BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032G16

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007201261.1|  hypothetical protein PRUPE_ppa013259mg             147   7e-41   Prunus persica
ref|XP_008235152.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    148   1e-40   Prunus mume [ume]
ref|XP_008359430.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    145   4e-40   Malus domestica [apple tree]
ref|XP_009339774.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    145   6e-40   Pyrus x bretschneideri [bai li]
ref|XP_002275043.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    145   6e-40   Vitis vinifera
ref|XP_009378720.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    144   8e-40   Pyrus x bretschneideri [bai li]
ref|XP_009604948.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    142   9e-39   Nicotiana tomentosiformis
ref|XP_008355495.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    140   7e-38   Malus domestica [apple tree]
ref|XP_011079555.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    139   2e-37   Sesamum indicum [beniseed]
ref|XP_002515284.1|  conserved hypothetical protein                     139   2e-37   Ricinus communis
gb|KJB41735.1|  hypothetical protein B456_007G122700                    137   5e-37   Gossypium raimondii
emb|CAA96570.1|  CP12                                                   137   5e-37   Pisum sativum [garden pea]
ref|XP_009774670.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    137   5e-37   Nicotiana sylvestris
ref|XP_011082421.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    137   6e-37   Sesamum indicum [beniseed]
ref|XP_009116912.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    136   2e-36   
dbj|BAH03328.1|  chloroplast protein 12                                 135   4e-36   Fagus crenata
ref|XP_010523926.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    134   6e-36   Tarenaya hassleriana [spider flower]
emb|CDX76635.1|  BnaC08g32210D                                          134   6e-36   
ref|XP_004152225.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    134   1e-35   Cucumis sativus [cucumbers]
ref|XP_003625969.1|  CP12                                               134   2e-35   Medicago truncatula
ref|XP_004300451.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    133   2e-35   Fragaria vesca subsp. vesca
gb|AFK34703.1|  unknown                                                 133   2e-35   Medicago truncatula
gb|KJB49824.1|  hypothetical protein B456_008G139400                    133   2e-35   Gossypium raimondii
ref|XP_002302764.2|  CP12 domain-containing family protein              133   2e-35   
ref|XP_008454293.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    133   2e-35   Cucumis melo [Oriental melon]
ref|XP_010468958.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    133   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_011042247.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    132   4e-35   Populus euphratica
ref|XP_004495904.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    132   5e-35   Cicer arietinum [garbanzo]
ref|XP_006402378.1|  hypothetical protein EUTSA_v10006414mg             132   5e-35   Eutrema salsugineum [saltwater cress]
gb|EPS59920.1|  hypothetical protein M569_14886                         131   6e-35   Genlisea aurea
gb|KDP28257.1|  hypothetical protein JCGZ_14028                         132   7e-35   Jatropha curcas
gb|KJB06277.1|  hypothetical protein B456_001G144300                    132   7e-35   Gossypium raimondii
emb|CDP17070.1|  unnamed protein product                                132   7e-35   Coffea canephora [robusta coffee]
ref|XP_008451482.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    131   8e-35   
gb|KFK35421.1|  hypothetical protein AALP_AA5G282200                    132   9e-35   Arabis alpina [alpine rockcress]
ref|XP_010413280.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    132   9e-35   Camelina sativa [gold-of-pleasure]
emb|CDY25110.1|  BnaC06g18520D                                          131   1e-34   Brassica napus [oilseed rape]
ref|XP_010087241.1|  hypothetical protein L484_009750                   131   1e-34   Morus notabilis
ref|XP_007051103.1|  CP12 domain-containing protein 1                   134   1e-34   
ref|XP_010544968.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    131   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_009104385.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    131   1e-34   Brassica rapa
ref|XP_003591401.1|  Calvin cycle protein CP12                          131   1e-34   Medicago truncatula
ref|XP_010512631.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    131   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_004494423.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    130   2e-34   Cicer arietinum [garbanzo]
emb|CDX67892.1|  BnaA07g19320D                                          130   2e-34   
gb|EYU46807.1|  hypothetical protein MIMGU_mgv1a016182mg                130   2e-34   Erythranthe guttata [common monkey flower]
gb|ABK96294.1|  unknown                                                 130   3e-34   Populus trichocarpa x Populus deltoides
ref|XP_004135995.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    129   4e-34   
ref|XP_007163176.1|  hypothetical protein PHAVU_001G212900g             129   6e-34   Phaseolus vulgaris [French bean]
ref|XP_004163144.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    130   6e-34   
gb|KFK37480.1|  hypothetical protein AALP_AA4G262800                    129   7e-34   Arabis alpina [alpine rockcress]
ref|XP_003554549.2|  PREDICTED: calvin cycle protein CP12-2, chlo...    130   8e-34   Glycine max [soybeans]
dbj|BAJ85428.1|  predicted protein                                      129   1e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN45014.1|  hypothetical protein Csa_7G407670                       130   2e-33   Cucumis sativus [cucumbers]
ref|XP_010069841.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    128   2e-33   Eucalyptus grandis [rose gum]
ref|XP_002876674.1|  CP12-2                                             128   2e-33   
dbj|BAJ90516.1|  predicted protein                                      127   2e-33   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006292773.1|  hypothetical protein CARUB_v10019023mg             128   2e-33   Capsella rubella
ref|XP_010267998.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    127   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_009382502.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    127   7e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_566100.2|  stroma protein CP12-1                                 126   7e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85997.1|  unknown                                                 127   7e-33   Medicago truncatula
ref|XP_010259310.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    126   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_011041206.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    126   9e-33   Populus euphratica
ref|XP_002880299.1|  cp12 domain-containing protein 1                   126   1e-32   Arabidopsis lyrata subsp. lyrata
ref|XP_010506777.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    126   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009411634.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    126   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009142539.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    125   1e-32   Brassica rapa
ref|XP_010518439.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    125   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002320298.1|  CP12 domain-containing family protein              125   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_010507892.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    125   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010497708.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    125   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010413103.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    124   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010413104.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    125   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_003535935.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    125   3e-32   Glycine max [soybeans]
emb|CDX80101.1|  BnaA05g00550D                                          125   3e-32   
ref|XP_006397935.1|  hypothetical protein EUTSA_v10001682mg             124   4e-32   Eutrema salsugineum [saltwater cress]
emb|CDY27491.1|  BnaC04g51320D                                          124   6e-32   Brassica napus [oilseed rape]
emb|CDY51422.1|  BnaA04g26990D                                          124   7e-32   Brassica napus [oilseed rape]
emb|CDY55379.1|  BnaC04g51970D                                          124   7e-32   Brassica napus [oilseed rape]
ref|XP_006295238.1|  hypothetical protein CARUB_v10024325mg             124   8e-32   Capsella rubella
emb|CAA96568.1|  CP12                                                   124   9e-32   Spinacia oleracea
emb|CDX95723.1|  BnaC03g26040D                                          124   1e-31   
ref|XP_009133812.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    124   1e-31   
ref|NP_191800.1|  calvin cycle protein CP12-2                           123   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AAK97687.1|  At2g47400/T8I13.24                                      123   1e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118779.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    123   1e-31   Brassica rapa
ref|XP_006444494.1|  hypothetical protein CICLE_v10022841mg             123   2e-31   Citrus clementina [clementine]
gb|AAM63795.1|  CP12 protein precursor-like protein                     123   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008654881.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    123   2e-31   Zea mays [maize]
gb|ACU20479.1|  unknown                                                 123   2e-31   Glycine max [soybeans]
gb|KHN19215.1|  Calvin cycle protein CP12                               122   2e-31   Glycine soja [wild soybean]
ref|XP_003521594.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    122   3e-31   Glycine max [soybeans]
ref|XP_003518788.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    122   3e-31   Glycine max [soybeans]
ref|XP_006651310.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    122   3e-31   
gb|ABS17660.1|  chloroplast protein 12                                  121   4e-31   Arnebia euchroma
ref|XP_008351460.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    122   4e-31   Malus domestica [apple tree]
gb|ADZ23481.1|  chloroplast protein 12                                  122   4e-31   Stylosanthes guianensis [stylo]
ref|XP_010038287.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    122   4e-31   Eucalyptus grandis [rose gum]
ref|XP_002467982.1|  hypothetical protein SORBIDRAFT_01g037510          122   6e-31   Sorghum bicolor [broomcorn]
ref|XP_004984626.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    121   8e-31   Setaria italica
ref|XP_010679381.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    120   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007145148.1|  hypothetical protein PHAVU_007G214200g             120   2e-30   Phaseolus vulgaris [French bean]
ref|XP_003558084.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    119   5e-30   Brachypodium distachyon [annual false brome]
emb|CAJ41166.1|  chloroplast protein 12 precursor                       120   5e-30   Cynara cardunculus var. scolymus [artichoke]
ref|XP_010321871.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    119   7e-30   Solanum lycopersicum
gb|AAV63570.1|  auxin-induced putative CP12 domain-containing pro...    117   8e-30   Arachis hypogaea [goober]
ref|NP_001049890.1|  Os03g0306800                                       118   2e-29   
gb|EAY89700.1|  hypothetical protein OsI_11237                          118   2e-29   Oryza sativa Indica Group [Indian rice]
pdb|2LJ9|A  Chain A, Partial 3d Structure Of The C-Terminal Part ...    116   2e-29   Arabidopsis thaliana [mouse-ear cress]
pdb|3QV1|G  Chain G, Crystal Structure Of The Binary Complex Of P...    116   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355835.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    116   5e-29   Solanum tuberosum [potatoes]
gb|EAY73672.1|  hypothetical protein OsI_01556                          116   6e-29   Oryza sativa Indica Group [Indian rice]
ref|NP_001042830.1|  Os01g0303000                                       116   7e-29   
ref|XP_009403696.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    116   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK03023.1|  predicted protein                                      115   3e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004967659.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    114   3e-28   Setaria italica
ref|XP_006644110.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    114   3e-28   Oryza brachyantha
ref|XP_009616215.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    114   4e-28   Nicotiana tomentosiformis
ref|XP_002436694.1|  hypothetical protein SORBIDRAFT_10g007180          114   7e-28   Sorghum bicolor [broomcorn]
ref|XP_010921497.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    112   2e-27   Elaeis guineensis
ref|XP_010230820.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    111   5e-27   Brachypodium distachyon [annual false brome]
ref|XP_009383546.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    111   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781107.1|  PREDICTED: calvin cycle protein CP12-2, chlo...    109   4e-26   Phoenix dactylifera
ref|XP_009784434.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    108   1e-25   Nicotiana sylvestris
gb|KHN30640.1|  Calvin cycle protein CP12                               107   2e-25   Glycine soja [wild soybean]
gb|EMT01482.1|  hypothetical protein F775_29657                         104   4e-25   
ref|XP_008386781.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    105   9e-25   
ref|XP_002976377.1|  hypothetical protein SELMODRAFT_105078             100   1e-23   
ref|XP_006840455.1|  hypothetical protein AMTR_s00045p00175560          102   2e-23   Amborella trichopoda
ref|XP_004229393.1|  PREDICTED: calvin cycle protein CP12-1, chlo...    102   2e-23   Solanum lycopersicum
gb|EMS48211.1|  hypothetical protein TRIUR3_21408                     99.8    5e-23   Triticum urartu
gb|ABK21319.1|  unknown                                                 100   7e-23   Picea sitchensis
gb|ACG43906.1|  CP12-1                                                  100   1e-22   Zea mays [maize]
ref|NP_001148040.1|  LOC100281649                                     99.4    3e-22   
ref|XP_006349189.1|  PREDICTED: calvin cycle protein CP12-1, chlo...  98.2    5e-22   Solanum tuberosum [potatoes]
ref|XP_001773160.1|  predicted protein                                95.5    1e-21   
ref|XP_009389615.1|  PREDICTED: calvin cycle protein CP12-2, chlo...  96.7    9e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001756905.1|  predicted protein                                88.6    5e-19   
ref|XP_001759510.1|  predicted protein                                87.0    2e-18   
gb|ABD37967.1|  CP12                                                  87.0    8e-18   Marchantia polymorpha
ref|XP_006342197.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  86.3    1e-17   Solanum tuberosum [potatoes]
ref|XP_008237890.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  86.7    1e-17   Prunus mume [ume]
ref|XP_007209751.1|  hypothetical protein PRUPE_ppa013090mg           86.3    2e-17   Prunus persica
ref|XP_009595948.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  84.7    4e-17   Nicotiana tomentosiformis
ref|XP_009765560.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  84.7    5e-17   Nicotiana sylvestris
emb|CDX87586.1|  BnaA07g32870D                                        80.1    2e-15   
ref|XP_009106324.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  80.1    3e-15   Brassica rapa
ref|XP_004300084.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  79.7    3e-15   Fragaria vesca subsp. vesca
ref|XP_002953061.1|  hypothetical protein VOLCADRAFT_121134           79.0    4e-15   Volvox carteri f. nagariensis
ref|NP_565134.1|  CP12 domain-containing protein 3                    79.3    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62589.1|  unknown                                               79.3    5e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ABK26381.1|  unknown                                               79.0    6e-15   Picea sitchensis
ref|XP_006302985.1|  hypothetical protein CARUB_v10021134mg           78.6    1e-14   Capsella rubella
ref|XP_009372664.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  78.6    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_011034773.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  78.6    1e-14   Populus euphratica
ref|XP_010266359.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  78.6    1e-14   
ref|XP_008373345.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  77.8    2e-14   
gb|KIZ05217.1|  Calvin cycle protein CP12                             77.0    2e-14   Monoraphidium neglectum
emb|CDX88298.1|  BnaC06g37420D                                        77.0    3e-14   
ref|XP_002887645.1|  hypothetical protein ARALYDRAFT_895539           76.6    4e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_006849927.1|  hypothetical protein AMTR_s00022p00115740        76.6    5e-14   
ref|XP_010088739.1|  hypothetical protein L484_016525                 75.1    5e-14   
ref|XP_002301892.1|  CP12 domain-containing family protein            76.6    6e-14   Populus trichocarpa [western balsam poplar]
gb|EMT03124.1|  hypothetical protein F775_44037                       74.3    6e-14   
ref|XP_006390179.1|  hypothetical protein EUTSA_v10019316mg           75.9    7e-14   Eutrema salsugineum [saltwater cress]
ref|XP_001694345.1|  small protein associating with GAPDH and PRK     75.1    9e-14   Chlamydomonas reinhardtii
ref|XP_005644334.1|  CP12-domain-containing protein                   75.1    9e-14   Coccomyxa subellipsoidea C-169
ref|XP_002307003.2|  hypothetical protein POPTR_0005s27980g           75.9    1e-13   Populus trichocarpa [western balsam poplar]
emb|CBI40783.3|  unnamed protein product                              73.9    2e-13   Vitis vinifera
emb|CAO03469.1|  CP12 protein                                         73.6    2e-13   Chlamydomonas reinhardtii
emb|CAA06467.1|  CP12                                                 72.4    2e-13   Chlamydomonas reinhardtii
ref|XP_011074049.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  74.3    2e-13   Sesamum indicum [beniseed]
ref|XP_011041131.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  74.3    3e-13   Populus euphratica
ref|XP_010474367.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  74.7    3e-13   Camelina sativa [gold-of-pleasure]
emb|CDP07245.1|  unnamed protein product                              75.1    4e-13   Coffea canephora [robusta coffee]
ref|XP_010479593.1|  PREDICTED: LOW QUALITY PROTEIN: calvin cycle...  73.9    4e-13   Camelina sativa [gold-of-pleasure]
gb|EYU36605.1|  hypothetical protein MIMGU_mgv1a014758mg              74.3    5e-13   Erythranthe guttata [common monkey flower]
ref|XP_010416576.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  73.6    6e-13   
ref|XP_010539757.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  73.6    6e-13   Tarenaya hassleriana [spider flower]
gb|KJB73143.1|  hypothetical protein B456_011G217400                  72.8    1e-12   Gossypium raimondii
gb|KDP36727.1|  hypothetical protein JCGZ_08018                       72.4    2e-12   Jatropha curcas
ref|XP_002276622.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  72.0    2e-12   Vitis vinifera
gb|ABD37968.1|  CP12                                                  71.6    2e-12   Mesostigma viride
ref|XP_011400908.1|  Calvin cycle protein CP12, chloroplastic         71.2    2e-12   Auxenochlorella protothecoides
ref|XP_002510743.1|  conserved hypothetical protein                   72.0    2e-12   Ricinus communis
gb|KJB60285.1|  hypothetical protein B456_009G298200                  70.5    6e-12   Gossypium raimondii
ref|WP_010475694.1|  hypothetical protein                             68.9    7e-12   Acaryochloris sp. CCMEE 5410
ref|WP_012162957.1|  hypothetical protein                             68.9    8e-12   Acaryochloris marina
ref|WP_012306885.1|  MULTISPECIES: hypothetical protein               68.6    1e-11   Synechococcus
ref|WP_017749890.1|  hypothetical protein                             67.8    1e-11   Scytonema hofmannii
ref|XP_008799141.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  69.7    1e-11   Phoenix dactylifera
ref|XP_010061244.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  69.3    2e-11   Eucalyptus grandis [rose gum]
ref|XP_007010913.1|  CP12 domain-containing protein 3                 68.9    2e-11   
ref|WP_017651373.1|  hypothetical protein                             67.0    3e-11   Fortiea contorta
