

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>ref|XP_011457567.1| PREDICTED: TMV resistance protein N-like [Fragaria vesca subsp. 
vesca]
Length=240

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYDVFLSFRG D RK F D L+ +L ++GIHTF+DD+ L +G+ I+ +L  AI ES++ I
Sbjct  91   TYDVFLSFRGEDTRKNFTDHLYTALWQKGIHTFRDDEELVRGESIAPNLLKAIEESRYVI  150

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGS-YENSFKELH  514
             VFS  YA S WCL+E+A V +C +++  + V+P+FYHV+P++VR Q G  +  +F++  
Sbjct  151  VVFSPNYADSAWCLDEVAEVADCMKEMGTK-VLPVFYHVDPSEVRRQTGEHFGKAFEKHQ  209

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            ++  K+  KV+RWK+AL + G L G+HL++
Sbjct  210  KRYKKEPNKVQRWKDALFQVGNLSGWHLQD  239



>ref|XP_010650377.1| PREDICTED: uncharacterized protein LOC104879391 [Vitis vinifera]
Length=555

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 1/152 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R  F D L+ +L RRGI TF+DDD L++G+ I+  L  AI ES+F 
Sbjct  18   WKYDVFLSFRGEDTRFNFTDHLYANLIRRGIATFRDDDSLKRGEEIAPELLKAIEESRFS  77

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS  YA S+WCL+EL  +M+C++++K QIVVPIFY V+P+ VR+Q G +  +F    
Sbjct  78   LIVFSGNYAGSRWCLDELVKIMKCRKEMK-QIVVPIFYQVDPSHVRHQTGRFGKAFSNYK  136

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            E   +  EKVR W+ AL +A  + G H+K+ Y
Sbjct  137  EDTEEMKEKVRSWRSALTEAANISGEHVKDGY  168



>gb|KCW73616.1| hypothetical protein EUGRSUZ_E02189 [Eucalyptus grandis]
Length=936

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 105/146 (72%), Gaps = 1/146 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L   G++TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGADLRSNFIGHLYQALHHNGVYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ S  +   K
Sbjct  71   VFSEDYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPKEVREGRKSYKRSLGKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHL  598
             GKD EKV+RWK+AL+ AG L G+HL
Sbjct  130  FGKDSEKVKRWKKALSDAGNLSGWHL  155



>ref|XP_010042728.1| PREDICTED: TMV resistance protein N-like, partial [Eucalyptus 
grandis]
Length=156

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 104/155 (67%), Gaps = 1/155 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            +G  Y+VFLSFRGPD R +  D L+  L   G+ TF+DD+ L  G+ I   L  AI +SK
Sbjct  2    EGCDYEVFLSFRGPDTRTSITDHLYTRLTEAGVRTFRDDEELRIGEEIGPDLIRAIEQSK  61

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              I +FSK YASSKWCL+ELA ++EC+ K + Q ++PIFY++EP++VR Q G Y ++F  
Sbjct  62   ISIPIFSKNYASSKWCLKELAQMVECK-KSRGQKIMPIFYYIEPSEVRYQTGGYGDAFHS  120

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
              +K   D+E +  WK ALN+ G LKG++++N  N
Sbjct  121  HEKKKRVDEETIPEWKAALNEIGGLKGWNIENIAN  155



>ref|XP_007226709.1| hypothetical protein PRUPE_ppa020033mg [Prunus persica]
 gb|EMJ27908.1| hypothetical protein PRUPE_ppa020033mg [Prunus persica]
Length=1168

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 107/154 (69%), Gaps = 4/154 (3%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            + W Y VFLSFRG D R  F   L+ +L R GI+TF DDD L +G+ IS +L  AI +SK
Sbjct  15   KSWKYHVFLSFRGFDTRSNFTSHLYSALRREGINTFMDDDELRRGEEISNALLTAIEDSK  74

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              + VFS+ YASSKWCL+EL  +++C+E   +Q+V+P+FY V P+DVRNQ+GS+ ++   
Sbjct  75   ISVVVFSENYASSKWCLDELVKILDCKES-NQQLVIPVFYKVNPSDVRNQRGSFRDALAN  133

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            +      + EKV RWKEAL++AG+L G+ L ++Y
Sbjct  134  MD---CNNLEKVNRWKEALSQAGKLAGFTLSDEY  164



>ref|XP_010070517.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 gb|KCW59328.1| hypothetical protein EUGRSUZ_H02017 [Eucalyptus grandis]
Length=541

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRGPDVRK F+D L+ +L++ GI T+ D + L KG+ IS +L  AI ES+  I 
Sbjct  28   YDVFLSFRGPDVRKNFLDHLYVALDQAGIFTYIDSEELRKGEQISPALMKAIEESQIAIV  87

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCLEEL  +MEC+E+ K   V P+FY VEP +VR Q+ SY  +  +   K
Sbjct  88   VFSEDYASSSWCLEELTKIMECREQ-KGLKVFPVFYKVEPREVRWQRQSYGEAMAKHEVK  146

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
             GKD EKV RWK+AL  AG L G H  + Y
Sbjct  147  FGKDSEKVNRWKKALCDAGNLSGEHFTDGY  176



>ref|XP_010026217.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=924

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 103/145 (71%), Gaps = 1/145 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             Y VFLSFRG DVR  F+  L+  L+R GIHTFKD + L KG+ IS +L  AI ES+  I
Sbjct  7    NYQVFLSFRGTDVRNNFLSHLYADLDRNGIHTFKDSEELRKGEEISPALMTAIEESRVAI  66

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             +FS+ YASS+WCLEELAT+MEC+ + KE IV+P+FY VEP +VR +  +Y  +  +   
Sbjct  67   IIFSEDYASSRWCLEELATIMECKAR-KELIVLPVFYKVEPREVRRRIKAYGRAMAKHET  125

Query  518  KIGKDDEKVRRWKEALNKAGQLKGY  592
            K GKD E+V+RWK+AL+ AG L G+
Sbjct  126  KYGKDSERVKRWKKALSDAGNLSGW  150



>gb|KEH15762.1| disease resistance protein (TIR-NBS-LRR class), partial [Medicago 
truncatula]
Length=166

 Score =   149 bits (377),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YD+FLSFRG D R+     L+++L R+ I TF D++ L+KGD IS +L  AI ES   I 
Sbjct  19   YDIFLSFRGEDTRRNLTSHLYDALSRKKIETFMDNNELQKGDEISAALIKAIEESHASIV  78

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASSKWCL EL  ++EC++ + EQ+V+P+FY+++P +VR Q GSYE +F++    
Sbjct  79   IFSENYASSKWCLNELKKILECKQYM-EQMVIPVFYNLDPANVRKQTGSYEQAFEKHKRD  137

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            +  +++K++ WK AL +A  L G+  +N
Sbjct  138  LKSNNDKLKNWKAALTEAANLVGWDSRN  165



>ref|XP_010058765.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   149 bits (376),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            +DVFLSFRG +VR  F+  L+++L + GI TF D + L KGD IS +L  AI++S   I 
Sbjct  11   HDVFLSFRGTNVRNNFLGHLYKALNQNGISTFVDSEELRKGDQISPALMKAIKQSCVAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASS+WCLEELA +MEC+E+ K+ IV+P+FY V+P  VR  + SY  +  +   K
Sbjct  71   IFSEDYASSQWCLEELAKLMECKEQ-KDLIVLPVFYKVDPRAVRGGRESYGRALTKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GK+ EKV+ WK+AL  AG L G+HL +
Sbjct  130  FGKNSEKVKIWKKALLDAGSLSGWHLND  157