ref|WP_006453737.1|  hypothetical protein                             67.0    4e-11   Synechococcus sp. PCC 7335
ref|XP_005706707.1|  small chloroplast protein                        68.2    4e-11   Galdieria sulphuraria
ref|WP_024544448.1|  hypothetical protein                             66.6    4e-11   Synechococcus
ref|WP_035156951.1|  hypothetical protein                             66.6    4e-11   Calothrix sp. 336/3
ref|WP_019501875.1|  hypothetical protein                             65.9    7e-11   Pseudanabaena sp. PCC 6802
ref|WP_035991854.1|  hypothetical protein                             65.9    8e-11   Leptolyngbya sp. KIOST-1
ref|WP_006635891.1|  hypothetical protein                             65.9    8e-11   Microcoleus vaginatus
ref|WP_015218820.1|  hypothetical protein                             65.5    1e-10   Cyanobacterium aponinum
ref|WP_027842240.1|  hypothetical protein                             65.1    2e-10   Mastigocoleus testarum
ref|WP_015223198.1|  hypothetical protein                             65.1    2e-10   
ref|WP_006516336.1|  CP12 domai nprotein                              65.1    2e-10   Leptolyngbya sp. PCC 7375
ref|WP_010997001.1|  hypothetical protein                             65.1    2e-10   Nostocaceae
ref|WP_017714302.1|  hypothetical protein                             64.7    2e-10   Prochlorothrix hollandica
ref|WP_015207783.1|  CP12 domain protein                              64.7    2e-10   Cylindrospermum stagnale
ref|WP_015200789.1|  hypothetical protein                             64.7    2e-10   Calothrix parietina
ref|WP_016953179.1|  hypothetical protein                             64.7    2e-10   Anabaena sp. PCC 7108
ref|XP_010932153.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  65.9    3e-10   Elaeis guineensis
ref|WP_015120210.1|  CP12 domain-containing protein                   63.9    4e-10   Rivularia sp. PCC 7116
ref|WP_012407493.1|  hypothetical protein                             63.9    4e-10   Nostoc
ref|WP_017297697.1|  hypothetical protein                             63.9    4e-10   Nodosilinea nodulosa
ref|WP_023072932.1|  protein regulation of calvin cycle via assoc...  63.9    4e-10   Leptolyngbya sp. Heron Island J
ref|WP_017313122.1|  MULTISPECIES: hypothetical protein               63.5    5e-10   Hapalosiphonaceae
ref|WP_011317898.1|  hypothetical protein                             63.5    6e-10   Trichormus variabilis
ref|WP_008309502.1|  CP12 domain protein                              63.2    7e-10   Leptolyngbya sp. PCC 6406
ref|WP_015175385.1|  protein of unknown function CP12                 63.2    7e-10   Oscillatoria nigro-viridis
emb|CAB56831.1|  hypothetical protein                                 63.5    8e-10   Cyanophora paradoxa
ref|XP_001774010.1|  predicted protein                                64.3    9e-10   
ref|WP_027404703.1|  hypothetical protein                             63.2    9e-10   Nostocales
ref|WP_022604974.1|  CP12 domain protein                              62.8    9e-10   Rubidibacter lacunae
ref|WP_009629451.1|  protein of unknown function CP12                 62.8    1e-09   Pseudanabaena
ref|WP_008274506.1|  hypothetical protein                             62.8    1e-09   Cyanothece sp. CCY0110
ref|WP_007356495.1|  MULTISPECIES: hypothetical protein               62.8    1e-09   Kamptonema
ref|WP_008197591.1|  hypothetical protein                             62.8    1e-09   Microcystis
ref|WP_002792997.1|  hypothetical protein                             62.8    1e-09   Microcystis
gb|EPS73074.1|  hypothetical protein M569_01682                       62.8    1e-09   Genlisea aurea
ref|WP_012594266.1|  MULTISPECIES: hypothetical protein               62.4    1e-09   Cyanothece
ref|WP_002739926.1|  calvin cycle protein CP12                        62.4    1e-09   Microcystis aeruginosa
ref|WP_002751352.1|  hypothetical protein                             62.4    1e-09   Microcystis aeruginosa
ref|WP_018396801.1|  hypothetical protein                             62.4    2e-09   filamentous cyanobacterium ESFC-1
ref|WP_002743917.1|  hypothetical protein                             62.4    2e-09   Microcystis aeruginosa
ref|WP_015202341.1|  hypothetical protein                             62.0    2e-09   Crinalium epipsammum
ref|WP_029636735.1|  hypothetical protein [                           62.0    2e-09   [Scytonema hofmanni] UTEX B 1581
ref|WP_012627347.1|  hypothetical protein                             62.0    2e-09   Cyanothece sp. PCC 7425
ref|WP_039754825.1|  hypothetical protein                             62.0    2e-09   Tolypothrix sp. NIES-4075
ref|WP_011057657.1|  MULTISPECIES: hypothetical protein               62.0    2e-09   Thermosynechococcus
gb|KIE08862.1|  hypothetical protein DA73_0230645                     61.6    2e-09   Tolypothrix bouteillei VB521301
ref|WP_015081465.1|  hypothetical protein                             61.6    3e-09   Anabaena sp. 90
ref|WP_019493833.1|  hypothetical protein                             61.6    3e-09   Calothrix sp. PCC 7103
ref|WP_015126619.1|  hypothetical protein                             61.2    3e-09   Calothrix sp. PCC 7507
ref|WP_017293080.1|  hypothetical protein                             61.2    4e-09   Geminocystis herdmanii
gb|ACB49980.1|  putative CP12                                         61.2    5e-09   Cyanothece sp. ATCC 51142
ref|WP_015136220.1|  hypothetical protein                             60.8    5e-09   Leptolyngbya sp. PCC 7376
ref|WP_019504562.1|  hypothetical protein                             60.8    5e-09   Pleurocapsa sp. PCC 7319
ref|WP_018400793.1|  CP12 polypeptide                                 63.2    6e-09   filamentous cyanobacterium ESFC-1
ref|WP_002788843.1|  hypothetical protein                             60.8    6e-09   Microcystis
ref|WP_002770133.1|  hypothetical protein                             60.5    6e-09   Microcystis aeruginosa
ref|WP_009556279.1|  CP12 domain protein                              60.5    6e-09   Oscillatoriales cyanobacterium JSC-12
ref|WP_002781201.1|  hypothetical protein                             60.5    7e-09   Microcystis
ref|WP_015137816.1|  CP12 domain-containing protein                   60.5    7e-09   Nostoc sp. PCC 7524
ref|WP_012629411.1|  hypothetical protein                             60.5    8e-09   Cyanothece sp. PCC 7425
ref|WP_037220753.1|  hypothetical protein                             60.1    9e-09   
ref|WP_015163984.1|  hypothetical protein                             60.1    9e-09   Pseudanabaena sp. PCC 7367
ref|WP_009547808.1|  MULTISPECIES: hypothetical protein               60.1    9e-09   Cyanothece
ref|WP_041040779.1|  hypothetical protein                             60.1    9e-09   Tolypothrix campylonemoides
ref|WP_015187453.1|  protein of unknown function CP12                 60.1    1e-08   Chroococcaceae
ref|WP_016865922.1|  hypothetical protein                             60.1    1e-08   Fischerella muscicola
ref|WP_006511551.1|  CP12 domain protein                              59.7    1e-08   Xenococcus sp. PCC 7305
ref|WP_026082867.1|  hypothetical protein                             59.7    1e-08   Mastigocladopsis repens
ref|WP_006621675.1|  MULTISPECIES: hypothetical protein               62.0    1e-08   Arthrospira
gb|KIJ83043.1|  hypothetical protein SD80_15500                       59.7    1e-08   Scytonema tolypothrichoides VB-61278
ref|WP_013190766.1|  hypothetical protein                             59.7    2e-08   Trichormus azollae
ref|WP_019508336.1|  CP12 polypeptide                                 61.6    2e-08   Pleurocapsa sp. PCC 7319
ref|WP_040484356.1|  CBS domain-containing protein                    61.6    2e-08   Lyngbya aestuarii
ref|WP_017717331.1|  CP12 polypeptide                                 61.6    2e-08   Oscillatoria sp. PCC 10802
gb|ERT05749.1|  CBS domain protein                                    61.6    2e-08   Lyngbya aestuarii BL J
ref|WP_028082844.1|  hypothetical protein                             59.3    2e-08   Dolichospermum circinale
ref|WP_015123941.1|  CP12 domain-containing protein                   59.3    2e-08   Synechococcus sp. PCC 6312
ref|WP_006198106.1|  hypothetical protein                             59.3    2e-08   Nodularia spumigena
ref|WP_040931551.1|  hypothetical protein                             58.9    2e-08   
ref|WP_015194435.1|  protein of unknown function CP12                 58.9    2e-08   Stanieria cyanosphaera
ref|WP_036530791.1|  hypothetical protein                             58.5    3e-08   Neosynechococcus sphagnicola
emb|CAA06468.1|  CP12                                                 57.8    3e-08   Ceratodon purpureus
gb|AHJ27947.1|  hypothetical protein NSP_16130                        59.3    3e-08   Nodularia spumigena CCY9414
ref|WP_015115885.1|  hypothetical protein                             58.5    3e-08   Nostocales
ref|WP_026719899.1|  hypothetical protein                             58.5    3e-08   
ref|XP_005711763.1|  CP12 protein, chloroplast precursor, involve...  59.7    4e-08   
dbj|BAI90542.1|  hypothetical protein                                 60.8    4e-08   
ref|WP_043468276.1|  CBS domain-containing protein                    60.8    4e-08   
ref|WP_006197267.1|  hypothetical protein                             58.9    4e-08   
ref|WP_009785850.1|  hypothetical protein                             60.8    4e-08   
ref|WP_016878694.1|  hypothetical protein                             58.2    4e-08   
ref|WP_036000717.1|  hypothetical protein                             58.2    5e-08   
ref|WP_040939044.1|  CBS domain-containing protein                    60.5    5e-08   
ref|WP_026734552.1|  hypothetical protein                             58.2    6e-08   
ref|WP_035737555.1|  CBS domain-containing protein                    60.5    6e-08   
ref|WP_011143687.1|  hypothetical protein                             57.8    6e-08   
ref|WP_009454896.1|  MULTISPECIES: hypothetical protein               58.2    7e-08   
ref|WP_008226771.1|  Protein CP12, regulation of Calvin cycle via...  57.8    7e-08   
ref|XP_005538561.1|  CP12 protein, chloroplast precursor              58.5    7e-08   
ref|WP_041269253.1|  hypothetical protein                             57.4    9e-08   
ref|WP_026785259.1|  MULTISPECIES: hypothetical protein               57.4    1e-07   
ref|WP_035158099.1|  hypothetical protein                             57.8    1e-07   
ref|WP_015216100.1|  protein of unknown function CP12                 57.4    1e-07   
gb|AFY68205.1|  protein of unknown function CP12                      57.8    1e-07   
ref|WP_009454249.1|  MULTISPECIES: hypothetical protein               57.0    1e-07   
ref|WP_039728056.1|  MULTISPECIES: hypothetical protein               57.0    1e-07   
ref|WP_007304708.1|  hypothetical protein                             57.0    1e-07   
ref|WP_039717133.1|  hypothetical protein                             57.0    1e-07   
ref|WP_006276771.1|  hypothetical protein                             57.0    1e-07   
ref|WP_015147142.1|  hypothetical protein                             59.3    2e-07   
ref|WP_026086989.1|  hypothetical protein                             56.6    2e-07   
ref|WP_009633049.1|  CP12 domain protein                              56.6    2e-07   
ref|WP_006510010.1|  CBS domain-containing protein                    58.9    2e-07   
ref|WP_026079866.1|  hypothetical protein                             56.6    2e-07   
ref|WP_040933638.1|  hypothetical protein                             56.2    2e-07   
ref|WP_015956035.1|  hypothetical protein                             56.2    3e-07   
ref|WP_042154077.1|  hypothetical protein                             56.2    3e-07   
ref|WP_015145579.1|  CP12 domain-containing protein                   56.2    3e-07   
ref|WP_017662908.1|  CP12 polypeptide                                 58.5    3e-07   
ref|WP_036481640.1|  hypothetical protein                             56.2    3e-07   
ref|WP_017321588.1|  hypothetical protein                             55.8    3e-07   
ref|WP_039749023.1|  CBS domain-containing protein                    58.2    4e-07   
ref|WP_013323106.1|  hypothetical protein                             55.8    4e-07   
ref|XP_010064961.1|  PREDICTED: calvin cycle protein CP12-3, chlo...  56.6    5e-07   
ref|WP_028948591.1|  hypothetical protein                             55.5    5e-07   
ref|WP_008275985.1|  hypothetical protein                             55.5    6e-07   
ref|WP_015199757.1|  hypothetical protein                             55.5    7e-07   
ref|WP_006528654.1|  CP12 domain protein                              55.1    7e-07   
ref|WP_015184117.1|  hypothetical protein                             57.4    7e-07   
ref|WP_009543040.1|  MULTISPECIES: hypothetical protein               55.1    8e-07   
ref|WP_026735781.1|  hypothetical protein                             55.1    9e-07   
ref|WP_015155543.1|  hypothetical protein                             54.7    9e-07   
gb|ACB49520.1|  unknown                                               54.7    1e-06   
ref|WP_021831474.1|  CP12 polypeptide                                 54.7    1e-06   
ref|WP_011612835.1|  hypothetical protein                             54.7    1e-06   
ref|WP_007306037.1|  hypothetical protein                             54.3    1e-06   
gb|KIZ03327.1|  hypothetical protein MNEG_4631                        55.1    1e-06   
ref|WP_017291480.1|  hypothetical protein                             54.3    1e-06   
ref|WP_006106059.1|  CP12 domain protein                              56.6    2e-06   
ref|WP_044493471.1|  hypothetical protein                             53.9    2e-06   
ref|WP_013322083.1|  hypothetical protein                             56.2    2e-06   
ref|WP_035997238.1|  CBS domain-containing protein                    56.2    2e-06   
ref|WP_029634590.1|  hypothetical protein [                           54.3    2e-06   
ref|WP_023171760.1|  putative CP12 gene family protein                53.9    2e-06   
gb|AFY36385.1|  CBS domain containing protein                         56.2    2e-06   
ref|WP_042342589.1|  CBS domain-containing protein                    56.2    2e-06   
ref|WP_015119253.1|  CP12 domain-containing protein                   53.9    3e-06   
ref|WP_012267174.1|  CP12 polypeptide                                 55.5    3e-06   
ref|WP_015182394.1|  CP12 domain-containing protein                   53.1    3e-06   
ref|WP_017661922.1|  hypothetical protein                             53.1    4e-06   
ref|XP_005851203.1|  hypothetical protein CHLNCDRAFT_137886           53.9    4e-06   
ref|WP_024968588.1|  hypothetical protein                             55.5    4e-06   
ref|WP_008199826.1|  CP12 polypeptide                                 55.5    4e-06   
ref|WP_009782451.1|  hypothetical protein                             53.1    4e-06   
ref|WP_015167659.1|  CP12 domain-containing protein                   53.1    4e-06   
ref|WP_036265751.1|  hypothetical protein                             53.1    5e-06   
ref|WP_017328246.1|  hypothetical protein                             52.8    5e-06   
ref|WP_038296453.1|  CBS domain-containing protein [                  55.1    5e-06   
ref|WP_026797084.1|  hypothetical protein                             55.1    5e-06   
ref|WP_026788812.1|  MULTISPECIES: hypothetical protein               55.1    5e-06   
ref|WP_015224274.1|  hypothetical protein                             52.8    6e-06   
ref|WP_002751597.1|  CP12 polypeptide                                 55.1    6e-06   
ref|WP_002801025.1|  CP12 polypeptide                                 55.1    6e-06   
ref|WP_011429904.1|  hypothetical protein                             52.4    6e-06   
ref|WP_010872329.1|  hypothetical protein                             52.4    7e-06   
ref|WP_015207732.1|  CP12 domain protein                              52.8    7e-06   
ref|WP_017653535.1|  CP12 polypeptide                                 54.7    7e-06   
ref|WP_011434185.1|  hypothetical protein                             52.4    8e-06   
ref|WP_023067491.1|  CP12 domain protein                              52.4    8e-06   
gb|AFY42309.1|  CBS domain containing protein                         54.7    9e-06   
ref|WP_044499845.1|  CBS domain-containing protein                    54.3    9e-06   
ref|WP_041033799.1|  hypothetical protein                             52.4    1e-05   
ref|WP_042153369.1|  CBS domain-containing protein                    54.3    1e-05   
ref|WP_002737762.1|  CBS domain pair family protein                   54.3    1e-05   
ref|WP_004162604.1|  CP12 polypeptide                                 54.3    1e-05   
ref|WP_011243573.1|  MULTISPECIES: hypothetical protein               51.6    1e-05   
ref|WP_010475692.1|  MULTISPECIES: hypothetical protein               52.0    1e-05   
ref|WP_002746099.1|  CBS domain pair family protein                   53.9    1e-05   
ref|WP_017289099.1|  hypothetical protein                             51.6    1e-05   
ref|WP_006100550.1|  hypothetical protein                             51.6    1e-05   
ref|WP_002790229.1|  Similar to tr|Q8YYT1|Q8YYT1                      53.9    2e-05   
ref|WP_015229190.1|  CP12 domain-containing protein                   51.2    2e-05   
ref|WP_015177778.1|  protein of unknown function CP12                 53.5    2e-05   
ref|WP_002779902.1|  Similar to tr|Q8YYT1|Q8YYT1                      53.5    2e-05   
ref|WP_041565216.1|  CBS domain-containing protein                    53.5    2e-05   
ref|WP_017326726.1|  hypothetical protein                             51.2    2e-05   
gb|ACC79855.1|  CBS domain containing protein                         53.5    2e-05   
ref|WP_017711604.1|  hypothetical protein                             52.8    3e-05   
ref|WP_006621819.1|  hypothetical protein                             50.4    3e-05   
ref|WP_017716571.1|  hypothetical protein                             50.4    3e-05   
ref|WP_006668828.1|  MULTISPECIES: hypothetical protein               50.4    3e-05   
ref|WP_015216559.1|  CBS domain containing protein                    52.8    3e-05   
gb|AAB53704.1|  unknown                                               52.8    3e-05   
ref|WP_036267698.1|  CBS domain-containing protein                    52.8    4e-05   
ref|WP_006631471.1|  protein of unknown function CP12                 52.8    4e-05   
ref|WP_028088930.1|  hypothetical protein                             52.4    5e-05   
ref|WP_041233297.1|  CBS domain-containing protein                    52.4    5e-05   
gb|AFZ27729.1|  CBS domain-containing protein                         52.4    5e-05   
ref|WP_039754353.1|  hypothetical protein                             50.4    5e-05   
ref|WP_037216977.1|  hypothetical protein                             50.4    6e-05   
ref|WP_002770514.1|  Similar to tr|Q8YYT1|Q8YYT1                      52.4    6e-05   
ref|WP_015227641.1|  hypothetical protein                             52.0    7e-05   
ref|WP_041643388.1|  hypothetical protein                             49.7    8e-05   
ref|WP_015216233.1|  protein of unknown function CP12                 52.0    8e-05   
ref|WP_015131732.1|  hypothetical protein                             50.1    8e-05   
gb|ADI65258.1|  protein of unknown function CP12                      49.7    8e-05   
ref|WP_039717285.1|  hypothetical protein                             49.3    1e-04   
ref|WP_019493049.1|  hypothetical protein                             49.3    1e-04   
ref|WP_036535645.1|  hypothetical protein                             48.9    1e-04   
ref|WP_041462676.1|  hypothetical protein                             48.9    2e-04   
ref|WP_012411541.1|  hypothetical protein                             48.5    2e-04   
gb|AFY85643.1|  protein of unknown function CP12                      48.9    2e-04   
ref|WP_011243464.1|  MULTISPECIES: hypothetical protein               48.1    2e-04   
ref|WP_017749085.1|  hypothetical protein                             48.5    3e-04   
ref|WP_007354179.1|  MULTISPECIES: hypothetical protein               50.4    3e-04   
ref|WP_027404529.1|  hypothetical protein                             50.1    3e-04   
ref|WP_015079812.1|  CBS and CP12 domain-containing protein           50.1    3e-04   
ref|WP_010994939.1|  hypothetical protein                             50.1    3e-04   
ref|WP_034936777.1|  CBS domain-containing protein                    50.1    3e-04   
ref|NP_001175656.1|  Os08g0513400                                     48.9    3e-04   
ref|WP_035082515.1|  hypothetical protein                             48.1    3e-04   
ref|WP_015078667.1|  CP12 domain-containing protein                   48.1    3e-04   
gb|ELR97775.1|  CBS domain-containing protein                         50.1    3e-04   
ref|WP_016952406.1|  CP12 polypeptide                                 49.7    4e-04   
ref|WP_026721110.1|  hypothetical protein                             49.3    6e-04   
ref|WP_026079653.1|  hypothetical protein                             48.9    8e-04   
gb|AFY67754.1|  protein of unknown function CP12                      47.4    8e-04   
ref|WP_041641677.1|  CBS domain-containing protein                    48.9    0.001   
gb|ADI65714.1|  CBS domain containing protein                         48.9    0.001   



>ref|XP_007201261.1| hypothetical protein PRUPE_ppa013259mg [Prunus persica]
 gb|EMJ02460.1| hypothetical protein PRUPE_ppa013259mg [Prunus persica]
Length=132

 Score =   147 bits (372),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 96/125 (77%), Gaps = 18/125 (14%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKG-----------FRPVAAAPDSLSEKVA  308
            R+L KA E+   +AFQP   L+NP   W+RS G            RPV+AAPD +SEKVA
Sbjct  15   RMLAKATETP--KAFQP-AWLSNP---WRRSGGQQLLGGGRMTMIRPVSAAPDKISEKVA  68

Query  309  ESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDEC  488
            ES+K+AE+TC+DDP SGECVAAWDEVEELSAAASHARD +K+ SDPLE +CKDNPETDEC
Sbjct  69   ESIKSAEETCSDDPASGECVAAWDEVEELSAAASHARDNKKT-SDPLETFCKDNPETDEC  127

Query  489  RTYDN  503
            RTYDN
Sbjct  128  RTYDN  132



>ref|XP_008235152.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Prunus 
mume]
Length=169

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 95/125 (76%), Gaps = 18/125 (14%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKG-----------FRPVAAAPDSLSEKVA  308
            RVL KA E+   +AFQP   L+NP   W+RS              RPV+AAPD +SEKVA
Sbjct  52   RVLAKATETP--KAFQP-AWLSNP---WRRSGSQQLLGGGRMTMIRPVSAAPDKISEKVA  105

Query  309  ESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDEC  488
            ES+K+AE+TC+DDP SGECVAAWDEVEELSAAASHARD +K+ SDPLE +CKDNPETDEC
Sbjct  106  ESIKSAEETCSDDPASGECVAAWDEVEELSAAASHARDNKKT-SDPLETFCKDNPETDEC  164

Query  489  RTYDN  503
            RTYDN
Sbjct  165  RTYDN  169



>ref|XP_008359430.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=129

 Score =   145 bits (367),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 88/118 (75%), Gaps = 11/118 (9%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLW-----VWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            VL KA E    +AF     LN P W     V +R    RPV+AAPD LSEKVAES+K+AE
Sbjct  18   VLSKATEVP--RAFH---SLNVPTWRSYSSVGRRMTMVRPVSAAPDKLSEKVAESIKSAE  72

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            +TC+DDP SGECVAAWDEVEELSAA SH RD +KS SDPLE +CKDNPETDECRTYDN
Sbjct  73   ETCSDDPASGECVAAWDEVEELSAAVSHKRDNEKS-SDPLETFCKDNPETDECRTYDN  129



>ref|XP_009339774.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=153

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 88/118 (75%), Gaps = 11/118 (9%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLW-----VWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            VL KA E    +AF     LN P W     V +R    RPV+AAPD LSEKVAES+K+AE
Sbjct  42   VLSKATEVP--RAFH---SLNVPTWRSYSSVGRRMTIVRPVSAAPDKLSEKVAESIKSAE  96

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            +TC+DDP SGECVAAWDEVEELSAA SH RD +KS SDPLE +CKDNPETDECRTYDN
Sbjct  97   ETCSDDPASGECVAAWDEVEELSAAVSHKRDNEKS-SDPLETFCKDNPETDECRTYDN  153



>ref|XP_002275043.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Vitis 
vinifera]
Length=128

 Score =   145 bits (365),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 91/121 (75%), Gaps = 12/121 (10%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF-------RPVAAAPDSLSEKVAESVK  320
            RVL +A +S   Q  Q P  L+NP   WKR   F       RPVAAAPDS+SEKV ES+K
Sbjct  13   RVLARAADSPKSQTIQSPW-LSNP---WKRPSRFGAGRMCVRPVAAAPDSISEKVVESIK  68

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            NAE+ C+DDP SGECVAAWDEVEELSAAASHARD++K  SDPLE YCKDNPE +ECRTY+
Sbjct  69   NAEEKCSDDPASGECVAAWDEVEELSAAASHARDKKK-ESDPLETYCKDNPEDEECRTYE  127

Query  501  N  503
            +
Sbjct  128  D  128



>ref|XP_009378720.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Pyrus 
x bretschneideri]
Length=129

 Score =   144 bits (364),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 89/118 (75%), Gaps = 11/118 (9%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLW-----VWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            VL KA E+   +AFQ    LN P W     V +R    RPV+AAPD LSEKVAES+K+AE
Sbjct  18   VLSKATEAP--RAFQ---SLNIPTWRSYSSVGRRMTMVRPVSAAPDKLSEKVAESIKSAE  72

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            + C+DDP SGECVAAWDEVEELSAAASH RD QKS SDPLE +C DNPETDECRTYD+
Sbjct  73   EKCSDDPASGECVAAWDEVEELSAAASHKRDNQKS-SDPLETFCNDNPETDECRTYDS  129



>ref|XP_009604948.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=129

 Score =   142 bits (357),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 88/121 (73%), Gaps = 11/121 (9%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF-------RPVAAAPDSLSEKVAESVK  320
            RVL KA  S   + F+ PC LNNP   WK+S  F       +PV+AAPD LS+ V +SVK
Sbjct  13   RVLAKASNSSKVEPFKFPC-LNNP---WKKSAQFGSRRMYLKPVSAAPDKLSDLVVDSVK  68

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
             AE+ C+++P SGEC AAWD VEE SAAASHARD+QK NSDPLE YCK+NPETDECR YD
Sbjct  69   GAEEACSENPASGECAAAWDVVEETSAAASHARDKQKQNSDPLEGYCKENPETDECRVYD  128

Query  501  N  503
            N
Sbjct  129  N  129



>ref|XP_008355495.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=145

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 86/117 (74%), Gaps = 11/117 (9%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLW-----VWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            VL K  E+   +AFQ    LN P W     V +R    RPV AAPD LSEKVAES+K+AE
Sbjct  35   VLSKTTEAP--RAFQ---SLNIPTWRSYSSVGRRMTLVRPVTAAPDKLSEKVAESIKSAE  89

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            + C+DDP SGECVAAWDEVEELSAAASH R  +KS SDPLE +CKDNPETDECRTYD
Sbjct  90   EKCSDDPASGECVAAWDEVEELSAAASHKRANEKS-SDPLETFCKDNPETDECRTYD  145



>ref|XP_011079555.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Sesamum 
indicum]
Length=129

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 12/102 (12%)
 Frame = +3

Query  222  LNNPLWVWKR-----SKG---FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAW  377
            LN+P   WKR     S G    RPVAAAPD +S+KV +S+KNA++ C+DDPVSGEC AAW
Sbjct  32   LNSP---WKRCTTQFSHGRMYVRPVAAAPDQISDKVEQSIKNAQEACSDDPVSGECAAAW  88

Query  378  DEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD+QK  SDPLEN+CKDNPETDECRTYDN
Sbjct  89   DEVEELSAAASHARDKQK-ESDPLENFCKDNPETDECRTYDN  129



>ref|XP_002515284.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47268.1| conserved hypothetical protein [Ricinus communis]
Length=128

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 89/122 (73%), Gaps = 15/122 (12%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRS--------KGFRPVAAAPDSLSEKVAESV  317
            RV+ KA ++   Q   P  +LNNP   WKR+           +PV AAPDS+SEKV ES+
Sbjct  14   RVIAKATDAPKAQ---PIFKLNNP---WKRAGCQLRSQRMQIKPVRAAPDSISEKVEESI  67

Query  318  KNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTY  497
            K+A+Q C DDP SGECVAAWD VEELSAAASHARD+ K +SDPLE YCKDNPETDECRTY
Sbjct  68   KDAKQACEDDPASGECVAAWDTVEELSAAASHARDKAK-DSDPLETYCKDNPETDECRTY  126

Query  498  DN  503
            ++
Sbjct  127  ED  128



>gb|KJB41735.1| hypothetical protein B456_007G122700 [Gossypium raimondii]
Length=128

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 1/86 (1%)
 Frame = +3

Query  246  KRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR  425
            +R +  +PV AAPDS+SEKV +SVK A++ C+DDP SGECVAAWDEVEELSAAASHARD+
Sbjct  44   RRMQVMKPVRAAPDSISEKVEKSVKEAQEACSDDPASGECVAAWDEVEELSAAASHARDK  103

Query  426  QKSNSDPLENYCKDNPETDECRTYDN  503
            +K N DPLENYCKDNPETDECRTYDN
Sbjct  104  KKDN-DPLENYCKDNPETDECRTYDN  128



>emb|CAA96570.1| CP12 [Pisum sativum]
Length=127

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 79/97 (81%), Gaps = 1/97 (1%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            P      L    R K  +PV AAP+ +S+KV ES+K+A++TCADDPVSGECVAAWDEVEE
Sbjct  32   PLSTRQTLTGSGRMKIVQPVRAAPEQISKKVEESIKSAQETCADDPVSGECVAAWDEVEE  91

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARDR+K  SDPLE+YCKDNPETDEC+TYDN
Sbjct  92   LSAAASHARDRKK-ESDPLEDYCKDNPETDECKTYDN  127



>ref|XP_009774670.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Nicotiana 
sylvestris]
Length=129

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 86/121 (71%), Gaps = 11/121 (9%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF-------RPVAAAPDSLSEKVAESVK  320
            RVL     S   + F+ PC LNNP   WK S  F       +PV+AAPD LS+ VA+SVK
Sbjct  13   RVLANKSNSPKVEPFKFPC-LNNP---WKNSAQFGSSRMYLKPVSAAPDKLSDLVADSVK  68

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
             AE+ C+++P SGEC AAWD VEE SAAASHARD+QK NSDPLE YCK+NPETDECR YD
Sbjct  69   GAEEACSENPASGECAAAWDVVEETSAAASHARDKQKQNSDPLEGYCKENPETDECRVYD  128

Query  501  N  503
            N
Sbjct  129  N  129



>ref|XP_011082421.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Sesamum 
indicum]
Length=127

 Score =   137 bits (345),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
             RPVAAAPD LS+KV ES+KNA++ C++DPVSGECVAAWDEVEELSAAASHA+D+ K +S
Sbjct  48   VRPVAAAPDKLSDKVEESIKNAQEACSEDPVSGECVAAWDEVEELSAAASHAKDKNK-DS  106

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLENYCKDNPETDECRTYDN
Sbjct  107  DPLENYCKDNPETDECRTYDN  127



>ref|XP_009116912.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Brassica 
rapa]
 gb|ABL97989.1| putative chloroplast protein CP12 [Brassica rapa]
 emb|CDY11420.1| BnaA09g39860D [Brassica napus]
Length=130

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 84/102 (82%), Gaps = 5/102 (5%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSK---GFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAWD  380
            P RLNNP  +  R+     FRPV + P+  +S+KV +S+K+A+++CADDPVSGECVAAWD
Sbjct  29   PVRLNNPWKLGSRTNRLVSFRPVKSTPEGVISDKVEKSIKDAKESCADDPVSGECVAAWD  88

Query  381  EVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            EVEELSAAASHARD++K+  SDPLE YCKDNPETDECRTYDN
Sbjct  89   EVEELSAAASHARDKKKAGGSDPLEEYCKDNPETDECRTYDN  130



>dbj|BAH03328.1| chloroplast protein 12 [Fagus crenata]
Length=130

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 89/123 (72%), Gaps = 14/123 (11%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF---------RPVAAAPDSLSEKVAES  314
            RVL K+ +S   Q  + P   ++    WKR   F         RPV+AAP+ +S+KVAES
Sbjct  13   RVLAKSADSPKAQTIKSPWLSHS----WKRPTLFGYAGRSMQVRPVSAAPEKISDKVAES  68

Query  315  VKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRT  494
            +K+AE+ CA DP SGECVAAWDEVEELSAAASHARD++K  SDPLE YCKDNPET+ECRT
Sbjct  69   IKDAEEACAGDPASGECVAAWDEVEELSAAASHARDKKK-GSDPLEEYCKDNPETEECRT  127

Query  495  YDN  503
            Y++
Sbjct  128  YED  130



>ref|XP_010523926.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Tarenaya 
hassleriana]
Length=127

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 80/104 (77%), Gaps = 10/104 (10%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG------FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAA  374
            P RLN P   W+   G       R V AAPD +SEKV +S++ A++TCADDP SGECVAA
Sbjct  27   PVRLNYP---WRSGSGSTRLVEARRVRAAPDRISEKVEKSIEEAKETCADDPKSGECVAA  83

Query  375  WDEVEELSAAASHARDRQKSNS-DPLENYCKDNPETDECRTYDN  503
            WDEVEELSAAASHARD+QK+   DPLENYCKDNPETDECRTYDN
Sbjct  84   WDEVEELSAAASHARDKQKAGGNDPLENYCKDNPETDECRTYDN  127



>emb|CDX76635.1| BnaC08g32210D [Brassica napus]
Length=129

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 7/121 (6%)
 Frame = +3

Query  159  NRVLGKALESQNGQA-FQPPCRLNNPLWVWKRSK----GFRPVAAAPDS-LSEKVAESVK  320
            N    +A+ S+N  A    P RLNNP  +  R+      FRPV +AP+  +S+KV +S+K
Sbjct  9    NIATQRAITSENRPARLACPVRLNNPWNLGSRTTNRLVSFRPVKSAPEGVISDKVEKSIK  68

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTY  497
            +AE+TCA DPVSGECVAAWDEVEELSAAASHARD++K+  SDPLE YCKDNPET+ECRTY
Sbjct  69   DAEETCAGDPVSGECVAAWDEVEELSAAASHARDKKKAEGSDPLEEYCKDNPETNECRTY  128

Query  498  D  500
            D
Sbjct  129  D  129



>ref|XP_004152225.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004156820.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cucumis 
sativus]
 gb|KGN52853.1| Chloroplast protein 12 [Cucumis sativus]
Length=128

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 87/124 (70%), Gaps = 18/124 (15%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWV---WKRSKGFR-------PVAAAPDSLSEKVAE  311
            R++ KA       A  P  +L N  W+   WK+S           PV AAPD +S+KV E
Sbjct  13   RIMAKA-------AKTPKVQLLNVGWLRCSWKQSAQLGAIRLRVPPVHAAPDKISDKVEE  65

Query  312  SVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECR  491
            S+KNAE+ CA DPVSGEC AAWDEVEELSAAASHARDR+K  SDPLE+YCKDNPET+ECR
Sbjct  66   SIKNAEEACAGDPVSGECAAAWDEVEELSAAASHARDRKK-ESDPLESYCKDNPETEECR  124

Query  492  TYDN  503
            TYDN
Sbjct  125  TYDN  128



>ref|XP_003625969.1| CP12 [Medicago truncatula]
 gb|AES82187.1| calvin cycle protein CP12-1 [Medicago truncatula]
Length=128

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = +3

Query  249  RSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQ  428
            R    RPV AAP+ +S+KV ES+K+A++TCADDPVSGECVAAWDEVEELSAAASHARDR+
Sbjct  45   RMTVVRPVRAAPEQISKKVEESIKSAQETCADDPVSGECVAAWDEVEELSAAASHARDRK  104

Query  429  KSNSDPLENYCKDNPETDECRTYDN  503
            K +SDPLE+YCKDNPETDEC+T+D 
Sbjct  105  K-DSDPLEDYCKDNPETDECKTFDT  128



>ref|XP_004300451.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=127

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = +3

Query  249  RSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQ  428
            R +  RPVAAAPD LS+KV ES+K AEQ C++DP SGECVAAWDEVEELSAAASH RD +
Sbjct  44   RMRMIRPVAAAPDKLSDKVRESIKEAEQACSEDPASGECVAAWDEVEELSAAASHKRDNE  103

Query  429  KSNSDPLENYCKDNPETDECRTYDN  503
            K N DPLE YC DNPETDECRTYDN
Sbjct  104  K-NKDPLETYCNDNPETDECRTYDN  127



>gb|AFK34703.1| unknown [Medicago truncatula]
Length=131

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +3

Query  162  RVLGKALES-QNGQAFQP-PCRLNNPLWVWKRSKG----FRPVAAAPDSLSEKVAESVKN  323
            RV+ K  ES Q  QA +  P  + N  W    S G     RPV A+PD ++ KV ES+K+
Sbjct  14   RVIFKGPESLQKSQAIRSGPVFMLNQRWTGAVSSGRMVSIRPVQASPD-ITGKVEESIKS  72

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            AE+TCA D  SGECVAAWDEVEELSAAASHARD++K+ SDPLE YCKDNPETDECRTYDN
Sbjct  73   AEETCAGDATSGECVAAWDEVEELSAAASHARDKKKT-SDPLEEYCKDNPETDECRTYDN  131



>gb|KJB49824.1| hypothetical protein B456_008G139400 [Gossypium raimondii]
Length=122

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 9/104 (9%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFR----PVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVA  371
             + PC LN P   WKR    +    PV AAPD +SEKV +S+K A++ C+DDP SGECVA
Sbjct  24   LKVPC-LNRP---WKRVSPMKLRVGPVRAAPDGISEKVEKSIKEAQEMCSDDPASGECVA  79

Query  372  AWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            AWDEVEELSAAASHARD++K + DPLENYCKDNPETDECRTYDN
Sbjct  80   AWDEVEELSAAASHARDKKK-DDDPLENYCKDNPETDECRTYDN  122



>ref|XP_002302764.2| CP12 domain-containing family protein [Populus trichocarpa]
 gb|ABK95858.1| unknown [Populus trichocarpa]
 gb|EEE82037.2| CP12 domain-containing family protein [Populus trichocarpa]
Length=127

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 86/122 (70%), Gaps = 15/122 (12%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF--------RPVAAAPDSLSEKVAESV  317
            RVL KA +    QA     +LN P   W+R+           RPV AAPDS+SEKV +S+
Sbjct  13   RVLAKATDKPKAQAL---VKLNQP---WRRTYHLGSGGRMQIRPVRAAPDSISEKVEKSI  66

Query  318  KNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTY  497
            K+AE  C+DD  SGEC AAWDEVEELSAAASHA+D++K  SDPLE YCKDNPETDECRTY
Sbjct  67   KDAEAACSDDAASGECAAAWDEVEELSAAASHAKDKKK-GSDPLEEYCKDNPETDECRTY  125

Query  498  DN  503
            ++
Sbjct  126  ED  127



>ref|XP_008454293.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Cucumis 
melo]
Length=128

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 87/124 (70%), Gaps = 18/124 (15%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWV---WKRSK---GFR----PVAAAPDSLSEKVAE  311
            R+L KA ++   Q         N  W+   WK+S      R    PV AAPD +S+KV E
Sbjct  13   RILAKAAQTPKVQPL-------NVGWLRCSWKQSARVGAIRLRVPPVHAAPDKISDKVEE  65

Query  312  SVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECR  491
            S+KNAE+ CA DPVSGEC AAWDEVEELSAAASHARDR+K  SDPLENYCKDNPET+ECR
Sbjct  66   SIKNAEEACAGDPVSGECAAAWDEVEELSAAASHARDRKK-ESDPLENYCKDNPETEECR  124

Query  492  TYDN  503
            TYDN
Sbjct  125  TYDN  128



>ref|XP_010468958.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Camelina 
sativa]
Length=131

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (81%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPD-SLSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+      FRPV A P+  +S+ V +S+K+A++TCADDPVSGECVAAW
Sbjct  29   PVRLNNPWNLGSRTTSRMVRFRPVKAGPEKGISDVVEKSIKDAQKTCADDPVSGECVAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K++ SDPLE YCKDNPET+ECRTYD 
Sbjct  89   DEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDT  131



>ref|XP_011042247.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Populus 
euphratica]
Length=126

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 14/121 (12%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF-------RPVAAAPDSLSEKVAESVK  320
            RVL KA +    Q   P  +LN P   W+R+          RPV AAPDS+SEKV +S+K
Sbjct  13   RVLAKATDKPRAQ---PLIKLNQP---WRRTYHLGSGRMQIRPVRAAPDSISEKVEKSIK  66

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            +AE  C+DD  SGEC AAWDEVEELSAAASHA+D++K  SDPLE YCKDNPETDECRTY+
Sbjct  67   DAEAACSDDAASGECAAAWDEVEELSAAASHAKDKKK-GSDPLEEYCKDNPETDECRTYE  125

Query  501  N  503
            +
Sbjct  126  D  126



>ref|XP_004495904.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cicer 
arietinum]
Length=132

 Score =   132 bits (333),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 84/124 (68%), Gaps = 15/124 (12%)
 Frame = +3

Query  162  RVLGKALES-QNGQAFQPPCRLNNPLWVWKRSKG---------FRPVAAAPDSLSEKVAE  311
            RVL K  ES Q   A     R      + +R  G          RPV AAPDS+SEKV E
Sbjct  14   RVLFKGPESLQKSHAI----RFGPVFMLSQRRTGSVSSGRILTIRPVRAAPDSISEKVEE  69

Query  312  SVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECR  491
            S+KNAE+ C+ D  SGECVAAWDEVEELSAAASHARD++K  SDPL+ YCKDNPE+DECR
Sbjct  70   SIKNAEEACSGDATSGECVAAWDEVEELSAAASHARDKKK-ESDPLDEYCKDNPESDECR  128