>gb|KCW73976.1| hypothetical protein EUGRSUZ_E02587 [Eucalyptus grandis]
 gb|KCW73977.1| hypothetical protein EUGRSUZ_E02587 [Eucalyptus grandis]
Length=440

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R +FI  L+++L R GI+TF+D D L+KG+ IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGMDLRNSFIGHLYQALHRNGIYTFRDSDELKKGEQISM-LMKAIEESCIAII  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCLEE A +MEC+E+ K+ IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  70   VFSENYASSTWCLEEAAKIMECKEQ-KDLIVLPVFYKVDPKEVRGGRKSYQKAMAKHEFK  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EK++RWK AL   G L G+HL +
Sbjct  129  FGKDSEKLKRWKTALLNVGNLSGWHLND  156



>ref|XP_011013488.1| PREDICTED: TMV resistance protein N-like isoform X2 [Populus 
euphratica]
Length=1127

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>ref|XP_006371227.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
 gb|ERP49024.1| hypothetical protein POPTR_0019s06300g [Populus trichocarpa]
Length=850

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 107/146 (73%), Gaps = 2/146 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS+ L  AI+ESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELSRGEEISKHLLRAIQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +  +QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTDQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYH  595
            +   +++ V+ W++AL ++G L G++
Sbjct  134  RF--EEKLVKEWRKALEESGNLSGWN  157



>ref|XP_006342554.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Solanum tuberosum]
Length=706

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 8/149 (5%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            Y VFLSFRG D R+ F+  L+ +LE+RGI  FKDD+RLE G  I   L  AI ES+F I 
Sbjct  12   YGVFLSFRGIDTRRNFVSHLYNALEQRGIDVFKDDERLETGKSIPNELMKAIEESRFAIV  71

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASS+WCLEELA +++C+ +L +QIV+PIFY V P+DV +Q   +  SF +    
Sbjct  72   IFSESYASSRWCLEELAHIIKCRNEL-DQIVIPIFYDVSPSDVSHQNSPFAESFSKY---  127

Query  521  IGKDD--EKVRRWKEALNKAGQLKGYHLK  601
              KDD  EKV+RW+EA  +AG++ GYHL+
Sbjct  128  --KDDELEKVQRWREACKEAGKISGYHLQ  154



>ref|XP_009779694.1| PREDICTED: TMV resistance protein N-like [Nicotiana sylvestris]
Length=1155

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 99/145 (68%), Gaps = 1/145 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D RKTF   L+E L  RGI TF+DD RLE G  I + L  AI ES+F 
Sbjct  9    WSYDVFLSFRGEDTRKTFTSHLYEVLNDRGIKTFQDDKRLEYGATIPEELCKAIEESQFA  68

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I +FSK YA+S+WCL EL  +MEC+ + + Q V+PIFY V+P+ +RNQK S+  +F+E  
Sbjct  69   IVIFSKNYATSRWCLNELVEIMECKTQFR-QTVIPIFYDVDPSHIRNQKESFAKAFEEHE  127

Query  515  EKIGKDDEKVRRWKEALNKAGQLKG  589
             K   D E ++RW+ AL  A  LKG
Sbjct  128  TKYKDDVEGIKRWRIALTAAANLKG  152



>ref|XP_011013487.1| PREDICTED: TMV resistance protein N-like isoform X1 [Populus 
euphratica]
Length=1128

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>ref|XP_011013489.1| PREDICTED: TMV resistance protein N-like isoform X3 [Populus 
euphratica]
Length=1118

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AIRESK  I
Sbjct  14   AYDVFLSFRGEDNRKTFTDHLYTALVQAGIHTFRDDDALPRGEEISHHLLRAIRESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQTGSFAEAFDKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL  AG L G+ L +  N
Sbjct  134  RF--EEKLVKEWRKALEDAGNLSGWSLNDMAN  163



>ref|XP_010058776.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=191

 Score =   150 bits (378),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            Y+VFLSFRG DVR TF+  L+++L   GI+TF D + L KGD    +L  AI ES   I 
Sbjct  11   YEVFLSFRGTDVRNTFLGHLYKALHHNGIYTFIDSEELRKGDQTLPALMKAIEESFVAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS+WCLEEL  +MEC+E+ K+  V+P+FY V+P +VR    SY  +  +   K
Sbjct  71   VFSKDYASSRWCLEELMKIMECKEQ-KDLTVLPVFYKVDPREVRQGSKSYGKALAKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV RWK+AL  AG L G+H  +
Sbjct  130  FGKDSEKVERWKKALFDAGSLSGWHFND  157



>ref|XP_011011693.1| PREDICTED: TMV resistance protein N-like, partial [Populus euphratica]
Length=1094

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS+ L  AI+ESK  I
Sbjct  42   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISKHLLRAIQESKISI  101

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ K   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  102  VVFSKGYASSRWCLNELVEILKCKRKKPGQIVLPIFYDIDPSDVRKQNGSFALAFDKHGE  161

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G+ L +  N
Sbjct  162  RF--EEKLVKEWRKALEEAGNLSGWSLNDMAN  191



>gb|KCW59447.1| hypothetical protein EUGRSUZ_H02184 [Eucalyptus grandis]
Length=196

 Score =   150 bits (379),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D R  F+  L+ +L++ GI+T+ D + L+KG+ IS +L  AI ES+  I 
Sbjct  13   YDVFLSFRGMDARNYFLGHLYTALDQSGINTYMDSEDLKKGEQISPALMEAIEESQIAIV  72

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK +ASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR Q+  Y  +  +   K
Sbjct  73   VFSKDFASSPWCLEEVAKIMECKEQ-RGLMVFPVFYKVEPREVRGQRQGYAEAMAKHEVK  131

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             G+D EKV+RWK+AL  AG L G+H  +
Sbjct  132  FGEDSEKVKRWKKALLDAGSLSGWHFMD  159



>ref|XP_010026210.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=630

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG DVR  F+  L+  L+R GIHTFKD + L KG+ IS +L  AI +S+  I 
Sbjct  8    YDVFLSFRGMDVRNNFLSHLYADLDRNGIHTFKDSEELRKGEEISPALMTAIEKSRIAII  67

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASS+WCLEELAT MEC+ + KE IV+P+FY VEP +VR +  +Y  +  +   K
Sbjct  68   IFSEDYASSRWCLEELATTMECKAR-KELIVLPVFYKVEPREVRRRIKAYGRAMAKHETK  126

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKND  607
             GKD E V+RWK+AL  AG L G+   N+
Sbjct  127  YGKDLETVKRWKKALFDAGNLSGWDYNNE  155



>ref|XP_009794564.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009794565.1| PREDICTED: TMV resistance protein N-like isoform X1 [Nicotiana 
sylvestris]
Length=1156

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 115/172 (67%), Gaps = 4/172 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++GIHTFKDD+ LEKG  IS  L  AI ES+  
Sbjct  14   WSYDVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDENLEKGKSISPDLMRAIEESRIA  73

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS+ YA+S WCL+EL  +MEC+  L  QIV P+FY V+P+ VR QK S+  +F   H
Sbjct  74   LIIFSRNYANSIWCLDELVKIMECK-NLNGQIVFPVFYDVDPSTVRKQKSSFGEAFSS-H  131

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
            E  G    K+++W+ AL +A  L G  L N  N +EA   + +  DI A+L 
Sbjct  132  EAHGC--FKLQKWRAALEEAANLSGCDLPNTANAHEAKVIKQIVEDILAKLG  181