Query  492  TYDN  503
            TYDN
Sbjct  129  TYDN  132



>ref|XP_006402378.1| hypothetical protein EUTSA_v10006414mg [Eutrema salsugineum]
 dbj|BAJ34148.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43831.1| hypothetical protein EUTSA_v10006414mg [Eutrema salsugineum]
Length=131

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+       RPV A P+  +++KV +S+K AE+TCA DPVSGECVAAW
Sbjct  29   PVRLNNPWNLGSRTTNRMVKIRPVKATPEGGITDKVEKSIKEAEETCAGDPVSGECVAAW  88

Query  378  DEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K+  SDPLE YCKDNPET+ECRTYDN
Sbjct  89   DEVEELSAAASHARDKKKAGGSDPLEEYCKDNPETNECRTYDN  131



>gb|EPS59920.1| hypothetical protein M569_14886, partial [Genlisea aurea]
Length=104

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 81/103 (79%), Gaps = 12/103 (12%)
 Frame = +3

Query  219  RLNNPLWVWKRS--KGFRP------VAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAA  374
            RLN P   W+RS  +G R       VAAAPD LS+KV ES+KNA++TCADDPVSGEC AA
Sbjct  6    RLNTP---WRRSSFRGRRIRSDVVVVAAAPDRLSDKVEESIKNAQETCADDPVSGECAAA  62

Query  375  WDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            WDEVEELSAAA HAR++ K  +DPLENYCKDNPE DECRTYDN
Sbjct  63   WDEVEELSAAAGHAREK-KLEADPLENYCKDNPEVDECRTYDN  104



>gb|KDP28257.1| hypothetical protein JCGZ_14028 [Jatropha curcas]
Length=126

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 86/121 (71%), Gaps = 14/121 (12%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRS-------KGFRPVAAAPDSLSEKVAESVK  320
            RV+ KA ++   Q   P  +LN+P   W R+          +P  AAPD +SEKV +S+K
Sbjct  13   RVVAKATDAPKAQ---PIFKLNHP---WNRTYQVGSGRMRMQPARAAPDRISEKVEKSIK  66

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
             AE+ CA DP SGECVAAWDEVEELSAAASHARD++K  SDPLE +CKDNPETDECRTYD
Sbjct  67   EAEEACAGDPASGECVAAWDEVEELSAAASHARDKKK-ESDPLEEFCKDNPETDECRTYD  125

Query  501  N  503
            N
Sbjct  126  N  126



>gb|KJB06277.1| hypothetical protein B456_001G144300 [Gossypium raimondii]
Length=126

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 85/120 (71%), Gaps = 12/120 (10%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKR------SKGFRPVAAAPDSLSEKVAESVKN  323
            R      +S  G   + P  LN P   WKR      S+  + V AAPDSLSEKV +S+K 
Sbjct  13   RATASLRDSTKGSPIKVP-YLNQP---WKRVLSPLESRRMQ-VRAAPDSLSEKVEQSIKE  67

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            A++ C+DDP SGECVAAWDEVEELSAAASHARDR K N DPLENYCKDNPETDEC+TYDN
Sbjct  68   AQEACSDDPASGECVAAWDEVEELSAAASHARDRLKDN-DPLENYCKDNPETDECKTYDN  126



>emb|CDP17070.1| unnamed protein product [Coffea canephora]
Length=127

 Score =   132 bits (331),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            PC+ +       R    RP+AAAP+ LS++VAESVK+AE+ CA DP SGEC AAWDEVEE
Sbjct  32   PCKSSTTAHFVHRGLSVRPLAAAPERLSDQVAESVKHAEEACAGDPESGECAAAWDEVEE  91

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARDR+K  +D LE+YCKDNPET+ECRTYDN
Sbjct  92   LSAAASHARDRKK-ETDVLEDYCKDNPETEECRTYDN  127



>ref|XP_008451482.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Cucumis 
melo]
Length=125

 Score =   131 bits (330),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 78/97 (80%), Gaps = 3/97 (3%)
 Frame = +3

Query  219  RLNNPL--WVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            RL+ P   W   R     PVAAAPD +SEKV ES+KNAE TC++DP SGEC AAWDEVEE
Sbjct  30   RLSYPWKRWTSGRMSAVGPVAAAPDRISEKVVESIKNAEVTCSEDPASGECAAAWDEVEE  89

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARDR K ++DPLE++CKDNPET+ECRTY++
Sbjct  90   LSAAASHARDRLK-DADPLEDFCKDNPETEECRTYED  125



>gb|KFK35421.1| hypothetical protein AALP_AA5G282200 [Arabis alpina]
Length=132

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSK----GFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+      F PV A P+  +S+ V +S+K+A++TCA DPVSGECVAAW
Sbjct  30   PVRLNNPWNLASRTTNRMVSFNPVKATPEGGISDIVEKSIKDAQETCAGDPVSGECVAAW  89

Query  378  DEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K+  SDPLE YCKDNPETDECRTYDN
Sbjct  90   DEVEELSAAASHARDKKKAGGSDPLEEYCKDNPETDECRTYDN  132



>ref|XP_010413280.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Camelina 
sativa]
Length=131

 Score =   132 bits (331),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (81%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPD-SLSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+      FRPV AAP+  +S+ V +S+K+A+ TCADDPVSGECVAAW
Sbjct  29   PVRLNNPWNLGSRTTSRMVRFRPVKAAPEKGISDVVEKSIKDAQDTCADDPVSGECVAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K++ SDPLE YCK+NPET+ECRTYD 
Sbjct  89   DEVEELSAAASHARDKKKADGSDPLEEYCKENPETNECRTYDT  131



>emb|CDY25110.1| BnaC06g18520D [Brassica napus]
Length=129

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+       RPV A P+  +S+KV +S+K+AE+TCA DPVSGECVAAW
Sbjct  30   PVRLNNPWNIGSRTTNRMVTVRPVKATPEGVISDKVEKSIKDAEETCAGDPVSGECVAAW  89

Query  378  DEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            DEVEELSAAASHARD++K +SDPLE YCKDNPET ECRTYD
Sbjct  90   DEVEELSAAASHARDKKK-DSDPLEEYCKDNPETSECRTYD  129



>ref|XP_010087241.1| hypothetical protein L484_009750 [Morus notabilis]
 ref|XP_010089346.1| hypothetical protein L484_000210 [Morus notabilis]
 gb|EXB28591.1| hypothetical protein L484_009750 [Morus notabilis]
 gb|EXC36196.1| hypothetical protein L484_000210 [Morus notabilis]
Length=131

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            P   N  L  + R    RPV AAPD LS+KVAESVKNAE+ C+D+P SGECVAAWDEVEE
Sbjct  36   PWNYNKRLSQYGRLMVVRPVMAAPDKLSDKVAESVKNAEEACSDNPASGECVAAWDEVEE  95

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARD++KS +D LE YCKDNPE DECRTY++
Sbjct  96   LSAAASHARDKKKS-TDSLEEYCKDNPEADECRTYED  131



>ref|XP_007051103.1| CP12 domain-containing protein 1 [Theobroma cacao]
 gb|EOX95260.1| CP12 domain-containing protein 1 [Theobroma cacao]
Length=208

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 13/122 (11%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKR--------SKGFRPVAAAPDSLSEKVAESV  317
            RV+   L+S    + + P  LN P   WKR         +  RPV AAPDS+S+KV +S+
Sbjct  92   RVVANVLDSTKASSVKVP-YLNQP---WKRVSQLGSRRMQVIRPVRAAPDSISDKVEKSI  147

Query  318  KNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTY  497
            K AE+ C+ DP SGECVAAWDEVEELSAAASHAR+++K N DPLENYCKD+PETDECRTY
Sbjct  148  KEAEEACSGDPASGECVAAWDEVEELSAAASHAREKKKGN-DPLENYCKDHPETDECRTY  206

Query  498  DN  503
            ++
Sbjct  207  ED  208



>ref|XP_010544968.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Tarenaya 
hassleriana]
Length=130

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 79/107 (74%), Gaps = 13/107 (12%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG--------FRPV-AAAPDSLSEKVAESVKNAEQTCADDPVSGEC  365
            P  L+ P   WK   G         R V AAAPD +SEKV +S+K AE+TC+DDP SGEC
Sbjct  27   PVSLSYP---WKMGTGTTRMGSGRVRQVRAAAPDRISEKVEKSIKEAEETCSDDPASGEC  83

Query  366  VAAWDEVEELSAAASHARDRQKSNS-DPLENYCKDNPETDECRTYDN  503
            VAAWDEVEELSAAASHARD+QK+   DPLENYCKDNPE DECRTYDN
Sbjct  84   VAAWDEVEELSAAASHARDKQKAGGNDPLENYCKDNPEADECRTYDN  130



>ref|XP_009104385.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Brassica 
rapa]
Length=129

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 6/105 (6%)
 Frame = +3

Query  201  AFQPPCRLNNPLWVWKRSK----GFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGEC  365
            +   P RLNNP  +  R+       RPV A P+  +S+KV +S+K+AE+TCA DPVSGEC
Sbjct  26   SLAGPVRLNNPWNLGSRTTNRMAAVRPVKATPEGVISDKVEKSIKDAEETCAGDPVSGEC  85

Query  366  VAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            VAAWDEVEELSAAASHARD++K +SDPLE YCKDNPET+ECRTYD
Sbjct  86   VAAWDEVEELSAAASHARDKKK-DSDPLEEYCKDNPETNECRTYD  129



>ref|XP_003591401.1| Calvin cycle protein CP12 [Medicago truncatula]
 gb|ACJ83864.1| unknown [Medicago truncatula]
 gb|AES61652.1| calvin cycle protein CP12-1 [Medicago truncatula]
 gb|AFK43368.1| unknown [Medicago truncatula]
Length=131

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 8/120 (7%)
 Frame = +3

Query  162  RVLGKALES-QNGQAFQP-PCRLNNPLWVWKRSKG----FRPVAAAPDSLSEKVAESVKN  323
            RV+ K  ES Q  QA +  P  + N  W    S G     RPV A+PD ++ KV ES+K+
Sbjct  14   RVIFKGPESLQKSQAIRSGPVFMLNQRWTGAVSSGRMVSIRPVQASPD-ITGKVEESIKS  72

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            AE+ CA D  SGECVAAWDEVEELSAAASHARD++K+ SDPLE YCKDNPETDECRTYDN
Sbjct  73   AEEACAGDATSGECVAAWDEVEELSAAASHARDKKKT-SDPLEEYCKDNPETDECRTYDN  131



>ref|XP_010512631.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Camelina 
sativa]
Length=131

 Score =   131 bits (329),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 83/103 (81%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPD-SLSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLN P  +  R+      FRPV AAP+  +S+ V +S+K+A++TCADDPVSGECVAAW
Sbjct  29   PVRLNYPWNLGSRTTNRMVRFRPVKAAPEKGISDVVEKSIKDAQETCADDPVSGECVAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K++ SDPLE YCKDNPET+ECRTYD 
Sbjct  89   DEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDT  131



>ref|XP_004494423.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Cicer 
arietinum]
Length=123

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            FR V AAPD +SEKV ES+KNA++TCA DP SGECVAAWDEVEELSAAASHARD++K +S
Sbjct  44   FRAVRAAPDKISEKVEESIKNAQETCAGDPTSGECVAAWDEVEELSAAASHARDKKK-DS  102

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE+YCKDNPET EC+T+D+
Sbjct  103  DPLEDYCKDNPETLECKTFDD  123



>emb|CDX67892.1| BnaA07g19320D [Brassica napus]
Length=129

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 6/101 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSK----GFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+       RPV A P+  +S+KV +S+K+AE+TCA DPVSGECVAAW
Sbjct  30   PVRLNNPWNLGSRTTNRMAAVRPVKATPEGVISDKVEKSIKDAEETCAGDPVSGECVAAW  89

Query  378  DEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            DEVEELSAAASHARD++K +SDPLE YCKDNPET ECRTYD
Sbjct  90   DEVEELSAAASHARDKKK-DSDPLEEYCKDNPETSECRTYD  129



>gb|EYU46807.1| hypothetical protein MIMGU_mgv1a016182mg [Erythranthe guttata]
Length=131

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 77/89 (87%), Gaps = 3/89 (3%)
 Frame = +3

Query  243  WKRSKGF--RPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHA  416
            +K+S+ F  RPVAAAPD LS+KV +S+K+A++ C+ DPVSGEC AAWDEVEELSAA SHA
Sbjct  44   FKQSRMFVVRPVAAAPDQLSQKVEQSIKDAQEACSGDPVSGECAAAWDEVEELSAAVSHA  103

Query  417  RDRQKSNSDPLENYCKDNPETDECRTYDN  503
            +D+ K ++DPLE YCKDNPETDECRTYDN
Sbjct  104  KDKSK-DTDPLETYCKDNPETDECRTYDN  131



>gb|ABK96294.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96302.1| unknown [Populus trichocarpa x Populus deltoides]
Length=127

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKG-----FRPVAAAPDSLSEKVAESVKNA  326
            RVL KA ++   Q   PP +LN     W    G      RPV AAP+ +SEKV +S+K A
Sbjct  13   RVLAKATDTPKAQ---PPIKLNQQRRSWSYQLGSGRVQVRPVRAAPEGISEKVEKSIKEA  69

Query  327  EQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            E+ C+ D  SGEC AAWDEVEELSAAASHA+D++K  SDPLE YCKDNPETDECRTY++
Sbjct  70   EEACSGDAASGECAAAWDEVEELSAAASHAKDKKK-GSDPLEEYCKDNPETDECRTYED  127



>ref|XP_004135995.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Cucumis 
sativus]
Length=125

 Score =   129 bits (325),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +3

Query  219  RLNNPL--WVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            RL+ P   W   R      VAAAPD +SEKV ES+KNAE TC++DP SGEC AAWDEVEE
Sbjct  30   RLSYPWKRWTSGRMSAVGTVAAAPDRISEKVVESIKNAEVTCSEDPASGECAAAWDEVEE  89

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARDR  S+SDPLE++CKDNPET+ECRTY++
Sbjct  90   LSAAASHARDRL-SHSDPLEDFCKDNPETEECRTYED  125



>ref|XP_007163176.1| hypothetical protein PHAVU_001G212900g [Phaseolus vulgaris]
 gb|ESW35170.1| hypothetical protein PHAVU_001G212900g [Phaseolus vulgaris]
Length=132

 Score =   129 bits (325),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 1/86 (1%)
 Frame = +3

Query  249  RSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQ  428
            R    RPV AAPD +SEKV ES+K A++ CA DP SGECVAAWDEVEELSAAASHARD+Q
Sbjct  47   RVTRIRPVRAAPDKISEKVEESIKQAQEACAGDPTSGECVAAWDEVEELSAAASHARDKQ  106

Query  429  K-SNSDPLENYCKDNPETDECRTYDN  503
            K  +SDPLENYCKDNPET EC+T+D+
Sbjct  107  KEKDSDPLENYCKDNPETIECKTFDD  132



>ref|XP_004163144.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Cucumis 
sativus]
Length=142

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +3

Query  219  RLNNPL--WVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            RL+ P   W   R      VAAAPD +SEKV ES+KNAE TC++DP SGEC AAWDEVEE
Sbjct  47   RLSYPWKRWTSGRMSAVGTVAAAPDRISEKVVESIKNAEVTCSEDPASGECAAAWDEVEE  106

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARDR  S+SDPLE++CKDNPET+ECRTY++
Sbjct  107  LSAAASHARDRL-SHSDPLEDFCKDNPETEECRTYED  142



>gb|KFK37480.1| hypothetical protein AALP_AA4G262800 [Arabis alpina]
Length=127

 Score =   129 bits (324),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 80/108 (74%), Gaps = 3/108 (3%)
 Frame = +3

Query  186  SQNGQAFQPPCRLNNPLWVWKRSKGFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGE  362
            S +      P RLN P W +      +PV A  +  +SEKV +S++ A++TCADDPVSGE
Sbjct  21   SSSSARLTAPVRLNYP-WKFSNRMVMKPVKATSEGGISEKVEKSIQEAKETCADDPVSGE  79

Query  363  CVAAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            CVAAWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  80   CVAAWDEVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  127



>ref|XP_003554549.2| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
 gb|KHN43459.1| Calvin cycle protein CP12 [Glycine soja]
Length=165

 Score =   130 bits (327),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 82/110 (75%), Gaps = 5/110 (5%)
 Frame = +3

Query  189  QNGQAFQ---PPCRLNNPLWV-WKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVS  356
            QN  A +   PP +   P  +   R    RPV AAP+ +SEKV ES+KNA++ CA DP S
Sbjct  56   QNAHAVKFSLPPSQAVRPGSIKLGRVMRIRPVRAAPERISEKVEESIKNAQEACAGDPTS  115

Query  357  GECVAAWDEVEELSAAASHARDRQK-SNSDPLENYCKDNPETDECRTYDN  503
            GECVAAWDEVEELSAAASHARD+QK  +SDPLENYCKDNPET EC+T+++
Sbjct  116  GECVAAWDEVEELSAAASHARDKQKEKDSDPLENYCKDNPETIECKTFED  165



>dbj|BAJ85428.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 5/90 (6%)
 Frame = +3

Query  249  RSKGFRPVAAA-----PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASH  413
            R+ G R VA A     P  L++KV ES+K AE+TCA DPV GECVAAWDEVEELSAAASH
Sbjct  41   RAHGRRLVAVAGSPSTPPELAQKVTESIKQAEETCAGDPVGGECVAAWDEVEELSAAASH  100

Query  414  ARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            ARDR+K +SDPLE +C+DNPETDECRTYD+
Sbjct  101  ARDRKKEHSDPLEEFCEDNPETDECRTYDS  130



>gb|KGN45014.1| hypothetical protein Csa_7G407670 [Cucumis sativus]
Length=181

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +3

Query  219  RLNNPL--WVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            RL+ P   W   R      VAAAPD +SEKV ES+KNAE TC++DP SGEC AAWDEVEE
Sbjct  86   RLSYPWKRWTSGRMSAVGTVAAAPDRISEKVVESIKNAEVTCSEDPASGECAAAWDEVEE  145

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHARDR  S+SDPLE++CKDNPET+ECRTY++
Sbjct  146  LSAAASHARDRL-SHSDPLEDFCKDNPETEECRTYED  181



>ref|XP_010069841.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW58333.1| hypothetical protein EUGRSUZ_H01016 [Eucalyptus grandis]
Length=122

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 1/78 (1%)
 Frame = +3

Query  270  VAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPL  449
             AAAP+ + EKVAES+K AE+TC+++PVSGEC AAWDEVEELSAAASHARDR+K  SDPL
Sbjct  46   AAAAPEQIEEKVAESIKEAEETCSENPVSGECAAAWDEVEELSAAASHARDRKK-ESDPL  104

Query  450  ENYCKDNPETDECRTYDN  503
            E++CKDNPETDECRTYDN
Sbjct  105  ESFCKDNPETDECRTYDN  122



>ref|XP_002876674.1| CP12-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52933.1| CP12-2 [Arabidopsis lyrata subsp. lyrata]
Length=131

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 81/103 (79%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P  LNNP  +  R+       +P+ AAP+  +S+ V +S+K A++TCA DPVSGECVAAW
Sbjct  29   PVHLNNPWNLGSRTTNRMVKLKPIRAAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++KS+ SDPLE YCKDNPET+ECRTYDN
Sbjct  89   DEVEELSAAASHARDKKKSDGSDPLEEYCKDNPETNECRTYDN  131



>dbj|BAJ90516.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=113

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 73/90 (81%), Gaps = 5/90 (6%)
 Frame = +3

Query  249  RSKGFRPVAAA-----PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASH  413
            R+ G R VA A     P  L++KV ES+K AE+TCA DPV GECVAAWDEVEELSAAASH
Sbjct  24   RAHGRRLVAVAGSPSTPPELAQKVTESIKQAEETCAGDPVGGECVAAWDEVEELSAAASH  83