>ref|XP_002264704.2| PREDICTED: TMV resistance protein N [Vitis vinifera]
Length=1254

 Score =   161 bits (407),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            +TYDVFLSFRG D R TF D L+ +L   GIHTF+DD+ LEKG  I+  L NAI ES+ F
Sbjct  20   FTYDVFLSFRGEDTRSTFTDHLYSALVSNGIHTFRDDEELEKGGVIAGELLNAIEESRIF  79

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I +FSK YA+S WCL EL  + EC     +QI++PIFYHV+P++VR Q G+Y  +F + H
Sbjct  80   IIIFSKDYANSSWCLNELEKITECMATNDQQIILPIFYHVDPSEVRKQTGTYGEAFAD-H  138

Query  515  EKIGKDD--EKVRRWKEALNKAGQLKGY  592
            EK    +  EK+++W+ AL +A  L GY
Sbjct  139  EKDADQEKKEKIQKWRIALTEASNLAGY  166



>gb|KDO42946.1| hypothetical protein CISIN_1g043319mg, partial [Citrus sinensis]
Length=164

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D +  F   L+ +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  18   YDVFVSFRGEDTQDNFTSHLYSTLCRQNIQTFIDD-QLNRGDEISESLVNAIEASDISVI  76

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCL+EL  +++C+++   QIV+P+FY V+P+DVRN+ GS+ +SF +L E+
Sbjct  77   VFSESYASSRWCLDELVKILDCKKEYA-QIVIPVFYRVDPSDVRNRTGSFGDSFSKLAER  135

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            +  + E++R W+ AL +A  L G+H  N
Sbjct  136  LKVNTEELRSWRNALKEAATLSGFHSLN  163



>ref|XP_010665340.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1264

 Score =   161 bits (407),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 115/174 (66%), Gaps = 7/174 (4%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYDVFLSFRG D RK F D L+++L+  GI TF+DD+ LEKG  I+  L  AI ESK FI
Sbjct  17   TYDVFLSFRGEDTRKNFTDHLYKNLDAYGICTFRDDEELEKGRDIAFDLSRAIEESKIFI  76

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             +FSK YA+S+WCL EL  ++E  EK + +IV+PIFYHV P+DVR Q GSY ++F   HE
Sbjct  77   VIFSKNYANSRWCLNELLKIIESMEK-EGKIVLPIFYHVNPSDVRKQLGSYGDAFSN-HE  134

Query  518  KIGKDDEKVR--RWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNH  673
            K   +++K R  +W+ AL+KA  L G+H+   Y        + +  DI  RLNH
Sbjct  135  KDADEEKKARIQKWRTALSKASNLSGWHIDEQYE---TNVLKEITDDIIRRLNH  185



>ref|XP_010058786.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=1038

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 105/146 (72%), Gaps = 1/146 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L   G++TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGADLRSNFIGHLYQALHHNGVYTFRDSEELKKGDQISPVLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++EC+E+ K  IV+P+FY V+P +VR  + SY+ S  +   K
Sbjct  71   VFSEDYASSRWCLEELAKIIECKEQ-KNLIVLPVFYKVDPKEVREGRKSYKRSLGKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHL  598
             GKD EKV+RWK+AL+ AG L G+HL
Sbjct  130  FGKDSEKVKRWKKALSDAGNLSGWHL  155



>ref|XP_006371054.1| hypothetical protein POPTR_0019s03010g, partial [Populus trichocarpa]
 gb|ERP48851.1| hypothetical protein POPTR_0019s03010g, partial [Populus trichocarpa]
Length=870

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D R+TF D L+ +L + GIHTF+DDD L +G+ IS  L  AI ESK  +
Sbjct  14   AYDVFLSFRGEDTRQTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAIHESKISL  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILQCKNRKTNQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  134  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  163



>ref|XP_010057020.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 ref|XP_010057022.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=464

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 104/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R +FI  L+++L R GI+TF+D D L+KG+ IS  L  AI ES   I 
Sbjct  35   YDVFLSFRGMDLRNSFIGHLYQALHRNGIYTFRDSDELKKGEQISM-LMKAIEESCIAII  93

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS WCLEE A +MEC+E+ K+ IV+P+FY V+P +VR  + SY+ +  +   K
Sbjct  94   VFSENYASSTWCLEEAAKIMECKEQ-KDLIVLPVFYKVDPKEVRGGRKSYQKAMAKHEFK  152

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EK++RWK AL   G L G+HL +
Sbjct  153  FGKDSEKLKRWKTALLNVGNLSGWHLND  180



>ref|XP_010648148.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=1250

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 109/153 (71%), Gaps = 4/153 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GW++DVFLSFRG D R TF D L  +L ++ I TF+DD+ L++G+ I  S+  AI ES+ 
Sbjct  13   GWSWDVFLSFRGEDTRFTFTDHLHSALRQKRIRTFRDDEGLDRGEEIGSSILKAIEESRM  72

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
            +I VFS  YA SKWCL+ELA +MEC+ + K Q VVP+FYHVEP+DVRNQ GS+  +F + 
Sbjct  73   YIVVFSNTYAHSKWCLDELAKIMECKIQ-KGQTVVPVFYHVEPSDVRNQTGSFGEAFDK-  130

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            ++K+   + K+ RWK AL  A  L G+H+++ Y
Sbjct  131  YQKV--PEHKLMRWKAALRHAANLSGWHVQHGY  161



>ref|XP_008228037.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=490

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 1/151 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYD FLSFRG D RK F D L+ +LE  GIHTF+DDD +E+G  IS  L  AI+ES+  I
Sbjct  16   TYDAFLSFRGTDTRKGFTDHLYRALEVAGIHTFRDDDEIERGANISAELQKAIQESRVSI  75

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSK YASS+WCL+EL T+M+ +E   E +V+PIFY V+P+ VRNQ G +E +F    +
Sbjct  76   IVFSKDYASSRWCLDELVTIMDRRET-NEHMVMPIFYDVDPSHVRNQTGIFEEAFARHQQ  134

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            +  K+ +KV +WK+AL     L G  L + Y
Sbjct  135  RFNKEMDKVEKWKKALRDVADLGGMVLGDRY  165



>ref|XP_009794566.1| PREDICTED: TMV resistance protein N-like isoform X2 [Nicotiana 
sylvestris]
Length=1107

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 4/171 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG DVRKTF+D L+ +L+++GIHTFKDD+ LEKG  IS  L  AI ES+  
Sbjct  14   WSYDVFLSFRGEDVRKTFVDHLYVALQQKGIHTFKDDENLEKGKSISPDLMRAIEESRIA  73

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS+ YA+S WCL+EL  +MEC+  L  QIV P+FY V+P+ VR QK S+  +F   H
Sbjct  74   LIIFSRNYANSIWCLDELVKIMECK-NLNGQIVFPVFYDVDPSTVRKQKSSFGEAFSS-H  131

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARL  667
            E  G    K+++W+ AL +A  L G  L N  N +EA   + +  DI A+L
Sbjct  132  EAHGC--FKLQKWRAALEEAANLSGCDLPNTANAHEAKVIKQIVEDILAKL  180



>ref|XP_006492482.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=164

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YD FLSFRG D RK+FI  L+ +L  +GI+ FKDD  LE+G  IS  L  AI +S+  
Sbjct  12   WPYDAFLSFRGADTRKSFISHLYAALNGKGIYVFKDDKELERGASISPGLLKAIEDSRIS  71