Query  414  ARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            ARDR+K +SDPLE +C+DNPETDECRTYD+
Sbjct  84   ARDRKKEHSDPLEEFCEDNPETDECRTYDS  113



>ref|XP_006292773.1| hypothetical protein CARUB_v10019023mg [Capsella rubella]
 gb|EOA25671.1| hypothetical protein CARUB_v10019023mg [Capsella rubella]
Length=131

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P RLNNP  +  R+      F PV AAP+  +S+ V +S+K A++TCA DP SGECVAAW
Sbjct  29   PVRLNNPWNLGSRTTSRMVKFSPVKAAPEGGISDVVEKSIKEAQETCAGDPESGECVAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K++ SDPLE YCKDNPET+ECRTYDN
Sbjct  89   DEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN  131



>ref|XP_010267998.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Nelumbo 
nucifera]
Length=130

 Score =   127 bits (320),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 91/121 (75%), Gaps = 13/121 (11%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLWVWKRSKGFR-------PVAAAPDSLSEKVAESVKN  323
            V+ KA +S   Q+F  PC LN+P   W+ ++ FR        +A  P+S+S+KV ES+KN
Sbjct  15   VVAKA-DSTKVQSFGYPC-LNHP---WRMNQCFRSGRLYVRTMATTPESISDKVNESIKN  69

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQK-SNSDPLENYCKDNPETDECRTYD  500
            A++TCA DP SGECVAAWDEVEELSAAASH R +QK  ++DPLE++CKDNPET+ECRTY+
Sbjct  70   AQETCASDPASGECVAAWDEVEELSAAASHIRLKQKEKDADPLEHFCKDNPETEECRTYE  129

Query  501  N  503
            +
Sbjct  130  D  130



>ref|XP_009382502.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=134

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 3/89 (3%)
 Frame = +3

Query  246  KRSKGFRPVAAAPDS---LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHA  416
            +R +    VA+AP +   +SEKV+ES+K AE+ CA D V+GEC AAWDEVEELSAAASHA
Sbjct  46   RRRRSTVLVASAPSTPPDISEKVSESIKKAEEACAGDAVAGECAAAWDEVEELSAAASHA  105

Query  417  RDRQKSNSDPLENYCKDNPETDECRTYDN  503
            RD+ K++SDPLENYCKDNPETDECRTYDN
Sbjct  106  RDKLKTDSDPLENYCKDNPETDECRTYDN  134



>ref|NP_566100.2| stroma protein CP12-1 [Arabidopsis thaliana]
 sp|O22914.1|CP121_ARATH RecName: Full=Calvin cycle protein CP12-1, chloroplastic; AltName: 
Full=CP12 domain-containing protein 1; AltName: Full=Chloroplast 
protein 12-1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL32917.1| putative chloroplast protein CP12 [Arabidopsis thaliana]
 gb|AAM47914.1| putative chloroplast protein CP12 [Arabidopsis thaliana]
 gb|AEC10836.1| CP12 domain-containing protein 1 [Arabidopsis thaliana]
Length=124

 Score =   126 bits (317),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +SEKV +S++ A++TCADDPVSGECVAAWDE
Sbjct  27   PVRLNYP---WKFGSMKRMVVVKATSEGEISEKVEKSIQEAKETCADDPVSGECVAAWDE  83

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   VEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  124



>gb|ACJ85997.1| unknown [Medicago truncatula]
Length=131

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 85/120 (71%), Gaps = 8/120 (7%)
 Frame = +3

Query  162  RVLGKALES-QNGQAFQP-PCRLNNPLWVWKRSKG----FRPVAAAPDSLSEKVAESVKN  323
            RV+ K  ES Q  QA +  P  + N  W    S G     RPV A+PD ++ KV ES+K+
Sbjct  14   RVIFKGPESLQKSQAIRSGPVFMLNQRWTGAVSSGRMVSIRPVQASPD-ITGKVEESIKS  72

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            AE+ CA D  SGECVAAWDEVEELSAAASHARD++K+ SDPLE Y KDNPETDECRTYDN
Sbjct  73   AEEACAGDATSGECVAAWDEVEELSAAASHARDKKKT-SDPLEEYRKDNPETDECRTYDN  131



>ref|XP_010259310.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Nelumbo 
nucifera]
Length=128

 Score =   126 bits (317),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 81/119 (68%), Gaps = 11/119 (9%)
 Frame = +3

Query  159  NRVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGFR----PVAAAPDSLSEKVAESVKNA  326
             RVL K     +    +PPC LN+P W   + +G R     +A  P+ +SEKV ES+K A
Sbjct  17   TRVLAKP----DTGMLRPPC-LNHP-WRLHKFEGRRLRIQAMATTPERISEKVVESIKTA  70

Query  327  EQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            E+ CA DPVSGEC AAWD VEELS+AASH R + K  SDPLE YCKDNPETDECRTYDN
Sbjct  71   EEVCAGDPVSGECAAAWDTVEELSSAASHERQKNK-ESDPLETYCKDNPETDECRTYDN  128



>ref|XP_011041206.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Populus 
euphratica]
Length=126

 Score =   126 bits (317),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 82/118 (69%), Gaps = 8/118 (7%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNN----PLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            RVL KA ++   Q   P  +LN        +W      RPV AAP+ +SEKV +S+K AE
Sbjct  13   RVLAKATDTPKAQ---PLIKLNQQRRRSYQLWSGRVQLRPVRAAPEGISEKVEKSIKEAE  69

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            + C+ D  SGEC AAWDEVEELSAAASHA+D++K  SDPLE YCKDNPETDECRTY++
Sbjct  70   EACSGDTASGECAAAWDEVEELSAAASHAKDKKK-GSDPLEEYCKDNPETDECRTYED  126



>ref|XP_002880299.1| cp12 domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56558.1| cp12 domain-containing protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=124

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +S+KV +S++ A++TCADDPVSGECVAAWDE
Sbjct  27   PVRLNYP---WKFGSMKRMVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDE  83

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   VEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  124



>ref|XP_010506777.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=125

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 77/102 (75%), Gaps = 8/102 (8%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV----AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWD  380
            P RLN P   WK     R V    A +   +S+KV +S++ A++TCADDPVSGECVAAWD
Sbjct  27   PVRLNYP---WKLGSMNRMVVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWD  83

Query  381  EVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            EVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   EVEELSAAASHARDKKKAGVSDPLEEYCSDNPETDECRTYDN  125



>ref|XP_009411634.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=128

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  207  QPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEV  386
            +P  RL   L   +R+       + P  +S+KV+ES+K AE  C+ D VSGEC AAWDEV
Sbjct  30   RPHARLLPLLGGRRRAVLAASAPSTPPDISDKVSESIKKAEDACSGDAVSGECAAAWDEV  89

Query  387  EELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            EELSAAASHARD+ K+NSDPLENYCKDNPETDECRTYDN
Sbjct  90   EELSAAASHARDKLKANSDPLENYCKDNPETDECRTYDN  128



>ref|XP_009142539.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Brassica 
rapa]
Length=127

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 79/107 (74%), Gaps = 9/107 (8%)
 Frame = +3

Query  201  AFQPPCRLNNPLWVWKRSKGFRPVAAAPDS-----LSEKVAESVKNAEQTCADDPVSGEC  365
            +   P RLN P   WK S   R V +   +     +S+KV +S++ A++TCADDPVSGEC
Sbjct  24   SLSAPVRLNYP---WKFSSTKRMVMSVKATSEGEIISDKVEKSIQEAKETCADDPVSGEC  80

Query  366  VAAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VAAWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  81   VAAWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  127



>ref|XP_010518439.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=124

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +S+KV +S++ A++TCADDPVSGECVAAWDE
Sbjct  27   PVRLNYP---WKLGSMNRLVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDE  83

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   VEELSAAASHARDKKKAGGSDPLEEYCTDNPETDECRTYDN  124



>ref|XP_002320298.1| CP12 domain-containing family protein [Populus trichocarpa]
 gb|EEE98613.1| CP12 domain-containing family protein [Populus trichocarpa]
Length=126

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 14/121 (12%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKGF-------RPVAAAPDSLSEKVAESVK  320
            RVL KA ++   Q   P  +LN     W+RS          RPV AAP+ +SEKV +S+K
Sbjct  13   RVLAKATDTPKAQ---PLIKLNQQ---WRRSYQLGSGRVQVRPVRAAPEGISEKVEKSIK  66

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
             AE+ C+ D  SGEC AAWDEVEELSAAASHA+D++K  SDPLE YCKDNPETDECRTY+
Sbjct  67   EAEEACSGDAASGECAAAWDEVEELSAAASHAKDKKK-GSDPLEEYCKDNPETDECRTYE  125

Query  501  N  503
            +
Sbjct  126  D  126



>ref|XP_010507892.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=124

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +S+KV +S++ A++TCADDPVSGECVAAWDE
Sbjct  27   PVRLNYP---WKLGSMNRMVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDE  83

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   VEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  124



>ref|XP_010497708.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=125

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 77/102 (75%), Gaps = 8/102 (8%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV----AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWD  380
            P RLN P   WK     R V    A +   +S+KV +S++ A++TCADDPVSGECVAAWD
Sbjct  27   PVRLNYP---WKLGSMNRMVVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWD  83

Query  381  EVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            EVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   EVEELSAAASHARDKKKAGGSDPLEEYCNDNPETDECRTYDN  125



>ref|XP_010413103.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic, partial 
[Camelina sativa]
Length=103

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +S+KV +S++ A++TCADDPVSGECVAAWDE
Sbjct  6    PVRLNYP---WKLGSMNRMVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDE  62

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  63   VEELSAAASHARDKKKAGGSDPLEEYCTDNPETDECRTYDN  103



>ref|XP_010413104.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Camelina 
sativa]
Length=112

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +S+KV +S++ A++TCADDPVSGECVAAWDE
Sbjct  15   PVRLNYP---WKLGSMNRMVVVKATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDE  71

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  72   VEELSAAASHARDKKKAGGSDPLEEYCTDNPETDECRTYDN  112



>ref|XP_003535935.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
Length=129

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 2/106 (2%)
 Frame = +3

Query  186  SQNGQAFQPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGEC  365
            +Q  QA + P  L+ P+  W      RPV A P+ +SEKV ES+K+AE+ C+      EC
Sbjct  26   AQKAQAVRFPA-LSRPIQKWPGLVKTRPVRATPEKISEKVEESIKSAEEACSGGGGDAEC  84

Query  366  VAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             AAWDEVEELSAAASHAR++QK  SDPLENYCKDNPETDECRTYDN
Sbjct  85   AAAWDEVEELSAAASHAREKQK-QSDPLENYCKDNPETDECRTYDN  129



>emb|CDX80101.1| BnaA05g00550D [Brassica napus]
Length=126

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 78/106 (74%), Gaps = 9/106 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPVAAAPDS-----LSEKVAESVKNAEQTCADDPVSGECV  368
               P RLN P   WK S   R V +   +     +S+KV +S++ A++TCADDPVSGECV
Sbjct  24   LSAPVRLNYP---WKFSSVKRMVMSVKATSEGEIISDKVEKSIQEAKETCADDPVSGECV  80

Query  369  AAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            AAWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  81   AAWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|XP_006397935.1| hypothetical protein EUTSA_v10001682mg [Eutrema salsugineum]
 gb|ESQ39388.1| hypothetical protein EUTSA_v10001682mg [Eutrema salsugineum]
Length=127

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 77/104 (74%), Gaps = 4/104 (4%)
 Frame = +3

Query  204  FQPPCRLNNP--LWVWKRSKGFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAA  374
               P RLN P       R    +P+ A  +  +S+KV +S++ A++TCADDPVSGECVAA
Sbjct  24   LSAPVRLNYPWRFGSMNRMVMVKPIKATSEGGISDKVEKSIQEAKETCADDPVSGECVAA  83

Query  375  WDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            WDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   WDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  127



>emb|CDY27491.1| BnaC04g51320D [Brassica napus]
Length=125

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 77/105 (73%), Gaps = 8/105 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPV----AAAPDSLSEKVAESVKNAEQTCADDPVSGECVA  371
               P RLN P   WK S   R V    A +   +S+KV +S++ A++TCADD VSGECVA
Sbjct  24   LSAPVRLNYP---WKFSSMNRMVMSVKATSEGGISDKVEKSIQEAKETCADDTVSGECVA  80

Query  372  AWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            AWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  81   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  125



>emb|CDY51422.1| BnaA04g26990D [Brassica napus]
Length=124

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 76/104 (73%), Gaps = 8/104 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPV----AAAPDSLSEKVAESVKNAEQTCADDPVSGECVA  371
               P RLN P   WK S   R V    A +   +S+KV +S++ A +TCADDPVSGECVA
Sbjct  24   LSAPVRLNYP---WKFSSMNRMVMSVKATSEGGISDKVEKSIQEATETCADDPVSGECVA  80

Query  372  AWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYD  500
            AWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYD
Sbjct  81   AWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYD  124



>emb|CDY55379.1| BnaC04g51970D [Brassica napus]
Length=126

 Score =   124 bits (310),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPVAAAPDS-----LSEKVAESVKNAEQTCADDPVSGECV  368
               P RLN P   WK S   R V +   +     +S KV +S++ A++TCADDPVSGECV
Sbjct  24   LSAPVRLNYP---WKFSLVKRMVMSVKATSEGEIISVKVEKSIQEAKETCADDPVSGECV  80

Query  369  AAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            AAWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  81   AAWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|XP_006295238.1| hypothetical protein CARUB_v10024325mg [Capsella rubella]
 gb|EOA28136.1| hypothetical protein CARUB_v10024325mg [Capsella rubella]
Length=124

 Score =   124 bits (310),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   W+     R V   A +   +S+KV +S++ A++TCADDPVSGECVAAWDE
Sbjct  27   PVRLNYP---WRFGSMNRMVVVNATSEGGISDKVEKSIQEAKETCADDPVSGECVAAWDE  83

Query  384  VEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  84   VEELSAAASHARDKKKAGVSDPLEEYCNDNPETDECRTYDN  124



>emb|CAA96568.1| CP12 [Spinacia oleracea]
Length=124

 Score =   124 bits (310),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +3

Query  234  LWVWKRSKGFRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAAS  410
            L   +RS G   V AAPD+ +SE V +S+K A++TC+DDPVSGECVAAWD VEELSAAAS
Sbjct  35   LHGGRRSHGLVAVRAAPDNRISENVEKSIKEAQETCSDDPVSGECVAAWDVVEELSAAAS  94

Query  411  HARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            HARD+ K + +PLE YCKDNPETDECRTYDN
Sbjct  95   HARDKAK-DVEPLEEYCKDNPETDECRTYDN  124



>emb|CDX95723.1| BnaC03g26040D [Brassica napus]
Length=126

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPVAAAPDS-----LSEKVAESVKNAEQTCADDPVSGECV  368
               P RLN P   WK     R V +   +     +S+KV +S++ A++TCADDPVSGECV
Sbjct  24   LYAPVRLNYP---WKFGSMNRMVTSVKATSEGGMISDKVEKSIQEAKETCADDPVSGECV  80

Query  369  AAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            AAWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  81   AAWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|XP_009133812.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic isoform 
X1 [Brassica rapa]
 ref|XP_009133813.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic isoform 
X2 [Brassica rapa]
 emb|CDX83329.1| BnaA03g21770D [Brassica napus]
Length=126

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 77/106 (73%), Gaps = 9/106 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPVAAAPDS-----LSEKVAESVKNAEQTCADDPVSGECV  368
               P RLN P   WK     R V +   +     +S+KV +S++ A++TCADDPVSGECV
Sbjct  24   LYAPVRLNYP---WKFGSMNRMVMSVKATSEGGMISDKVEKSIQEAKETCADDPVSGECV  80

Query  369  AAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            AAWDEVEELSAAASHARD++K+  SDPLE YC DNPETDECRTYDN
Sbjct  81   AAWDEVEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYDN  126



>ref|NP_191800.1| calvin cycle protein CP12-2 [Arabidopsis thaliana]
 sp|Q9LZP9.1|CP122_ARATH RecName: Full=Calvin cycle protein CP12-2, chloroplastic; AltName: 
Full=CP12 domain-containing protein 2; AltName: Full=Chloroplast 
protein 12-2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB82955.1| CP12 protein precursor-like protein [Arabidopsis thaliana]
 gb|AAM20142.1| putative CP12 protein precursor [Arabidopsis thaliana]
 gb|AAM45071.1| putative CP12 protein precursor [Arabidopsis thaliana]
 gb|AEE80349.1| calvin cycle protein CP12-2 [Arabidopsis thaliana]
Length=131

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P  LNN   +  R+       +P+ AAP+  +S+ V +S+K A++TCA DPVSGECVAAW
Sbjct  29   PVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K++ SDPLE YCKDNPET+ECRTYDN
Sbjct  89   DEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN  131



>gb|AAK97687.1| At2g47400/T8I13.24 [Arabidopsis thaliana]
 gb|AAN28735.1| At2g47400/T8I13.24 [Arabidopsis thaliana]
Length=124

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 76/101 (75%), Gaps = 7/101 (7%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPV---AAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            P RLN P   WK     R V   A +   +SEKV +S++ A++TCADDPVSGECVAAWDE
Sbjct  27   PVRLNYP---WKFGSMKRMVVVKATSEGEISEKVEKSIQEAKETCADDPVSGECVAAWDE  83

Query  384  VEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARD++K+  SDPLE YC DNPETDE RTYDN
Sbjct  84   VEELSAAASHARDKKKAGGSDPLEEYCNDNPETDEYRTYDN  124



>ref|XP_009118779.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Brassica 
rapa]
Length=124

 Score =   123 bits (308),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 8/104 (8%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPV----AAAPDSLSEKVAESVKNAEQTCADDPVSGECVA  371
               P RLN P   WK S   R V    A A   +S+KV +S++ A +TCADDPVSGECVA
Sbjct  24   LSAPVRLNYP---WKFSSMNRMVMSVKATAEGGISDKVEKSIQEATETCADDPVSGECVA  80

Query  372  AWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYD  500
            AWDE EELSAAASHARD++K+  SDPLE YC DNPETDECRTYD
Sbjct  81   AWDEAEELSAAASHARDKKKAGGSDPLEEYCSDNPETDECRTYD  124



>ref|XP_006444494.1| hypothetical protein CICLE_v10022841mg [Citrus clementina]
 ref|XP_006492335.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR57734.1| hypothetical protein CICLE_v10022841mg [Citrus clementina]
 gb|KDO86998.1| hypothetical protein CISIN_1g032973mg [Citrus sinensis]
Length=130

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 10/101 (10%)
 Frame = +3

Query  222  LNNPLWVWKRSKGFR-------PVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWD  380
            LNNP    KR   FR       P+ AAPD +SEKV +S+K+AE+ C  DP SGEC AAWD
Sbjct  33   LNNP--SRKRPAQFRTGRMHMQPLRAAPDRISEKVEQSIKSAEEACEGDPASGECAAAWD  90

Query  381  EVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            EVEELSAAASHAR+R+K +SDPLE YCKDNPETDECRTY++
Sbjct  91   EVEELSAAASHARERKK-DSDPLEAYCKDNPETDECRTYED  130



>gb|AAM63795.1| CP12 protein precursor-like protein [Arabidopsis thaliana]
Length=131

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 80/103 (78%), Gaps = 6/103 (6%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKG----FRPVAAAPDS-LSEKVAESVKNAEQTCADDPVSGECVAAW  377
            P  LNN   +  R+       +P+ AAP+  +S+ V +S+K A++TCA DPVSGEC+AAW
Sbjct  29   PVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGISDVVEKSIKEAQETCAGDPVSGECIAAW  88

Query  378  DEVEELSAAASHARDRQKSN-SDPLENYCKDNPETDECRTYDN  503
            DEVEELSAAASHARD++K++ SDPLE YCKDNPET+ECRTYDN
Sbjct  89   DEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN  131