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLK-EQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
            I VFS+ YASS WCL+EL  +++C+ K   +Q++ PIFY VEPT VR Q GS+  +F + 
Sbjct  72   IIVFSQNYASSTWCLDELVKIVQCKNKNDHQQMIFPIFYDVEPTVVRKQTGSFREAFSKH  131

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
             E   ++ EKV+ W++AL +   + G+ LK
Sbjct  132  EEAYRENLEKVKNWRDALKEVANISGWELK  161



>ref|XP_006494655.1| PREDICTED: putative disease resistance protein At4g11170-like 
isoform X1 [Citrus sinensis]
 ref|XP_006494656.1| PREDICTED: putative disease resistance protein At4g11170-like 
isoform X2 [Citrus sinensis]
Length=644

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 106/148 (72%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L+ +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  11   YDVFVSFRGEDTRDNFTSHLYSALCRQNIQTFIDD-QLNRGDEISESLANAIEASAISVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC++    QIV+P+FY V+P+DVRNQ GS+ +SF +L E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKDYV-QIVIPVFYRVDPSDVRNQTGSFGDSFSKLEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            + ++ EK+R W++AL +A  L G+H  N
Sbjct  129  LKENTEKLRTWRKALKEAASLSGFHSLN  156



>ref|XP_010070572.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=281

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 105/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG DVR  F+  L+ +L++RGI+T+ D + L KG+ IS +L  AI+ES+  I
Sbjct  105  SYDVFLSFRGTDVRNNFLGHLYIALDQRGINTYIDSEELRKGEQISPALMEAIKESQIAI  164

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRN----QKGSYENSFK  505
             VFS+ YASSKWCL+ELA +MEC+E+ +  +V  +FY VEP +VR      + SY  +  
Sbjct  165  VVFSENYASSKWCLDELAEIMECKEQ-RNLVVFSVFYKVEPREVRTPGKGDRQSYGKAMA  223

Query  506  ELHEKIGKDDEKVRRWKEALNKAGQLKGYHLKND  607
            E     GKD EKV+RWK+AL+  G L G+H+  +
Sbjct  224  EHEVNFGKDSEKVKRWKKALSNVGSLSGWHVTEN  257



>gb|KGN59549.1| hypothetical protein Csa_3G824940 [Cucumis sativus]
Length=631

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 106/153 (69%), Gaps = 3/153 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            WTYDVFLSFRG D RK F D L+ +L+  GI+ F+DD  L++G+ IS  L  AI  SK  
Sbjct  52   WTYDVFLSFRGEDTRKNFTDHLYYALKDAGINVFRDDPELQRGEDISSGLERAIEGSKVA  111

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YA S WCLEEL  +MEC+  L+ Q+V+P+FY+V+P+ VR QKG +E +F + H
Sbjct  112  VIVFSERYAESGWCLEELVKIMECRRTLR-QMVLPVFYNVDPSCVRKQKGEFEEAFVK-H  169

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            EK GKD +KVRRW+ AL +A  + G  L  + N
Sbjct  170  EK-GKDIDKVRRWRMALTEAANVAGLGLTQNAN  201



>ref|XP_010650378.1| PREDICTED: toll/interleukin-1 receptor-like protein [Vitis vinifera]
Length=164

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 101/148 (68%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            +DVFLSFRG D R  F D  +E+L RRGIHTF+DD  LE+G+ I   L  AI ES+F + 
Sbjct  18   FDVFLSFRGEDTRFNFTDHFYENLIRRGIHTFRDDS-LERGEEIEPELLKAIEESRFSLI  76

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YA S+WCL+EL  +M+C++++K Q VVPIFYHV+P+ VRNQ G +  +F    E 
Sbjct  77   VFSENYAGSRWCLDELVKIMKCKKEMK-QTVVPIFYHVDPSLVRNQTGRFGEAFSNYKED  135

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              +  EKVR W+ AL +A  +   H+K+
Sbjct  136  TEEMKEKVRSWRSALTEATNISEEHVKD  163



>ref|XP_008344573.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
 ref|XP_008344574.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
 ref|XP_008344575.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
 ref|XP_008344576.1| PREDICTED: TMV resistance protein N-like [Malus domestica]
Length=172

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 100/149 (67%), Gaps = 3/149 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W+YDVFLSFRG D R  F   L E+L+ RG H F D+D L++G+ I + L  AI ES+  
Sbjct  22   WSYDVFLSFRGEDTRNGFTSHLHEALKYRGCHVFIDEDDLKRGEGIKEKLFRAIEESRIS  81

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YA S WCL+EL  +M+C++KL    V+PIFYHV+P+ VR Q G    +F +  
Sbjct  82   IVVFSKTYADSSWCLDELVKIMDCRDKLGRH-VLPIFYHVDPSHVRKQDGDLAEAFHKHE  140

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLK  601
            E+   D E++++W+EAL +A  L G+HL+
Sbjct  141  EE--DDKERLKQWREALTEAANLAGHHLQ  167



>ref|XP_006371041.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
 gb|ERP48838.1| hypothetical protein POPTR_0019s02900g [Populus trichocarpa]
Length=1147

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ I   L  AI+ESK  I
Sbjct  14   TYDVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEIHDHLLRAIQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV PIFY+++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVQPIFYNIDPSDVRKQNGSFAKAFVKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  134  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  163



>gb|KEH38848.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1193

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q + Y VF+SFRGPD R +F+D L+  L R+GI  FKDD  LEKG+ IS  L  AIR S+
Sbjct  40   QSYKYGVFISFRGPDTRNSFVDHLYAHLTRKGIFAFKDDKSLEKGEFISPQLLQAIRNSR  99

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
             FI VFSK YA S WCLEE+A + +C E  K Q V PIFY V+P+DVR Q G Y+N F  
Sbjct  100  IFIVVFSKTYAESTWCLEEMAAIADCCEYFK-QTVFPIFYDVDPSDVRKQSGVYQNDFVL  158

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              +K  +D +KV RW +A+ +  +L G+ ++N
Sbjct  159  HKKKFTRDPDKVVRWTKAMGRLAELVGWDVRN  190



>ref|XP_006355113.1| PREDICTED: TMV resistance protein N-like isoform X1 [Solanum 
tuberosum]
Length=1124

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W Y VFLSFRG D RKTF   L+E L+ RGI TF+DD RLE GD I + L  AI ES+  
Sbjct  17   WKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFSK YA+S+WCL EL  +MEC+++   Q V+PIFY V+P+ VRNQ  S+  +F E H
Sbjct  77   LIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAE-H  135

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD    +KV+RW+ AL  A  LKGY +++
Sbjct  136  ELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRD  169



>ref|XP_006388458.1| hypothetical protein POPTR_0182s00230g [Populus trichocarpa]
 gb|ERP47372.1| hypothetical protein POPTR_0182s00230g [Populus trichocarpa]
Length=169

 Score =   149 bits (375),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 101/152 (66%), Gaps = 3/152 (2%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D L+ + +  GI+TF+DD+ L +G+ IS  L  AI++S+  
Sbjct  15   WIYDVFLSFRGEDTRKNFTDHLYFAFKDAGINTFRDDNELRRGEDISTELLQAIQKSRIS  74

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFS+ YA+S+WCLEEL  +MEC+   + Q+V PIFY V+P+DVR Q GS+  +F    
Sbjct  75   VIVFSRNYANSRWCLEELVKIMECRRSCR-QLVFPIFYDVDPSDVRKQTGSFAEAFAGHE  133

Query  515  EK--IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            E+  +  D  KV  W+ AL +A  L G+ L+N
Sbjct  134  ERFVLQTDKGKVATWRMALTEAANLSGWDLRN  165



>ref|XP_006355114.1| PREDICTED: TMV resistance protein N-like isoform X2 [Solanum 
tuberosum]
Length=1123

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W Y VFLSFRG D RKTF   L+E L+ RGI TF+DD RLE GD I + L  AI ES+  
Sbjct  17   WKYVVFLSFRGEDTRKTFTGHLYEGLKNRGISTFQDDKRLEHGDSIPKELLRAIEESQVA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFSK YA+S+WCL EL  +MEC+++   Q V+PIFY V+P+ VRNQ  S+  +F E H
Sbjct  77   LIVFSKNYATSRWCLNELVKIMECKDEENGQTVIPIFYDVDPSHVRNQSESFGAAFAE-H  135

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD    +KV+RW+ AL  A  LKGY +++
Sbjct  136  ELKYKDDVEGMQKVQRWRNALTVAANLKGYDIRD  169



>gb|ABB82029.1| TIR-NBS disease resistance-like protein [Populus trichocarpa]
Length=1147

 Score =   160 bits (405),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ I   L  AI+ESK  I
Sbjct  14   TYDVFLSFRGKDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEIHDHLLRAIQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV PIFY+++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVQPIFYNIDPSDVRKQNGSFAKAFVKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  134  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  163



>ref|XP_010646175.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera]
Length=546

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/153 (51%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
            GWTYDVFLSFRG D R  F D L+  L R+GI  F+DD +L++G+ I+  L NAI +S+ 
Sbjct  18   GWTYDVFLSFRGEDTRNNFTDHLYTDLVRKGIRIFRDD-KLKRGEKIAPELLNAIEKSRS  76

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             I VFSK YA S+WCL+ELA +MEC+ +  ++ V+PIFYHV+P+DVR Q GS+  +F  +
Sbjct  77   SIVVFSKSYADSRWCLDELAKIMECRREYGQK-VLPIFYHVDPSDVRKQTGSFGEAFT-M  134

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            +E+  K+  KVR W+EAL +A  L G+H+   Y
Sbjct  135  YEETWKN--KVRSWREALTEASNLSGWHVNEGY  165



>gb|KCW59177.1| hypothetical protein EUGRSUZ_H01824 [Eucalyptus grandis]
Length=163

 Score =   148 bits (374),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG +VR  F+  L+ +L++ G+ T+ D + L KG+ IS +L  AI ES+  I
Sbjct  15   NYDVFLSFRGINVRNNFLSHLYTALDQNGLFTYLDSEELRKGEQISPALMKAIEESQVVI  74

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCLEE+A +MEC+ + K+ IV+P+FY VEP +VR  + SY  +  +   
Sbjct  75   IVFSEDYASSPWCLEEVAKIMECKIQ-KDLIVLPVFYKVEPREVRGGRESYGRAMVKHES  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GK+ EKVRRWKEAL  AG L  +HL +
Sbjct  134  KFGKESEKVRRWKEALFDAGSLSRWHLND  162



>ref|XP_006371049.1| hypothetical protein POPTR_0019s02970g, partial [Populus trichocarpa]
 gb|ERP48846.1| hypothetical protein POPTR_0019s02970g, partial [Populus trichocarpa]
Length=962

 Score =   159 bits (403),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  A++ESK  I
Sbjct  14   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISI  73

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  74   VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  133

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G +L +  N
Sbjct  134  R--SEEKLVKEWRKALEEAGNLSGRNLNDMAN  163



>gb|KDO43806.1| hypothetical protein CISIN_1g0018052mg, partial [Citrus sinensis]
Length=522

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D L+ +L+++GI  F+DD  LE+G+ IS  L  AI ESK  
Sbjct  17   WKYDVFLSFRGVDTRKNFTDHLYTALDQKGIIVFRDDKELERGESISPGLFKAIEESKIS  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFS+ YA S WCL+EL  ++EC+ K  +Q+V PIFY VEPTDVR Q G  E  F    
Sbjct  77   IIVFSRNYACSTWCLDELVHILECKNKNHQQMVYPIFYDVEPTDVRKQSGILEAVFARHE  136

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            E + ++ EKV++W++ L +   + G+ LK+
Sbjct  137  EILAQNKEKVQKWRDTLKEVANICGWELKD  166



>gb|KCW73956.1| hypothetical protein EUGRSUZ_E02550, partial [Eucalyptus grandis]
Length=898

 Score =   159 bits (403),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R G++TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGADLRNNFIGHLYQALHRDGVYTFRDSEELKKGDQISPVLTKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YASS+WCLEELA ++E +E+ K  IV+P+FY V+P +VR  + SY+ S  +   K
Sbjct  71   VFSEDYASSRWCLEELAKIIESKEQ-KNLIVLPVFYKVDPREVREGRKSYKTSLAKHEFK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            +G D EKV+RWK+AL+ AG L G+HL N
Sbjct  130  LGNDFEKVKRWKKALSDAGNLSGWHLNN  157



>ref|XP_010058762.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=412

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG +VRK+F+  L+ +L++ GI+TF+D + L KGD IS +L  AI ES   I 
Sbjct  11   YDVFLSFRGTNVRKSFLSHLYRALDQNGIYTFQDSEELRKGDQISTTLMKAIEESCIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASS WCLEE+A +MEC+E+ K+  V+P+FY V+P +VR  + SY  +  +  +K
Sbjct  71   IFSEDYASSWWCLEEMAKIMECREQ-KDLTVLPVFYKVDPREVREGRESYRKALDKHEDK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKND  607
              KD EKV++WK+AL  AG L G+HL ++
Sbjct  130  FRKDPEKVKKWKKALFDAGNLSGWHLNDE  158



>ref|XP_010070386.1| PREDICTED: TMV resistance protein N-like isoform X3 [Eucalyptus 
grandis]
Length=806

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRGPDVRK+F+   + +L+++G +T+ D + L+KGDCI  +L  AI +S+  I 
Sbjct  48   YDVFLSFRGPDVRKSFLSHFYAALDQKGFYTYIDSEELQKGDCIKPALMKAIEDSRIAII  107

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            +FS+ YASS+WCLEE+A +MEC+ K ++  V P+FY V+P +VR  + SYE +  E   K
Sbjct  108  IFSENYASSRWCLEEVAKIMECK-KQRDLTVFPVFYKVDPGEVRTPRESYEKAMVEHERK  166

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             G+D ++V+RWK AL  AG L G+ LK+
Sbjct  167  FGRDSDEVKRWKNALFDAGSLSGWDLKD  194



>ref|XP_010070522.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=529

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRGPDVR  F+  L+ +L++ GI T+ D++ L KG+ IS +L  AI ES+  I
Sbjct  72   SYDVFLSFRGPDVRNHFLSHLYAALDQVGISTYIDNEELRKGEQISPALMKAIEESQIAI  131

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YASS WCLEE++ +MEC+EK K   V+P+FY VEP +VR QK SY  +  E   
Sbjct  132  VVFSENYASSTWCLEEISKIMECKEK-KGLKVLPVFYKVEPREVRGQKQSYGKAMGEHEI  190

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            K GK+ E+V+RWK+AL  AG L G+   + Y
Sbjct  191  KFGKNSEQVKRWKKALYDAGGLSGWPYTDGY  221



>ref|XP_006494647.1| PREDICTED: TMV resistance protein N-like [Citrus sinensis]
Length=377