>ref|XP_008654881.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Zea mays]
 tpg|DAA45009.1| TPA: hypothetical protein ZEAMMB73_901738 [Zea mays]
Length=126

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  L++KV+ES+K A++TCADDPVSGECVAAWDEVEELSAAASH RDRQK  +DPLE YC
Sbjct  54   PPDLAKKVSESIKQAQETCADDPVSGECVAAWDEVEELSAAASHLRDRQK-GADPLEEYC  112

Query  462  KDNPETDECRTYDN  503
            KDNPETDECRTY++
Sbjct  113  KDNPETDECRTYED  126



>gb|ACU20479.1| unknown [Glycine max]
Length=132

 Score =   123 bits (308),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  249  RSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQ  428
            R    RPV AAP+ +SEKV ES+KNA++ CA DP SGECVAAWDEVEELSAAASHA+ +Q
Sbjct  47   RVMRIRPVRAAPERISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHAKYKQ  106

Query  429  K-SNSDPLENYCKDNPETDECRTYDN  503
            K  +SDPLE YCKDNPET EC+T+++
Sbjct  107  KEKDSDPLETYCKDNPETIECKTFED  132



>gb|KHN19215.1| Calvin cycle protein CP12 [Glycine soja]
Length=132

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  249  RSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQ  428
            R    RPV AAP+ +SEKV ES+KNA++ CA DP SGECVAAWDEVEELSAAASHA+ +Q
Sbjct  47   RVMRIRPVRAAPERISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHAKYKQ  106

Query  429  K-SNSDPLENYCKDNPETDECRTYDN  503
            K  +SDPLE YCKDNPET EC+T+++
Sbjct  107  KEKDSDPLETYCKDNPETIECKTFED  132



>ref|XP_003521594.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
Length=132

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +3

Query  249  RSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQ  428
            R    RPV AAP+ +SEKV ES+KNA++ CA DP SGECVAAWDEVEELSAAASHA+ +Q
Sbjct  47   RVMRIRPVRAAPERISEKVEESIKNAQEACAGDPTSGECVAAWDEVEELSAAASHAKYKQ  106

Query  429  K-SNSDPLENYCKDNPETDECRTYDN  503
            K  +SDPLE YCKDNPET EC+T+++
Sbjct  107  KEKDSDPLETYCKDNPETIECKTFED  132



>ref|XP_003518788.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Glycine 
max]
 gb|KHN08637.1| Calvin cycle protein CP12 [Glycine soja]
Length=128

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (71%), Gaps = 2/106 (2%)
 Frame = +3

Query  186  SQNGQAFQPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGEC  365
            +Q  QA   P  L  P+  W      RPV A P+ +SEKV ES+K+AE+ C+      EC
Sbjct  25   AQKAQAMSFPA-LFRPIQKWPGLVKARPVWATPEKISEKVEESIKSAEEACSGAGGDAEC  83

Query  366  VAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             AAWDEVEELSAAASHAR++QK  SDPLENYCKDNPETDECRTYDN
Sbjct  84   AAAWDEVEELSAAASHAREKQK-QSDPLENYCKDNPETDECRTYDN  128



>ref|XP_006651310.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Oryza 
brachyantha]
Length=108

 Score =   122 bits (305),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 75/100 (75%), Gaps = 4/100 (4%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            FQ P     PL +    +    V + P  L++KV+ES+K AE+TCADDP  GEC AAWDE
Sbjct  13   FQAPMPPPRPLAMVPARQN---VVSTPPELAQKVSESIKQAEETCADDPEGGECAAAWDE  69

Query  384  VEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARDR+K +SDPLE YCKDNPETDECRTY++
Sbjct  70   VEELSAAASHARDRKK-DSDPLEEYCKDNPETDECRTYED  108



>gb|ABS17660.1| chloroplast protein 12, partial [Arnebia euchroma]
Length=86

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
             RPVAA  + LSEKVAES+K+AE+TC+DDPVSGEC AAWDEVEELSAAASHA D+ K  S
Sbjct  7    VRPVAAVQEGLSEKVAESIKSAEETCSDDPVSGECAAAWDEVEELSAAASHAGDKMK-ES  65

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE  CKDN +T+ECRTYD+
Sbjct  66   DPLETLCKDNMDTEECRTYDD  86



>ref|XP_008351460.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=129

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLW-----VWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            VL KA E+     FQ    LN P W     + +     RPV+AAP  LSEKVAES+K  E
Sbjct  18   VLSKATEAL--MTFQ---SLNIPTWRSYSSISRCMTLVRPVSAAPVKLSEKVAESIKIVE  72

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            + C+DDP +GECV AWD+VEELSAAASH R  ++S SDPLE  CKDNPETDECRTY+N
Sbjct  73   EKCSDDPENGECVVAWDKVEELSAAASHKRANEES-SDPLETLCKDNPETDECRTYNN  129



>gb|ADZ23481.1| chloroplast protein 12 [Stylosanthes guianensis]
Length=132

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 80/121 (66%), Gaps = 7/121 (6%)
 Frame = +3

Query  159  NRVLGKALE-SQNGQA--FQPPCRLNN---PLWVWKRSKGFRPVAAAPDSLSEKVAESVK  320
             RVL +  E  Q  Q   F P  RLN     L    R    R V AAPD +SE+V +S+ 
Sbjct  13   TRVLAQGPEIPQKAQTVKFSPVVRLNQRWPALTSSNRVSSVRLVRAAPDRISERVEKSIS  72

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            +A++ C D+P   EC AAWDEVEELSAAASHARD++K  SDPLENYCKDNPETDECR YD
Sbjct  73   DAQEACNDNPAGSECAAAWDEVEELSAAASHARDKKK-ESDPLENYCKDNPETDECRAYD  131

Query  501  N  503
            N
Sbjct  132  N  132



>ref|XP_010038287.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW50111.1| hypothetical protein EUGRSUZ_K03545 [Eucalyptus grandis]
Length=127

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 85/120 (71%), Gaps = 11/120 (9%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRS------KGFRPVAAAPDSLSEKVAESVKN  323
            R + K+ E Q   A   P +LN P   W+RS      +    V++APD + +KVAES+K 
Sbjct  13   RAVPKSAEPQKLSASASP-QLNYP---WRRSCQLAARRRMVVVSSAPDKIEDKVAESIKG  68

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            AE+ C+D+PVSGECVAAWDEVEELSA ASH RD+ K+ SDPLE YCKDNPET ECRTY++
Sbjct  69   AEEACSDNPVSGECVAAWDEVEELSATASHLRDK-KAASDPLEAYCKDNPETAECRTYED  127



>ref|XP_002467982.1| hypothetical protein SORBIDRAFT_01g037510 [Sorghum bicolor]
 gb|EER94980.1| hypothetical protein SORBIDRAFT_01g037510 [Sorghum bicolor]
Length=130

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A P  L+ KV+ES+K A++TCADDPVS ECVAAWDEVEELSAAASHARDRQK   DPLE 
Sbjct  56   ATPPDLANKVSESIKQAKETCADDPVSAECVAAWDEVEELSAAASHARDRQK-GVDPLEE  114

Query  456  YCKDNPETDECRTYDN  503
            YCKDNPETDECRTY++
Sbjct  115  YCKDNPETDECRTYED  130



>ref|XP_004984626.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Setaria 
italica]
Length=130

 Score =   121 bits (304),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A P  LS KV+ES+K+A++ CADDPVSGEC AAWDEVEELSAAASHARDRQK  +DPLE 
Sbjct  56   ATPPDLSNKVSESIKHAQEACADDPVSGECAAAWDEVEELSAAASHARDRQK-GADPLEE  114

Query  456  YCKDNPETDECRTYDN  503
            YCK+NPETDECRTY++
Sbjct  115  YCKENPETDECRTYED  130



>ref|XP_010679381.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=123

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 76/103 (74%), Gaps = 4/103 (4%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFR---PVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAA  374
            F+ P   N   +V  R+   R    V AAPD LS+ V +S+K A++TC+DDPVS ECVAA
Sbjct  22   FEAPKLCNMVTYVKNRNIHARRLVMVRAAPDKLSDNVEKSIKEAQETCSDDPVSSECVAA  81

Query  375  WDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            WD VEE+SAAASHARD+ K  +DPLE YCKDNPETDEC+TYDN
Sbjct  82   WDVVEEVSAAASHARDKAK-ETDPLEEYCKDNPETDECKTYDN  123



>ref|XP_007145148.1| hypothetical protein PHAVU_007G214200g [Phaseolus vulgaris]
 gb|ESW17142.1| hypothetical protein PHAVU_007G214200g [Phaseolus vulgaris]
Length=131

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 72/97 (74%), Gaps = 4/97 (4%)
 Frame = +3

Query  222  LNNPLWVWKRSKGF---RPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            L  P+  W    G    RP+ A P+ LSEKV ES+K+AE+TC+      EC AAWDEVEE
Sbjct  36   LFRPIQKWPGFVGVGKVRPIHATPEKLSEKVEESIKSAEETCSGGGADAECAAAWDEVEE  95

Query  393  LSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            LSAAASHAR++Q+  SDPLENYCK+NPETDECRTYDN
Sbjct  96   LSAAASHAREKQQ-QSDPLENYCKENPETDECRTYDN  131



>ref|XP_003558084.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Brachypodium 
distachyon]
Length=126

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 80/110 (73%), Gaps = 9/110 (8%)
 Frame = +3

Query  198  QAFQPPCRLNNPLWVWK--RSKGFRPV------AAAPDSLSEKVAESVKNAEQTCADDPV  353
            QA  P  RL    +  +  R++G R +      A+ P  L++KV ES+K AE+TCA DP 
Sbjct  18   QAQAPGSRLTVASFAARAVRAQGGRRLVAVAGSASTPPELAQKVTESIKQAEETCAGDPE  77

Query  354  SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             GECVAAWDEVEELSAAASHARDRQK +SDPLE YCK++PE+DECRTY++
Sbjct  78   GGECVAAWDEVEELSAAASHARDRQK-DSDPLEEYCKESPESDECRTYED  126



>emb|CAJ41166.1| chloroplast protein 12 precursor [Cynara cardunculus var. scolymus]
Length=149

 Score =   120 bits (300),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 77/95 (81%), Gaps = 2/95 (2%)
 Frame = +3

Query  258  GFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN  437
            G   V AAP+ LSEK+A S+++A+++CA+D  SGECVAAWDEVEELSAA+SHARD+ K +
Sbjct  13   GRMYVRAAPEGLSEKIASSIESAKESCAEDLASGECVAAWDEVEELSAASSHARDKAK-D  71

Query  438  SDPLENYCKDNPETDECRTYDN*ITSF-ICCVALR  539
            +DPLE YCKDNPETDECRTY++ I +  +  V LR
Sbjct  72   TDPLETYCKDNPETDECRTYEDLIDAIHVFSVLLR  106



>ref|XP_010321871.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Solanum 
lycopersicum]
Length=127

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 77/103 (75%), Gaps = 13/103 (13%)
 Frame = +3

Query  222  LNNPLWVWKRSK--GFRPVA------AAPDS-LSEKVAESVKNAEQTCADDPVSGECVAA  374
            LN+P   WK+S   G+R +         PD  LS+ VAESVK AE+TCA+DPVSGEC AA
Sbjct  29   LNSP---WKKSSQLGYRRMMYVVVPRVVPDKKLSDLVAESVKEAEETCAEDPVSGECKAA  85

Query  375  WDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            WD VEE SAAASHARD++K  SD LENYCKDNPETDECRTYDN
Sbjct  86   WDVVEETSAAASHARDKKK-ESDVLENYCKDNPETDECRTYDN  127



>gb|AAV63570.1| auxin-induced putative CP12 domain-containing protein [Arachis 
hypogaea]
Length=73

 Score =   117 bits (292),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            PD +SEKV +S+K AE+ C D+P S EC AAWDEVEELSAAASHARD++K  SDPLENYC
Sbjct  1    PDKISEKVEKSIKEAEEACTDNPASNECAAAWDEVEELSAAASHARDKKKE-SDPLENYC  59

Query  462  KDNPETDECRTYDN  503
            KDNPETDECRTYDN
Sbjct  60   KDNPETDECRTYDN  73



>ref|NP_001049890.1| Os03g0306800 [Oryza sativa Japonica Group]
 gb|ABF95532.1| CP12, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11804.1| Os03g0306800 [Oryza sativa Japonica Group]
 gb|EAZ26657.1| hypothetical protein OsJ_10560 [Oryza sativa Japonica Group]
 dbj|BAG96228.1| unnamed protein product [Oryza sativa Japonica Group]
Length=131

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  L++KV+ES+K AE+TCA DP  GEC AAWDEVEELSAAASHARDR+K +SDPLE YC
Sbjct  59   PPELAQKVSESIKQAEETCAGDPEGGECAAAWDEVEELSAAASHARDRKK-DSDPLEEYC  117

Query  462  KDNPETDECRTYDN  503
            KDNPETDECRTY++
Sbjct  118  KDNPETDECRTYED  131



>gb|EAY89700.1| hypothetical protein OsI_11237 [Oryza sativa Indica Group]
Length=131

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  L++KV+ES+K AE+TCA DP  GEC AAWDEVEELSAAASHARDR+K +SDPLE YC
Sbjct  59   PPELAQKVSESIKQAEETCAGDPEGGECAAAWDEVEELSAAASHARDRKK-DSDPLEEYC  117

Query  462  KDNPETDECRTYDN  503
            KDNPETDECRTY++
Sbjct  118  KDNPETDECRTYED  131



>pdb|2LJ9|A Chain A, Partial 3d Structure Of The C-Terminal Part Of The Free 
Arabidopsis Thaliana Cp12-2 In Its Oxidized Form
Length=99

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +3

Query  270  VAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN-SDP  446
            +AA    +S+ V +S+K A++TCA DPVSGECVAAWDEVEELSAAASHARD++K++ SDP
Sbjct  21   MAAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDP  80

Query  447  LENYCKDNPETDECRTYDN  503
            LE YCKDNPET+ECRTYDN
Sbjct  81   LEEYCKDNPETNECRTYDN  99



>pdb|3QV1|G Chain G, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|H Chain H, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|I Chain I, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|I Chain I, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|J Chain J, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|K Chain K, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|L Chain L, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|M Chain M, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|N Chain N, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=82

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +3

Query  270  VAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN-SDP  446
            +AA    +S+ V +S+K A++TCA DPVSGECVAAWDEVEELSAAASHARD++K++ SDP
Sbjct  4    MAAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDP  63

Query  447  LENYCKDNPETDECRTYDN  503
            LE YCKDNPET+ECRTYDN
Sbjct  64   LEEYCKDNPETNECRTYDN  82



>ref|XP_006355835.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Solanum 
tuberosum]
Length=126

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 72/102 (71%), Gaps = 12/102 (12%)
 Frame = +3

Query  222  LNNPLWVWKRSKGFR--------PVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAW  377
            LN+P   WK+S  F         P       LS+ VAESVK AE+ CA+DPVSGEC AAW
Sbjct  29   LNSP---WKKSGQFSYGRMYVVVPRVVPDKKLSDLVAESVKEAEEACAEDPVSGECKAAW  85

Query  378  DEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            D VEE SAAASHARDR+K  SD LENYCKDNPETDECRTYDN
Sbjct  86   DVVEETSAAASHARDRKK-ESDVLENYCKDNPETDECRTYDN  126



>gb|EAY73672.1| hypothetical protein OsI_01556 [Oryza sativa Indica Group]
Length=124

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A P  +S+K++ES+  A++ CA+D  SGEC AAWDEVEELSAAASHARD+ K  SDPLE 
Sbjct  49   ATPPDISDKMSESIDKAKEACAEDTASGECAAAWDEVEELSAAASHARDKLKETSDPLEA  108

Query  456  YCKDNPETDECRTYDN  503
            YCKDNPETDECRTYDN
Sbjct  109  YCKDNPETDECRTYDN  124



>ref|NP_001042830.1| Os01g0303000 [Oryza sativa Japonica Group]
 dbj|BAB19776.1| P0035H10.18 [Oryza sativa Japonica Group]
 dbj|BAB93161.1| putative CP12 [Oryza sativa Japonica Group]
 dbj|BAF04744.1| Os01g0303000 [Oryza sativa Japonica Group]
 gb|EAZ11584.1| hypothetical protein OsJ_01448 [Oryza sativa Japonica Group]
 dbj|BAG95340.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86845.1| unnamed protein product [Oryza sativa Japonica Group]
Length=124

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A P  +S+K++ES+  A++ CA+D  SGEC AAWDEVEELSAAASHARD+ K  SDPLE 
Sbjct  49   ATPPDISDKMSESIDKAKEACAEDTASGECAAAWDEVEELSAAASHARDKLKETSDPLEA  108

Query  456  YCKDNPETDECRTYDN  503
            YCKDNPETDECRTYDN
Sbjct  109  YCKDNPETDECRTYDN  124



>ref|XP_009403696.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=129

 Score =   116 bits (290),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P ++SEKV ES+K AE+TCA+D  SGEC AAWDEVEELSAAASHARD+ K+ SDPLE YC
Sbjct  57   PPNISEKVVESIKKAEETCAEDAASGECAAAWDEVEELSAAASHARDKLKT-SDPLEEYC  115

Query  462  KDNPETDECRTYDN  503
            KDNPETDECRTY++
Sbjct  116  KDNPETDECRTYED  129



>dbj|BAK03023.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04975.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=129

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  +S+K++ES+K A++TC++D  SGEC AAWDEVEELSAAASHARD+ K +SDPLENYC
Sbjct  57   PSGISDKMSESIKEAQETCSEDAASGECAAAWDEVEELSAAASHARDKLK-DSDPLENYC  115

Query  462  KDNPETDECRTYDN  503
            K+NPETDECRTYD+
Sbjct  116  KENPETDECRTYDS  129



>ref|XP_004967659.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Setaria 
italica]
Length=125

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A P  +S++V+ES+K AEQTC  +  SGEC AAWDEVEELSAAASHARD+ K ++DPLE 
Sbjct  50   ATPPGISDQVSESIKKAEQTCEGEEGSGECAAAWDEVEELSAAASHARDKLKEDNDPLEK  109

Query  456  YCKDNPETDECRTYDN  503
            YCK+NPETDECRTYDN
Sbjct  110  YCKENPETDECRTYDN  125



>ref|XP_006644110.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Oryza 
brachyantha]
Length=124

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  +S+K++ES+  A++ CA+D  SGEC AAWDEVEELSAAASHARD+ K NSDPLE YC
Sbjct  51   PPDISDKMSESIDKAKEACAEDNASGECAAAWDEVEELSAAASHARDKLKENSDPLEKYC  110

Query  462  KDNPETDECRTYDN  503
            K+NPETDECRTYDN
Sbjct  111  KENPETDECRTYDN  124



>ref|XP_009616215.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=132

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 14/124 (11%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRSKG---------FRPVAAAPDS-LSEKVAE  311
            R+  K  +S   QA + PC LN P   WK S            + + A PD+ LS+ VA+
Sbjct  13   RIFAKTCDSSKVQALKFPC-LNKP---WKNSSSVQFGHGKLYLKTIGATPDNKLSDLVAD  68

Query  312  SVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECR  491
            SVK AE+ CA++PVSGEC AAWD VEE SAAASHARD++K +SDPLENYCKDNPETDECR
Sbjct  69   SVKEAEEACAENPVSGECAAAWDVVEEASAAASHARDKKKESSDPLENYCKDNPETDECR  128

Query  492  TYDN  503
            TYDN
Sbjct  129  TYDN  132



>ref|XP_002436694.1| hypothetical protein SORBIDRAFT_10g007180 [Sorghum bicolor]
 gb|EER88061.1| hypothetical protein SORBIDRAFT_10g007180 [Sorghum bicolor]
Length=129