 Score =   154 bits (389),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L+ +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  11   YDVFVSFRGEDTRDNFTSHLYSALSRQNIQTFIDD-QLNRGDEISESLVNAIEASAISVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC+++   QIV+P+FY V+P+D RNQ G +  SF +L E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKEYA-QIVIPVFYRVDPSDARNQTGPFGISFSKLEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              ++ EK+R W++AL +A  L G+H  N
Sbjct  129  FKENTEKLRTWRKALKEAASLSGFHSLN  156



>ref|XP_006370854.1| hypothetical protein POPTR_0019s00940g [Populus trichocarpa]
 gb|ERP48651.1| hypothetical protein POPTR_0019s00940g [Populus trichocarpa]
Length=183

 Score =   149 bits (376),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 100/153 (65%), Gaps = 6/153 (4%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D L+ +L         DD+ L +G+ IS  L  AI  S+  
Sbjct  21   WNYDVFLSFRGEDTRKNFTDHLYTAL-----GNVWDDNELPRGEEISPQLLKAIEGSRIS  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I VFSK YASS+WCL+EL  ++EC++K+  Q+V+PIFY  EP+DVR Q GSY  +F E  
Sbjct  76   IVVFSKHYASSRWCLDELVKIIECRQKIG-QVVLPIFYDTEPSDVRKQTGSYAKAFDEHE  134

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            E+  ++ EKV +W+ AL +AG L G+ L N+ N
Sbjct  135  ERFKEEMEKVNKWRGALAQAGNLSGFGLNNEAN  167



>emb|CAN78476.1| hypothetical protein VITISV_009816 [Vitis vinifera]
Length=826

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 106/150 (71%), Gaps = 4/150 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            +DVFLSFRG D R  F D L+ +L  RGIHTF+DD+ LE+G  I  SL  AI ESK  I 
Sbjct  13   WDVFLSFRGEDTRXNFTDHLYSALTSRGIHTFRDDEGLERGGEIQPSLLKAIEESKVSIV  72

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YA S+WCL+EL  +ME + + K QIVVP+FYHV+P+DVR Q GS+  +F   ++K
Sbjct  73   VFSKNYAHSQWCLDELYKIMESRRE-KGQIVVPVFYHVDPSDVRKQTGSFGKAFAR-YKK  130

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            + K  E+V RW+ AL +AG L G+H+++ Y
Sbjct  131  VTK--ERVLRWRAALTQAGGLSGWHVEHGY  158



>gb|AEI27416.1| TIR_3 [Helianthus annuus]
Length=1111

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 115/173 (66%), Gaps = 4/173 (2%)
 Frame = +2

Query  152  GWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKF  331
             W ++VFLSFRG D RK F+D L++ L ++GIHT+KDD  L +G+ I  +L  AI+ES+ 
Sbjct  74   AWNHEVFLSFRGEDTRKNFVDHLYKDLVQQGIHTYKDDQTLPRGESIGPALLKAIQESRI  133

Query  332  FIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKEL  511
             + VFS+ YA S WCL+ELA  MEC +    QIV+PIFYHV+P+DVR QKG Y  +  + 
Sbjct  134  ALVVFSQNYADSSWCLDELAHTMECVDT-NGQIVIPIFYHVDPSDVRKQKGKYGKALSK-  191

Query  512  HEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLN  670
            HE+  K+ +KV  W+ AL KAG L G+ + N  N +EA C   +   I +RL+
Sbjct  192  HER--KNKQKVESWRNALEKAGNLSGWVINNTENSHEAKCISDIVGTISSRLS  242



>ref|XP_010058821.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
Length=158

 Score =   148 bits (373),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            Y+VFLSFRG D+R TF+  L+++L   GI+TF D + L KG+ I  +L  AI ES   I 
Sbjct  11   YEVFLSFRGTDLRNTFLSHLYKALHHNGIYTFIDSEELRKGNQILPTLMKAIEESLIAII  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS+WCLEEL  +MEC+E+ K+  V+P+FY V+P +VR    SY  +  +   K
Sbjct  71   VFSKDYASSRWCLEELMKIMECKEQ-KDLTVLPVFYKVDPREVRRGSKSYGKALAKHETK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GKD EKV+ WK+AL  AG L G+H  +
Sbjct  130  FGKDSEKVKLWKKALFDAGSLSGWHFND  157



>gb|ADL36719.1| HD domain class transcription factor [Malus domestica]
Length=184

 Score =   149 bits (375),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
              WTYDVFLSFRG D R  F+  L+ +L ++G  TF DD+ L++G+ IS +L  AI +S+
Sbjct  19   HSWTYDVFLSFRGEDTRYNFVGHLYNNLVQKGFKTFIDDEALKRGEEISSALLKAIEQSR  78

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              + VFS+ YASS+WCL+EL  +  C+E+L +Q+V P+FY V+P+DVRNQ+ S+  +  +
Sbjct  79   ISVVVFSENYASSRWCLDELVHIFHCKEQL-QQMVFPVFYKVDPSDVRNQRKSFGKALVD  137

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKND  607
               K+  + +KV RW+E L KA  L G+    D
Sbjct  138  HESKLKDNMDKVLRWRETLTKAANLSGWSFLAD  170



>ref|XP_003596679.1| TIR-NBS-LRR type disease resistance protein [Medicago truncatula]
Length=1406

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q + Y VF+SFRGPD R +F+D L+  L R+GI  FKDD  LEKG+ IS  L  AIR S+
Sbjct  253  QSYKYGVFISFRGPDTRNSFVDHLYAHLTRKGIFAFKDDKSLEKGEFISPQLLQAIRNSR  312

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
             FI VFSK YA S WCLEE+A + +C E  K Q V PIFY V+P+DVR Q G Y+N F  
Sbjct  313  IFIVVFSKTYAESTWCLEEMAAIADCCEYFK-QTVFPIFYDVDPSDVRKQSGVYQNDFVL  371

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              +K  +D +KV RW +A+ +  +L G+ ++N
Sbjct  372  HKKKFTRDPDKVVRWTKAMGRLAELVGWDVRN  403



>ref|XP_010070408.1| PREDICTED: TMV resistance protein N-like [Eucalyptus grandis]
 gb|KCW59172.1| hypothetical protein EUGRSUZ_H01809 [Eucalyptus grandis]
Length=264

 Score =   151 bits (382),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 101/151 (67%), Gaps = 1/151 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            +YDVFLSFRG DVR  F+  L+ +L + GI+T+ D + L KG+ IS +L   I ES+  I
Sbjct  105  SYDVFLSFRGTDVRNYFLGHLYTALVQSGINTYMDSEDLNKGEQISPALMETIEESQIAI  164

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSK YASS WCLEE+A +MEC+E+ +  +V P+FY VEP +VR Q+  Y  +  +   
Sbjct  165  IVFSKDYASSPWCLEEVAKIMECKEQ-RGLMVFPVFYKVEPREVRGQRQGYAKAMAKFVV  223

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            K G+D EKV+ WK+AL  AG L G+H  + Y
Sbjct  224  KFGEDSEKVKLWKKALLDAGSLSGWHFMDGY  254



>ref|XP_006371047.1| hypothetical protein POPTR_0019s02950g [Populus trichocarpa]
 gb|ERP48844.1| hypothetical protein POPTR_0019s02950g [Populus trichocarpa]
Length=678

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  AI+ESK  I
Sbjct  42   AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAIQESKISI  101

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+ VR Q GS+  +F +  E
Sbjct  102  VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSYVRKQDGSFAEAFVKHEE  161

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  162  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  191



>gb|KCW73973.1| hypothetical protein EUGRSUZ_E02576 [Eucalyptus grandis]
Length=220

 Score =   150 bits (378),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 98/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             Y+VFLSFRG D+R TF+  L+++L   GIHTF D + L KGD    +L  AI ES   I
Sbjct  10   NYEVFLSFRGTDIRNTFLGHLYKALHHNGIHTFIDSEELRKGDQTLPALMKAIEESFIAI  69

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSK YASS+WCLEEL  +MEC+E+ K+  V+P+FY V+P +VR    SY  +  +   
Sbjct  70   IVFSKDYASSRWCLEELMKIMECKEQ-KDLTVLPVFYKVDPREVRQGSKSYGKALAKHES  128

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K GKD EKV +WK+AL  AG L G+H  +
Sbjct  129  KFGKDSEKVEQWKKALFNAGSLSGWHFND  157



>ref|XP_006370864.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
 gb|ERP48661.1| hypothetical protein POPTR_0019s01170g [Populus trichocarpa]
Length=1058

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L++ GI  F+DDD L +G+ IS  L  AI+ESK  I
Sbjct  51   AYDVFLSFRGEDTRKTFTDHLYAALDQAGIRAFRDDDELPRGEEISDHLLRAIQESKISI  110

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  ++EC+++   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  111  VVFSKGYASSRWCLNELVEILECKKRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  170

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G++L +  N
Sbjct  171  RF--EEKLVKEWRKALEEAGNLSGWNLNDMAN  200



>gb|AAL07544.1| resistance gene analog NBS9 [Helianthus annuus]
Length=304

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 103/144 (72%), Gaps = 4/144 (3%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            ++VFLSFRG D RK F+D L++ L ++GI T+KDD+ L +G+ I  +L  AI+ES F + 
Sbjct  46   HEVFLSFRGEDTRKNFVDHLYKDLVQQGIQTYKDDETLPRGERIGPALLKAIQESHFAVV  105

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+ YA S WCL+ELA +MEC +  + QIV+PIFYHV+P+DVR Q G Y  +F + HE+
Sbjct  106  VFSENYADSSWCLDELAHIMECVDT-RGQIVIPIFYHVDPSDVRKQNGKYGKAFTK-HER  163

Query  521  IGKDDEKVRRWKEALNKAGQLKGY  592
              K+ +KV  W+ AL KAG L G+
Sbjct  164  --KNKQKVESWRNALEKAGNLSGW  185



>gb|AES66930.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1282

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            Q + Y VF+SFRGPD R +F+D L+  L R+GI  FKDD  LEKG+ IS  L  AIR S+
Sbjct  129  QSYKYGVFISFRGPDTRNSFVDHLYAHLTRKGIFAFKDDKSLEKGEFISPQLLQAIRNSR  188

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
             FI VFSK YA S WCLEE+A + +C E  K Q V PIFY V+P+DVR Q G Y+N F  
Sbjct  189  IFIVVFSKTYAESTWCLEEMAAIADCCEYFK-QTVFPIFYDVDPSDVRKQSGVYQNDFVL  247

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              +K  +D +KV RW +A+ +  +L G+ ++N
Sbjct  248  HKKKFTRDPDKVVRWTKAMGRLAELVGWDVRN  279



>ref|XP_008222878.1| PREDICTED: TMV resistance protein N-like, partial [Prunus mume]
Length=558

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W + VFLSFRG D R  F   L+ +L ++GI+TF DDD L +G+ IS +L  AI +SK F
Sbjct  21   WKHHVFLSFRGLDTRSNFTGHLYNALCQQGINTFMDDDELRRGEEISSTLLTAIEDSKIF  80

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFSK YASSKWCLEEL  +++C+ K ++Q+V+P+FY V P+DVRN +GS+ ++   + 
Sbjct  81   VVVFSKNYASSKWCLEELVKILDCK-KSEQQLVIPVFYKVNPSDVRNHRGSFGDALANVE  139

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHL  598
             K   + EKV+RW+EAL++   L G+ L
Sbjct  140  CKYKDNMEKVKRWREALSQVANLSGFTL  167



>gb|AAA91021.1| L6tr [Linum usitatissimum]
Length=705

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            Y+VFLSFRGPD R+ F DFL++SL R  IHTF+DDD L KG  I  +L  AI +SK ++ 
Sbjct  61   YEVFLSFRGPDTREQFTDFLYQSLRRYKIHTFRDDDELLKGKEIGPNLLRAIDQSKIYVP  120

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            + S GYA SKWCL ELA ++  QE+   +I++PIFY V+P+DVR+Q G Y+ +F++   K
Sbjct  121  IISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMVDPSDVRHQTGCYKKAFRKHANK  180

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHL-KND  607
               D + ++ WK+AL K G LKG+H+ KND
Sbjct  181  F--DGQTIQNWKDALKKVGDLKGWHIGKND  208



>gb|ABF81459.1| TIR-NBS type disease resistance protein [Populus trichocarpa]
Length=1421

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRG D RKTF D L+ +L + GIHTF+DDD L +G+ IS  L  A++ESK  I
Sbjct  203  AYDVFLSFRGEDTRKTFTDHLYTALVQAGIHTFRDDDELPRGEEISDHLLRAVQESKISI  262

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFSKGYASS+WCL EL  +++C+ +   QIV+PIFY ++P+DVR Q GS+  +F +  E
Sbjct  263  VVFSKGYASSRWCLNELVEILKCKNRKTGQIVLPIFYDIDPSDVRKQNGSFAEAFVKHEE  322

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDYN  613
            +   +++ V+ W++AL +AG L G +L +  N
Sbjct  323  R--SEEKLVKEWRKALEEAGNLSGRNLNDMAN  352



>gb|KCW59105.1| hypothetical protein EUGRSUZ_H01726 [Eucalyptus grandis]
Length=841

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
             YDVFLSFRGPDVRK+F+   + +L+++G +T+ D + L+KGDCI  +L  AI +S+  I
Sbjct  10   NYDVFLSFRGPDVRKSFLSHFYAALDQKGFYTYIDSEELQKGDCIKPALMKAIEDSRIAI  69

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             +FS+ YASS+WCLEE+A +MEC+++ ++  V P+FY V+P +VR  + SYE +  E   
Sbjct  70   IIFSENYASSRWCLEEVAKIMECKKQ-RDLTVFPVFYKVDPGEVRTPRESYEKAMVEHER  128

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            K G+D ++V+RWK AL  AG L G+ LK+
Sbjct  129  KFGRDSDEVKRWKNALFDAGSLSGWDLKD  157



>ref|XP_003526343.1| PREDICTED: TMV resistance protein N-like [Glycine max]
Length=1464

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +2

Query  149  QGWTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESK  328
            +GWTYDVFLSFRG D R+TF   L+  L +RGI+ F DD++L +G+ IS +L  AI ES+
Sbjct  16   RGWTYDVFLSFRGEDTRRTFTGSLYHGLHQRGINVFIDDEKLRRGEEISPALIGAIEESR  75

Query  329  FFIAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKE  508
              I VFS+ YASS WCL+ELA ++EC  K + Q+V P+F+HV+P+ VR+Q+GS+  +  +
Sbjct  76   IAIIVFSQNYASSTWCLDELAKILECY-KTRGQLVWPVFFHVDPSAVRHQRGSFATAMAK  134

Query  509  LHEKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
              ++   D +K+++WK AL +A  L G+ LKN Y
Sbjct  135  HEDRFKGDVQKLQKWKMALFEAANLSGWTLKNGY  168



>ref|XP_008236673.1| PREDICTED: TMV resistance protein N-like [Prunus mume]
Length=220

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 100/151 (66%), Gaps = 2/151 (1%)
 Frame = +2