 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCAD  344
            VL +   +  G+ + P  R      V  RS G     A P ++S+K++ES+K AE+TCAD
Sbjct  23   VLPRRKAAATGRVWFPVARRGGGFAV--RSTG----PATPSNISDKLSESIKEAEETCAD  76

Query  345  DPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            +  + EC AAWD VEE+SAAASHARD  K NSDPLE YCK+NPETDECR YDN
Sbjct  77   EKGTAECAAAWDNVEEISAAASHARDNLKENSDPLEKYCKENPETDECRIYDN  129



>ref|XP_010921497.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Elaeis 
guineensis]
Length=128

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  +SEKV+ES+K AE+ C DD  SGEC AAWDEVEELSAAASHARD+ K +SDPLE+YC
Sbjct  56   PPRISEKVSESIKKAEEACEDDAASGECAAAWDEVEELSAAASHARDKLK-DSDPLESYC  114

Query  462  KDNPETDECRTYDN  503
            KDNPET+ECRTY++
Sbjct  115  KDNPETEECRTYED  128



>ref|XP_010230820.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Brachypodium 
distachyon]
Length=127

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            P  +S+K++ES+K A++ C++D  SGEC AAWDEVEELSAAASHARD+ K  SDPLENYC
Sbjct  55   PPGISDKMSESIKEAQEACSEDSASGECAAAWDEVEELSAAASHARDKLK-ESDPLENYC  113

Query  462  KDNPETDECRTYDN  503
            K+NPETDECRTYD+
Sbjct  114  KENPETDECRTYDS  127



>ref|XP_009383546.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=129

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 83/121 (69%), Gaps = 12/121 (10%)
 Frame = +3

Query  168  LGKALESQNGQAFQPPC-RLNNPLW-----VWKRSKGFRPVAAAPD---SLSEKVAESVK  320
            + + L S   +  +PP  R   P W     V  R  G   VA+AP    ++SEKVAES+K
Sbjct  12   IPRVLVSTKAELPKPPLSRTRLPPWTSGHRVNSRRAGL--VASAPSMPPNISEKVAESIK  69

Query  321  NAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            NAE TCA+D  SGEC AAWDEVEELSAAASHARD+ K + DPLE++CKD+P+ +ECRTY+
Sbjct  70   NAEATCAEDAASGECAAAWDEVEELSAAASHARDKLKVD-DPLESFCKDSPDNEECRTYE  128

Query  501  N  503
            +
Sbjct  129  D  129



>ref|XP_008781107.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic [Phoenix 
dactylifera]
Length=130

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            + P  +SEKV++S+K AE+ C  + VSGEC AAWDEVEELSAAASHARD+ K +SDPLE+
Sbjct  56   STPPGISEKVSDSIKKAEEACEGNEVSGECAAAWDEVEELSAAASHARDKLK-DSDPLED  114

Query  456  YCKDNPETDECRTYDN  503
            YCKDNPET+ECRTY++
Sbjct  115  YCKDNPETEECRTYED  130



>ref|XP_009784434.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Nicotiana 
sylvestris]
 emb|CAA96569.1| CP12 [Nicotiana tabacum]
 gb|AAK49535.2| chloroplast protein 12 [Nicotiana tabacum]
Length=132

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 86/126 (68%), Gaps = 18/126 (14%)
 Frame = +3

Query  162  RVLGKALESQNGQA--FQPPCRLNNPLWVWKRSK---------GFRPVAAAPDS-LSEKV  305
            R+L K  +S   Q   FQ    LN P   WK S            + ++A PD+ LS+ V
Sbjct  13   RILSKTSDSPKVQTLKFQ---SLNKP---WKNSSLVQFGHGKLYLKAISATPDNKLSDLV  66

Query  306  AESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDE  485
            AESVK AE+ CA++PVSGEC AAWD VEE SAAASHARD++K +SDPLENYCKDNPETDE
Sbjct  67   AESVKEAEEACAENPVSGECAAAWDVVEEASAAASHARDKKKESSDPLENYCKDNPETDE  126

Query  486  CRTYDN  503
            CRTYDN
Sbjct  127  CRTYDN  132



>gb|KHN30640.1| Calvin cycle protein CP12 [Glycine soja]
Length=120

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/106 (57%), Positives = 69/106 (65%), Gaps = 11/106 (10%)
 Frame = +3

Query  186  SQNGQAFQPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGEC  365
            +Q  QA + P  L+ P+  W      RPV A P+ +SEK         + CA      EC
Sbjct  26   AQKAQAVRFPA-LSRPIQKWPGLVKTRPVRATPEKISEK---------EACAGAGGDAEC  75

Query  366  VAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             AAWDEVEELSAAASHAR++QK  SDPLENYCKDNPETDECRTYDN
Sbjct  76   AAAWDEVEELSAAASHAREKQK-QSDPLENYCKDNPETDECRTYDN  120



>gb|EMT01482.1| hypothetical protein F775_29657 [Aegilops tauschii]
Length=66

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 61/67 (91%), Gaps = 1/67 (1%)
 Frame = +3

Query  303  VAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETD  482
            +++S+K A++TC++D  SGEC AAWDEVEELSAAASHARD+ K +SDPLENYCK+NPETD
Sbjct  1    MSDSIKEAQETCSEDAASGECAAAWDEVEELSAAASHARDKLK-DSDPLENYCKENPETD  59

Query  483  ECRTYDN  503
            ECRTYD+
Sbjct  60   ECRTYDS  66



>ref|XP_008386781.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Malus 
domestica]
Length=114

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 68/96 (71%), Gaps = 10/96 (10%)
 Frame = +3

Query  165  VLGKALESQNGQAFQPPCRLNNPLW-----VWKRSKGFRPVAAAPDSLSEKVAESVKNAE  329
            VL KA E    +AF     LN P W     V +R    RPV+AAPD LSEKVAES+K+AE
Sbjct  18   VLSKATEVP--RAFH---SLNVPTWRSYSSVGRRMTMVRPVSAAPDKLSEKVAESIKSAE  72

Query  330  QTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN  437
            +TC+DDP SGECVAAWDEVEELSAA SH RD +KS+
Sbjct  73   ETCSDDPASGECVAAWDEVEELSAAVSHKRDNEKSS  108



>ref|XP_002976377.1| hypothetical protein SELMODRAFT_105078 [Selaginella moellendorffii]
 ref|XP_002987219.1| hypothetical protein SELMODRAFT_125533 [Selaginella moellendorffii]
 gb|EFJ11795.1| hypothetical protein SELMODRAFT_125533 [Selaginella moellendorffii]
 gb|EFJ22637.1| hypothetical protein SELMODRAFT_105078 [Selaginella moellendorffii]
Length=80

 Score =   100 bits (250),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            L  KV ES+K AE+ CA++P S ECV AWDEVEE+SAAASH RD+ K   DPLE +CKDN
Sbjct  11   LEGKVEESIKQAEEVCAENPASAECVVAWDEVEEVSAAASHQRDKDKGK-DPLEAFCKDN  69

Query  471  PETDECRTYDN  503
            PETDECR YDN
Sbjct  70   PETDECRVYDN  80



>ref|XP_006840455.1| hypothetical protein AMTR_s00045p00175560 [Amborella trichopoda]
 gb|ERN02130.1| hypothetical protein AMTR_s00045p00175560 [Amborella trichopoda]
Length=126

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 62/71 (87%), Gaps = 1/71 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            +SEK++ES+++A++ C+ D VSGECVAAWDEVEE+SAAAS AR ++K  SDPLE YCKDN
Sbjct  57   ISEKLSESIEHAKEVCSGDAVSGECVAAWDEVEEMSAAASDARLKEK-ESDPLETYCKDN  115

Query  471  PETDECRTYDN  503
            PET ECRTY++
Sbjct  116  PETKECRTYED  126



>ref|XP_004229393.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic [Solanum 
lycopersicum]
Length=124

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 85/117 (73%), Gaps = 8/117 (7%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRS--KGFRPVAAAPDS-LSEKVAESVKNAEQ  332
            + L K   S N + F+ PC LNNP   WK+S  K     +AAPD+ LS+ VA+SVK AE+
Sbjct  13   KFLAKNSNSPNFKPFKLPC-LNNP---WKKSSTKFGLVCSAAPDNKLSDLVADSVKGAEE  68

Query  333  TCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            TC ++P SGEC AAWD VEE SAAASHARD++K   D LENYCK+NPETDECRTYDN
Sbjct  69   TCNENPASGECAAAWDVVEEASAAASHARDKKKQ-EDVLENYCKENPETDECRTYDN  124



>gb|EMS48211.1| hypothetical protein TRIUR3_21408 [Triticum urartu]
Length=85

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 55/60 (92%), Gaps = 1/60 (2%)
 Frame = +3

Query  324  AEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            A++TC++D  SGEC AAWDEVEELSAAASHARD+ K +SDPLENYCK+NPETDECRTYD+
Sbjct  27   AQETCSEDAASGECAAAWDEVEELSAAASHARDKLK-DSDPLENYCKENPETDECRTYDS  85



>gb|ABK21319.1| unknown [Picea sitchensis]
 gb|ABK22351.1| unknown [Picea sitchensis]
 gb|ABK23864.1| unknown [Picea sitchensis]
 gb|ABK25624.1| unknown [Picea sitchensis]
 gb|ACN40458.1| unknown [Picea sitchensis]
Length=141

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 66/93 (71%), Gaps = 6/93 (6%)
 Frame = +3

Query  240  VWKRSKGFRPVAA-----APDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAA  404
            V  R  G + VA      A  ++SE V ES+K A +TCA+D  SGEC A+WDEVEELSAA
Sbjct  50   VVGRRNGIQVVAMSSPTPAKGNISEVVEESIKKAIETCAEDSTSGECAASWDEVEELSAA  109

Query  405  ASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             SH R++ K+  DPLE +CKDNPETDECRTY++
Sbjct  110  RSHMREKDKAK-DPLEEFCKDNPETDECRTYED  141



>gb|ACG43906.1| CP12-1 [Zea mays]
 gb|AFW85340.1| CP12-1 [Zea mays]
Length=140

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 66/103 (64%), Gaps = 7/103 (7%)
 Frame = +3

Query  204  FQPPCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVS-GECVAAWD  380
            F    R      V  RS G     A P  +S+KV+ES+K AE+TCADD     EC AAWD
Sbjct  42   FPAAARRGGGRLVAVRSSG----PATPPEISDKVSESIKQAEETCADDQKGDAECAAAWD  97

Query  381  EVEELSAAASHARDRQKSN--SDPLENYCKDNPETDECRTYDN  503
            EVEELSA ASHARD  K    +DPLE YCKDNP+++ECR YDN
Sbjct  98   EVEELSATASHARDSLKETNANDPLEKYCKDNPDSEECRIYDN  140



>ref|NP_001148040.1| LOC100281649 [Zea mays]
 gb|ACG29564.1| CP12-1 [Zea mays]
Length=144

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 60/79 (76%), Gaps = 3/79 (4%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVS-GECVAAWDEVEELSAAASHARDRQKSN--SDP  446
            A P  +S+KV+ES+K AE+TCADD     EC AAWDEVEELSA ASHARD  K    +DP
Sbjct  66   ATPPEISDKVSESIKQAEETCADDQKGDAECAAAWDEVEELSATASHARDSLKETNANDP  125

Query  447  LENYCKDNPETDECRTYDN  503
            LE YCKDNP+++ECR YDN
Sbjct  126  LEKYCKDNPDSEECRIYDN  144



>ref|XP_006349189.1| PREDICTED: calvin cycle protein CP12-1, chloroplastic-like [Solanum 
tuberosum]
Length=124

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 82/116 (71%), Gaps = 8/116 (7%)
 Frame = +3

Query  162  RVLGKALESQNGQAFQPPCRLNNPLWVWKRS--KGFRPVAAAPDS-LSEKVAESVKNAEQ  332
            + L K   S N + F+ PC LNNP   WK+S  K     AA PD+ LS+ VA+SVK AE+
Sbjct  13   KFLAKNSNSPNSKPFKFPC-LNNP---WKKSSTKFGLVCAATPDNKLSDLVADSVKGAEE  68

Query  333  TCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
             C ++P SGEC AAWD VEE SAAASHARD++K   D LENYCK+NPETDECRTYD
Sbjct  69   ACNENPASGECAAAWDVVEEASAAASHARDKKK-QEDVLENYCKENPETDECRTYD  123



>ref|XP_001773160.1| predicted protein [Physcomitrella patens]
 gb|EDQ62013.1| predicted protein, partial [Physcomitrella patens]
Length=68

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +3

Query  300  KVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPET  479
            ++ E++  A++TC DDP S  C  AWD VEEL+A A+H RDR K+NSDPLE YC DNPET
Sbjct  1    QIPEAIAEAQKTCEDDPTSAPCAVAWDNVEELTAEAAHQRDRNKANSDPLETYCADNPET  60

Query  480  DECRTYDN  503
            DECRTY++
Sbjct  61   DECRTYED  68



>ref|XP_009389615.1| PREDICTED: calvin cycle protein CP12-2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=194

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 69/99 (70%), Gaps = 15/99 (15%)
 Frame = +3

Query  219  RLNNPLWVWKRSKGFR--PVAAAPDS---LSEKVAESVKNAEQTCADDPVSGECVAAWDE  383
            ++  P +  +R+   R  PVA++P +   +SEKV ES+KNA++TCA+D  SGEC AAWDE
Sbjct  106  KVGGPQYNGRRASYRRLAPVASSPPTPPNISEKVVESIKNAQETCAEDAASGECAAAWDE  165

Query  384  VEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYD  500
            VEELSAAASHARDR K+          DNPETDE RTY+
Sbjct  166  VEELSAAASHARDRLKA----------DNPETDEGRTYE  194


 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 50/63 (79%), Gaps = 3/63 (5%)
 Frame = +3

Query  252  SKGFRPVAAAPDS---LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARD  422
            S GF  V + P +   +SEKVAES++NAE+TCA+D  SGEC AAWDEVEELSAAASHARD
Sbjct  44   SHGFALVTSLPSTPPNMSEKVAESIRNAEETCAEDAASGECAAAWDEVEELSAAASHARD  103

Query  423  RQK  431
            + K
Sbjct  104  KLK  106



>ref|XP_001756905.1| predicted protein [Physcomitrella patens]
 gb|EDQ78136.1| predicted protein, partial [Physcomitrella patens]
Length=70

 Score = 88.6 bits (218),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  294  SEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNP  473
            S ++  ++  A++ C +DP S  C  AWDEVEEL+A A+H RDR+K++ DPLE YC DNP
Sbjct  1    SAQIPNAIAEAQKACEEDPTSAPCAVAWDEVEELTAEAAHQRDREKTSGDPLEKYCADNP  60

Query  474  ETDECRTYDN  503
            E+DECRTY++
Sbjct  61   ESDECRTYED  70



>ref|XP_001759510.1| predicted protein [Physcomitrella patens]
 gb|EDQ75812.1| predicted protein, partial [Physcomitrella patens]
Length=67

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +3

Query  303  VAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETD  482
            +  ++  A+ TC +DP S  C  AWD VEEL+A A+H RDR+KS+ DPLE YC DNPETD
Sbjct  1    IPSAIAEAQLTCEEDPNSAPCAVAWDNVEELTAEAAHQRDREKSSGDPLEKYCADNPETD  60

Query  483  ECRTYDN  503
            ECRTY++
Sbjct  61   ECRTYED  67



>gb|ABD37967.1| CP12 [Marchantia polymorpha]
Length=130

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 59/89 (66%), Gaps = 5/89 (6%)
 Frame = +3

Query  246  KRSKGFRPVAAAP---DSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHA  416
            +R   F   A++P   D L  KVAES+K A + C  +  S ECV AWDE EELSAA  +A
Sbjct  44   RRCSTFVVRASSPNSADDLQAKVAESIKAATEVCKGNETSEECVVAWDETEELSAA--YA  101

Query  417  RDRQKSNSDPLENYCKDNPETDECRTYDN  503
              ++K+ +DPLE YC DNPETDECR Y++
Sbjct  102  DKKRKAKADPLETYCADNPETDECRVYED  130



>ref|XP_006342197.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Solanum 
tuberosum]
Length=122

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            L+E + + VK A++ C +D  S EC  AWDEVEE+S A +H R + + N DPLE YC+DN
Sbjct  52   LTEMIEKKVKEAKEVCGEDARSDECKVAWDEVEEVSQAKAHLRIKLQLNQDPLEPYCQDN  111

Query  471  PETDECRTYDN  503
            P+ DECRTYD+
Sbjct  112  PDADECRTYDH  122



>ref|XP_008237890.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Prunus 
mume]
Length=141

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A+Q C  DP++ EC  AWDEVEE+S A +  R + ++N 
Sbjct  61   FKGTQMREKQLTEMIEKKVMEAKQVCEGDPIADECKVAWDEVEEVSQAKADLRLKLETNK  120

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C+DNPETDECR Y++
Sbjct  121  DPLESFCQDNPETDECRIYED  141



>ref|XP_007209751.1| hypothetical protein PRUPE_ppa013090mg [Prunus persica]
 gb|EMJ10950.1| hypothetical protein PRUPE_ppa013090mg [Prunus persica]
Length=140

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A+Q C  DP++ EC  AWDEVEE+S A +  R + ++N 
Sbjct  60   FKGTQMREKQLTEMIEKKVMEAKQVCEGDPIADECKVAWDEVEEVSQAKADLRLKLETNK  119

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C+DNPETDECR Y++
Sbjct  120  DPLESFCQDNPETDECRIYED  140



>ref|XP_009595948.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Nicotiana 
tomentosiformis]
Length=123

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            L+E + + VK A+  C +D  S EC  AWDEVEE+S A +H R + + N DPLE++C+DN
Sbjct  53   LTEMIEKKVKEAKAVCGEDARSDECKVAWDEVEEVSQAKAHLRIKLQLNQDPLESFCQDN  112

Query  471  PETDECRTYDN  503
            PETDECR Y++
Sbjct  113  PETDECRIYED  123



>ref|XP_009765560.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Nicotiana 
sylvestris]
Length=126

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            L+E + + VK A+  C +D  S EC  AWDEVEE+S A +H R + + N DPLE++C+DN
Sbjct  56   LTEMIEKKVKEAKAVCGEDARSDECKVAWDEVEEVSQAKAHLRIKLQLNQDPLESFCQDN  115

Query  471  PETDECRTYDN  503
            PETDECR Y++
Sbjct  116  PETDECRIYED  126



>emb|CDX87586.1| BnaA07g32870D [Brassica napus]
Length=135

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 65/115 (57%), Gaps = 13/115 (11%)
 Frame = +3

Query  198  QAFQPPCRLNNPLWVWKRS--KGFRPVAAAP----------DSLSEKVAESVKNAEQTCA  341
            Q  +PP    + ++  +R   +G R V AA           + LSE + E VK A + C 
Sbjct  21   QHQRPPTVTGSDMFRVRRKEPRGLRLVVAATAKYKGTKMREEKLSEMIEEKVKEATEVCE  80

Query  342  DDPVSGECVAAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
             D  S EC  AWDEVEE+S A +  R + K  N DPLE++C++NPETDECR Y++
Sbjct  81   ADVRSEECKVAWDEVEEVSQARADLRIKLKFLNQDPLESFCQENPETDECRIYED  135



>ref|XP_009106324.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Brassica 
rapa]
Length=136

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 65/115 (57%), Gaps = 13/115 (11%)
 Frame = +3

Query  198  QAFQPPCRLNNPLWVWKRS--KGFRPVAAAP----------DSLSEKVAESVKNAEQTCA  341
            Q  +PP    + ++  +R   +G R V AA           + LSE + E VK A + C 
Sbjct  22   QHQRPPTVTGSDMFRVRRKEPRGLRLVVAATAKYKGTKMREEKLSEMIEEKVKEATEVCE  81