Query  158  TYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFI  337
            TYDVFLSFRG D RK F   L+ +L ++GI TF DDD L +G+ IS +L  AI ES   I
Sbjct  47   TYDVFLSFRGEDTRKNFTGHLYSNLVQKGIKTFIDDD-LSRGEEISLALLKAIEESMVSI  105

Query  338  AVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHE  517
             VFS+ YA+SKWCL+EL  ++EC+E  K Q+V P+FY V+P+DVRNQ+GS+  +      
Sbjct  106  VVFSENYAASKWCLDELVKILECKES-KNQMVFPVFYKVDPSDVRNQRGSFGQALAGHES  164

Query  518  KIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            K+  + EKV RW+  L +A  L G+   + Y
Sbjct  165  KLRDNMEKVLRWRTTLTRAANLSGWSFLDGY  195



>gb|KDO36433.1| hypothetical protein CISIN_1g031540mg [Citrus sinensis]
Length=158

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SFRG D R  F   L  +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  11   YDVFVSFRGEDTRDNFTSHLCSALCRQNIQTFIDD-QLNRGDEISESLVNAIEASAISVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC+++   QIV+P+FY V+P+D RNQ G +  SF +L E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKEYA-QIVIPVFYLVDPSDARNQTGPFGISFSKLEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
              ++ EK++ W++AL +A  L G+H  N
Sbjct  129  FKENPEKLQTWRKALKEAASLSGFHSLN  156



>gb|KDP34368.1| hypothetical protein JCGZ_11251 [Jatropha curcas]
Length=912

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 119/173 (69%), Gaps = 1/173 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W  DVFLSFRG D RK+F D ++ +L R GI TF+DDD L +G+ IS +L  AI++S+  
Sbjct  14   WNNDVFLSFRGEDTRKSFTDHVYTALVRSGIRTFRDDDELRRGEDISSALIKAIQQSRIS  73

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + VFSK YASS+WCL+E+  ++ C+  +  QIV+PIFY V+P+DVR Q G ++ +F    
Sbjct  74   LIVFSKRYASSRWCLDEVTEIINCKNTIG-QIVIPIFYDVDPSDVRRQTGPFQQAFDRHE  132

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDYNeyeaxcaexvaaDIHARLNH  673
            ++  ++ EKV++W+ AL  AG+L G+ L+N  N +E+   E +  D+ ++LN+
Sbjct  133  KRFREEMEKVKKWRVALEDAGKLSGFALQNMENGHESKFIEKIVEDVLSKLNY  185



>ref|XP_006441919.1| hypothetical protein CICLE_v100186892mg, partial [Citrus clementina]
 gb|ESR55159.1| hypothetical protein CICLE_v100186892mg, partial [Citrus clementina]
Length=157

 Score =   147 bits (372),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 101/145 (70%), Gaps = 2/145 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVF+SF+G D R  F   L  +L R+ I TF DD +L +GD IS+SL NAI  S   + 
Sbjct  11   YDVFVSFKGEDTRDNFTSHLCSALCRQNIQTFIDD-QLNRGDEISESLVNAIEASAISVI  69

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFS+GYASS+WCL+EL  ++EC+++   QIV+P+FY V+P+D RNQ G +  SF +L E+
Sbjct  70   VFSEGYASSRWCLDELVKILECKKQYA-QIVIPVFYRVDPSDARNQTGPFGISFSKLEER  128

Query  521  IGKDDEKVRRWKEALNKAGQLKGYH  595
              ++ EK++ W++AL +A  L G+H
Sbjct  129  FKENSEKLQTWRKALKEAASLSGFH  153



>ref|XP_009374162.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=748

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D R+ F D L+ +LER GI TFKDD  L+KG  IS  L +AI+ES+F 
Sbjct  16   WKYDVFLSFRGDDTRRGFTDHLYSALERHGILTFKDDPELQKGKSISPELFSAIQESRFA  75

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + V SK YASS WCL+EL  ++EC E  K   V+PIFY V+P+DVR QKGS+  +F +  
Sbjct  76   LIVLSKNYASSTWCLDELLKILECMEARK--TVLPIFYEVDPSDVRKQKGSFAEAFTKHE  133

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKNDY  610
            E +  D  KV+ W++AL     L G+  K+ Y
Sbjct  134  ENLKNDLMKVQSWRDALTTVANLSGWDSKDWY  165



>gb|AFP55548.1| TIR-NBS-LRR [Rosa rugosa]
Length=1115

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 2/150 (1%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W YDVFLSFRG D RK F D+L+  L+RRGI TF+DD +LE+G  IS  L  AI +S+F 
Sbjct  17   WKYDVFLSFRGEDTRKGFTDYLYHELQRRGIRTFRDDPQLERGTAISPELLTAIEQSRFA  76

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            I V S  YASS WCL EL+ ++EC E  +   ++PIFY V+P+ VR+Q+GS+  +F+E  
Sbjct  77   IVVLSPNYASSTWCLLELSKILECME--ERGTILPIFYEVDPSHVRHQRGSFAEAFQEHE  134

Query  515  EKIGKDDEKVRRWKEALNKAGQLKGYHLKN  604
            EK G  ++KV  W++AL K   L G+  K+
Sbjct  135  EKFGVGNKKVEGWRDALTKVASLAGWTSKD  164



>gb|KCW73653.1| hypothetical protein EUGRSUZ_E02234, partial [Eucalyptus grandis]
Length=830

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +2

Query  161  YDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFFIA  340
            YDVFLSFRG D+R  FI  L+++L R GI+TF+D + L+KGD IS  L  AI ES   I 
Sbjct  11   YDVFLSFRGADLRNNFIGHLYQALYRIGIYTFRDSEELKKGDQISPVLMKAIEESCIAIV  70

Query  341  VFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELHEK  520
            VFSK YASS+WCL+EL  ++EC+E+ K   V+P+FY V+P +VR  K SY+ +  +   K
Sbjct  71   VFSKNYASSRWCLKELVKIIECKEQ-KNLTVLPVFYKVDPREVRGCKNSYQRALAKHESK  129

Query  521  IGKDDEKVRRWKEALNKAGQLKGYHLKN  604
             GK+ E V+RWK+AL+ AG L G+HL +
Sbjct  130  FGKESENVKRWKKALSDAGNLSGWHLND  157



>ref|XP_006353757.1| PREDICTED: TMV resistance protein N-like [Solanum tuberosum]
Length=1218

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +2

Query  155  WTYDVFLSFRGPDVRKTFIDFLFESLERRGIHTFKDDDRLEKGDCISQSLPNAIRESKFF  334
            W Y+VFLSFRG D RKT I +L+E L R+GI  F+DD RLE+GD I + L  AI++S+  
Sbjct  15   WKYNVFLSFRGEDTRKTIIGYLYERLTRKGIIAFQDDKRLERGDSIPEELLKAIQDSQVA  74

Query  335  IAVFSKGYASSKWCLEELATVMECQEKLKEQIVVPIFYHVEPTDVRNQKGSYENSFKELH  514
            + +FS  YA+S+WCL+EL  +MEC +   E+IV+P+FY VEP+ VRNQ  S+  +F E H
Sbjct  75   LIIFSGNYATSRWCLDELVKIMECTKDENEKIVMPVFYGVEPSHVRNQSDSFAEAFAE-H  133

Query  515  EKIGKDD----EKVRRWKEALNKAGQLKGYHLKN  604
            E   KDD    +KV+ W+ AL  A  LKGY   N
Sbjct  134  ESKYKDDGEGMQKVKEWRTALTAAANLKGYVFGN  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700