Query  342  DDPVSGECVAAWDEVEELSAAASHARDRQKS-NSDPLENYCKDNPETDECRTYDN  503
             D  S EC  AWDEVEE+S A +  R + K  N DPLE++C++NPETDECR Y++
Sbjct  82   ADVRSEECKVAWDEVEEVSQARADLRIKLKFLNQDPLESFCQENPETDECRIYED  136



>ref|XP_004300084.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=129

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 12/106 (11%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPVAAAP--------DSLSEKVAESVKNAEQTCAD-DPVSGEC  365
            P R+  P    +R  G R +A A           L+E + + V  A++ C + DP++ EC
Sbjct  27   PVRVAIP--AGQRKVGMRVMAVAKFKGTQMREKRLTEMIEKKVLEAKEVCGEGDPITDEC  84

Query  366  VAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
              AWDEVEE+S A +  R + K +SDPLE++C+DNPETDECR Y++
Sbjct  85   KVAWDEVEEVSQAKADLRLKLK-DSDPLESFCQDNPETDECRIYED  129



>ref|XP_002953061.1| hypothetical protein VOLCADRAFT_121134 [Volvox carteri f. nagariensis]
 gb|ABM47308.1| calvin cycle protein CP12 [Volvox carteri f. nagariensis]
 gb|EFJ45983.1| hypothetical protein VOLCADRAFT_121134 [Volvox carteri f. nagariensis]
Length=108

 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 3/73 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN--SDPLENYCK  464
            L +KV ++VK+AE+ CA    S +C  AWD VEELSAAASH +D  K++  SDPLE YC+
Sbjct  37   LGKKVEDAVKDAEEACAKG-TSQDCAVAWDTVEELSAAASHKKDAAKADALSDPLEKYCQ  95

Query  465  DNPETDECRTYDN  503
            D P+ DECR Y++
Sbjct  96   DAPDADECRVYED  108



>ref|NP_565134.1| CP12 domain-containing protein 3 [Arabidopsis thaliana]
 sp|Q9C9K2.1|CP123_ARATH RecName: Full=Calvin cycle protein CP12-3, chloroplastic; AltName: 
Full=CP12 domain-containing protein 3; AltName: Full=Chloroplast 
protein 12-3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51942.1|AC015450_3 hypothetical protein; 64587-64991 [Arabidopsis thaliana]
 gb|AAO44019.1| At1g76560 [Arabidopsis thaliana]
 dbj|BAE99820.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35859.1| CP12 domain-containing protein 3 [Arabidopsis thaliana]
Length=134

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +3

Query  234  LWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASH  413
            + V K +  +       + LSE + E VK A + C  + +S EC  AWDEVEE+S A + 
Sbjct  44   MMVTKATAKYMGTKMREEKLSEMIEEKVKEATEVCEAEEMSEECRVAWDEVEEVSQARAD  103

Query  414  ARDRQK-SNSDPLENYCKDNPETDECRTYDN  503
             R + K  N DPLE++C++NPETDECR Y++
Sbjct  104  LRIKLKLLNQDPLESFCQENPETDECRIYED  134



>gb|AAM62589.1| unknown [Arabidopsis thaliana]
Length=134

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 56/91 (62%), Gaps = 1/91 (1%)
 Frame = +3

Query  234  LWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASH  413
            + V K +  +       + LSE + E VK A + C  + +S EC  AWDEVEE+S A + 
Sbjct  44   MMVTKATAKYMGTKMREEKLSEMIEEKVKEATEVCEAEEMSEECRVAWDEVEEVSQARAD  103

Query  414  ARDRQK-SNSDPLENYCKDNPETDECRTYDN  503
             R + K  N DPLE++C++NPETDECR Y++
Sbjct  104  LRIKLKLLNQDPLESFCQENPETDECRIYED  134



>gb|ABK26381.1| unknown [Picea sitchensis]
Length=135

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  225  NNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAA  404
            N P  V +    F+        LS+ + E V  A++ C  +  S EC  AWDEVEE+S A
Sbjct  44   NCPPGVSRAVPKFKGTYVREQKLSDLIVEKVGEAQEVCQGNESSDECRVAWDEVEEVSQA  103

Query  405  ASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             +H R R + + DPLE YCK+NPETDECR Y++
Sbjct  104  KAHLRQRSQKD-DPLEAYCKENPETDECRIYED  135



>ref|XP_006302985.1| hypothetical protein CARUB_v10021134mg [Capsella rubella]
 gb|EOA35883.1| hypothetical protein CARUB_v10021134mg [Capsella rubella]
Length=133

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/74 (53%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +3

Query  285  DSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQK-SNSDPLENYC  461
            + LSE + E VK A + C  D  S EC  AWDEVEE+S A S  R + K  N DPLE++C
Sbjct  60   EKLSEMIEEKVKEATEVCETDERSEECRVAWDEVEEVSQARSDLRIKLKLLNQDPLESFC  119

Query  462  KDNPETDECRTYDN  503
            + NPETDECR Y++
Sbjct  120  QQNPETDECRLYED  133



>ref|XP_009372664.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Pyrus 
x bretschneideri]
Length=136

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A + C  DP + EC  AWDEVEE+S A +  R + + + 
Sbjct  56   FKGTQMREKQLTEMIEKKVMEAREVCEGDPKTDECKVAWDEVEEVSQAKADLRLKLEKHK  115

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C++NPETDECR Y++
Sbjct  116  DPLESFCRENPETDECRIYED  136



>ref|XP_011034773.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Populus 
euphratica]
Length=144

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + E V  A++ C  D  S EC  AWDEVEE+S A +  R R+    
Sbjct  65   FKGTQMREKQLTEMIEEKVVEAKEVCQGDETSDECKVAWDEVEEVSQAKADFR-RRLEKQ  123

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE YC+DNPETDECR Y++
Sbjct  124  DPLEYYCQDNPETDECRVYED  144



>ref|XP_010266359.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Nelumbo 
nucifera]
Length=144

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 51/81 (63%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V+ A+Q C  D  S EC  AWDEVEE+S A +  R R+    
Sbjct  65   FKGTQMREKHLTEMIEKKVQEAQQVCEGDQTSDECKVAWDEVEEVSQAKADLR-RKLEKQ  123

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C+DNPETDECR Y++
Sbjct  124  DPLESFCQDNPETDECRIYED  144



>ref|XP_008373345.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Malus 
domestica]
Length=136

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 51/81 (63%), Gaps = 0/81 (0%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A + C  DP + EC  AWDEVEE+S A +  R + + + 
Sbjct  56   FKGTQMREKQLTEMIEKKVXEATEVCEGDPKTDECKVAWDEVEEVSQAKADLRLKLEKHK  115

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C++NPETDECR Y++
Sbjct  116  DPLESFCQENPETDECRIYED  136



>gb|KIZ05217.1| Calvin cycle protein CP12 [Monoraphidium neglectum]
Length=104

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 2/64 (3%)
 Frame = +3

Query  312  SVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECR  491
            ++K AE+TC   P +GEC AAWD VEE+SAA SH +D   +NSDPLE +C DNP+ DECR
Sbjct  43   AIKEAEETCDGGP-AGECAAAWDNVEEISAAISHKKD-AAANSDPLEAFCGDNPDADECR  100

Query  492  TYDN  503
             Y++
Sbjct  101  VYED  104



>emb|CDX88298.1| BnaC06g37420D [Brassica napus]
Length=134

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 56/94 (60%), Gaps = 11/94 (12%)
 Frame = +3

Query  255  KGFRPVAAAP----------DSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAA  404
            +G R V AA           + LSE + E VK A + C  D  S EC  AWDEVEE+S A
Sbjct  41   RGSRLVVAATAKYKGTKMREEKLSEMIVEKVKEATEVCEADVRSEECKVAWDEVEEVSQA  100

Query  405  ASHARDRQK-SNSDPLENYCKDNPETDECRTYDN  503
             +  R + +  N DPLE++C++NPETDECR Y++
Sbjct  101  RADLRIKLRLLNQDPLESFCQENPETDECRIYED  134



>ref|XP_002887645.1| hypothetical protein ARALYDRAFT_895539 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63904.1| hypothetical protein ARALYDRAFT_895539 [Arabidopsis lyrata subsp. 
lyrata]
Length=135

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 1/91 (1%)
 Frame = +3

Query  234  LWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASH  413
            + V   +  ++      + LSE + E VK A + C  +  S EC  AWDEVEE+S A + 
Sbjct  45   MMVTTATAKYKGTKMREEKLSEMIEEKVKEATEVCEAEERSEECRVAWDEVEEVSQARAD  104

Query  414  ARDRQK-SNSDPLENYCKDNPETDECRTYDN  503
             R + K  N DPLE++C++NPETDECR Y++
Sbjct  105  LRVKLKLLNQDPLESFCQENPETDECRIYED  135



>ref|XP_006849927.1| hypothetical protein AMTR_s00022p00115740 [Amborella trichopoda]
 gb|ERN11508.1| hypothetical protein AMTR_s00022p00115740 [Amborella trichopoda]
Length=136

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + +  A++ C  D  S EC  AWDEVEE+S A +  R R+    
Sbjct  57   FKGTQMREQKLTEMIEKKITEAKEVCKGDLTSDECKVAWDEVEEVSQAKADLR-RKMEKE  115

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C++NPETDECR YD+
Sbjct  116  DPLESFCQENPETDECRIYDD  136



>ref|XP_010088739.1| hypothetical protein L484_016525 [Morus notabilis]
 gb|EXB36920.1| hypothetical protein L484_016525 [Morus notabilis]
Length=90

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + VK A + C  D  S EC  AWDEVEE+S A +  R + +   
Sbjct  11   FKGTQMREKQLNEMIEKKVKEATEVCGGDEKSAECKVAWDEVEEISQAKADFRLKLQ-KE  69

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE++C+++PETDECR YDN
Sbjct  70   DPLESFCQEHPETDECRLYDN  90



>ref|XP_002301892.1| CP12 domain-containing family protein [Populus trichocarpa]
 gb|EEE81165.1| CP12 domain-containing family protein [Populus trichocarpa]
Length=148

 Score = 76.6 bits (187),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A++ C  D  S EC  AWDEVEE+S A +  R R+    
Sbjct  69   FKGTQMREKQLAEMIEKKVVEAKEVCEGDETSDECKVAWDEVEEVSQAKADFR-RRLEKQ  127

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE YC+DNPETDECR Y++
Sbjct  128  DPLEYYCQDNPETDECRVYED  148



>gb|EMT03124.1| hypothetical protein F775_44037 [Aegilops tauschii]
Length=64

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +3

Query  384  VEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            VEELSAAASHARDR+K +SDPLE +C+DNPETDECRTYD+
Sbjct  25   VEELSAAASHARDRKKEHSDPLEEFCEDNPETDECRTYDS  64



>ref|XP_006390179.1| hypothetical protein EUTSA_v10019316mg [Eutrema salsugineum]
 gb|ESQ27465.1| hypothetical protein EUTSA_v10019316mg [Eutrema salsugineum]
Length=129

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +3

Query  285  DSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQK-SNSDPLENYC  461
            + LSE + + VK A + C  D  S EC  AWDEVEE+S A +  R + K  N DPLE++C
Sbjct  56   EKLSEMIEKKVKEATEVCEGDERSEECRVAWDEVEEVSQAKADLRIKLKLLNQDPLESFC  115

Query  462  KDNPETDECRTYDN  503
            ++NPETDECR Y++
Sbjct  116  QENPETDECRIYED  129



>ref|XP_001694345.1| small protein associating with GAPDH and PRK [Chlamydomonas reinhardtii]
 sp|A6Q0K5.2|CP12_CHLRE RecName: Full=Calvin cycle protein CP12, chloroplastic; AltName: 
Full=CP12 domain-containing protein; AltName: Full=Chloroplast 
protein 12; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|EDP02778.1| small protein associating with GAPDH and PRK [Chlamydomonas reinhardtii]
Length=107

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN---SDPLENYC  461
            L++KV ++VK AE  CA    S +C  AWD VEELSAA SH +D  K++   +DPLE +C
Sbjct  35   LNKKVQDAVKEAEDACAKG-TSADCAVAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFC  93

Query  462  KDNPETDECRTYDN  503
            KD P+ DECR Y++
Sbjct  94   KDAPDADECRVYED  107



>ref|XP_005644334.1| CP12-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE19790.1| CP12-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=116

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 9/110 (8%)
 Frame = +3

Query  177  ALESQNGQAFQPPCRLNNPLWVWKRSKGFRPV-AAAPDSLSEKVAESVKNAEQTCADDPV  353
            A+ SQ  QA +P         V +RS   R    AA  +LSE +  ++  A + C D+  
Sbjct  15   AVASQTTQAVRPRVLAR----VSRRSVLTRAEPTAAQKTLSE-LERAIAEARKQC-DEAT  68

Query  354  SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
            +GEC AAWD VEELSAA SH   + ++ +DPLE +C DNPE DECR Y++
Sbjct  69   AGECAAAWDTVEELSAAISH--KKAQAKADPLEEFCDDNPEADECRVYED  116



>ref|XP_002307003.2| hypothetical protein POPTR_0005s27980g [Populus trichocarpa]
 gb|EEE93999.2| hypothetical protein POPTR_0005s27980g [Populus trichocarpa]
Length=142

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + E V  A++ C  D  S EC  AWDEVEE+S A +  R R +   
Sbjct  63   FKGTLVRNQLLTEMIEEKVIEAKEACKGDATSVECKVAWDEVEEVSQAKADFRLRLEKQ-  121

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE YC+DNPETDECR Y++
Sbjct  122  DPLEYYCQDNPETDECRIYED  142



>emb|CBI40783.3| unnamed protein product [Vitis vinifera]
Length=94

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +3

Query  231  PLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAAS  410
            P+ V K    F+        L+E + + V  A+Q C  D  S EC  AWDEVEE+S A +
Sbjct  9    PMGVVK----FKGTQMREKQLTELIEKKVLEAKQVCEGDETSDECKVAWDEVEEVSQAKA  64

Query  411  HARDRQKSNSDPLENYCKDNPETDECRTYDN  503
              R R+    DPLE+YC++NPE +ECR Y++
Sbjct  65   DLR-RKMEKEDPLESYCQENPENEECRIYED  94



>emb|CAO03469.1| CP12 protein [Chlamydomonas reinhardtii]
Length=80

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 51/74 (69%), Gaps = 4/74 (5%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSN---SDPLENYC  461
            L++KV ++VK AE  CA    S +C  AWD VEELSAA SH +D  K++   +DPLE +C
Sbjct  8    LNKKVQDAVKEAEDACAK-GTSADCAVAWDTVEELSAAVSHKKDAVKADVTLTDPLEAFC  66

Query  462  KDNPETDECRTYDN  503
            KD P+ DECR Y++
Sbjct  67   KDAPDADECRVYED  80



>emb|CAA06467.1| CP12 [Chlamydomonas reinhardtii]
Length=40

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = +3

Query  348  PVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            PVSGECV AWDEVEELSAAASHARDR+K  SDPLE+YCKDN
Sbjct  1    PVSGECVRAWDEVEELSAAASHARDRKK-ESDPLEDYCKDN  40



>ref|XP_011074049.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Sesamum 
indicum]
Length=125

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR-QKSNSDPLENYCKD  467
            L+E + + V  A+Q C +D  S EC  AWDEVEE+S A +  R +      DPLE++C++
Sbjct  54   LTEMIEQKVAEAKQVCGEDETSDECKVAWDEVEEVSQAKADLRLKIHHLQQDPLEHFCQE  113

Query  468  NPETDECRTYDN  503
            NPETDECR Y++
Sbjct  114  NPETDECRIYED  125



>ref|XP_011041131.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Populus 
euphratica]
Length=142

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A++ C  D  S EC  AWDEVEE+S A +  R R +   
Sbjct  63   FKGTLVRNQLLTEMIEKKVIEAKEACKGDATSVECKVAWDEVEEVSQAKADFRLRLEKQ-  121

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE YC+DNPETDECR Y++
Sbjct  122  DPLEYYCQDNPETDECRIYED  142



>ref|XP_010474367.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Camelina 
sativa]
Length=161

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query  213  PCRLNNPLWVWKRSKGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            P RL   +     +K ++      + LSE + E VK A + C  D  S EC  AWDEVEE
Sbjct  38   PRRLKLTIATTATAK-YKGTKMREEKLSEMIEEKVKEATEVCQTDEGSEECRVAWDEVEE  96

Query  393  LSAAASHARDRQK-SNSDPLENYCKDNPETDECRTY  497
            +S A S  R + K  N DPLE++C++NPETDEC  Y
Sbjct  97   VSQARSDLRIKLKLLNQDPLESFCQENPETDECSGY  132



>emb|CDP07245.1| unnamed protein product [Coffea canephora]
Length=193

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR-QKSNSDPLENYCKD  467
            L+E + + V+ A++ C +D  S EC  AWDEVEE+S A +  R + +  + DPLE++C+D
Sbjct  122  LTEMIEKKVREAKEVCGEDGKSDECKVAWDEVEEVSQAKADLRLKLEIMHQDPLESFCQD  181

Query  468  NPETDECRTYDN  503
            NPETDECR Y++
Sbjct  182  NPETDECRIYED  193



>ref|XP_010479593.1| PREDICTED: LOW QUALITY PROTEIN: calvin cycle protein CP12-3, 
chloroplastic-like [Camelina sativa]
Length=134

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQK-SN  437
            ++      + LSE + E VK A + C  D  S EC  AWDEVEE+S A S  R + K  N
Sbjct  53   YKGTKMREEKLSEMIEEKVKEATEVCDADERSEECRVAWDEVEEVSQARSDLRIKLKLLN  112

Query  438  SDPLENYCKDNPETDECRTYDN  503
             DPLE+  +DNPETDECR Y++
Sbjct  113  QDPLESVYQDNPETDECRVYED  134



>gb|EYU36605.1| hypothetical protein MIMGU_mgv1a014758mg [Erythranthe guttata]
Length=179

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR-QKSNSDPLENYCKD  467
            L+E + + V  A+Q C +D  S EC  AWDEVEE+S A +  R +      DPLE++C++
Sbjct  108  LTEMIEKKVMEAKQVCGEDETSDECKVAWDEVEEVSQAKADLRLKLHHLQQDPLEHFCQE  167

Query  468  NPETDECRTYDN  503
            NPETDECR Y++
Sbjct  168  NPETDECRIYED  179



>ref|XP_010416576.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Camelina 
sativa]
Length=134

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 1/82 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQK-SN  437
            ++      + LSE + E VK A + C  D  S EC  AWDEVEE+S A S  R + K  N
Sbjct  53   YKGTKMREEKLSEMIEEKVKEATEVCDTDERSEECRVAWDEVEEVSQARSDLRIKLKLLN  112

Query  438  SDPLENYCKDNPETDECRTYDN  503
             DPLE++ ++NPETDECR Y +
Sbjct  113  QDPLESFWQENPETDECRVYQD  134



>ref|XP_010539757.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Tarenaya 
hassleriana]
Length=139

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            ++      + L+E +   VK A + CA D  S EC  AWDEVEE+S A +  R + +   
Sbjct  60   YKGTKMREEKLTEMIERKVKEATEVCAADEGSEECRVAWDEVEEVSQAKADLRLKLQKQ-  118

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE +C++NP+TDECR YD+
Sbjct  119  DPLEGFCQENPDTDECRIYDD  139



>gb|KJB73143.1| hypothetical protein B456_011G217400 [Gossypium raimondii]
Length=135

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR-QKSNSDPLENYCKD  467
            LSE + + V  A+Q C  D  S EC  AWDEVEE+S A ++ R R +    DPLE++C +
Sbjct  64   LSEMIEKKVTEAKQVCEGDETSDECRVAWDEVEEVSQAKANLRLRLEVEKKDPLESFCLE  123

Query  468  NPETDECRTYDN  503
            NPET+EC+ YD+
Sbjct  124  NPETEECKVYDD  135



>gb|KDP36727.1| hypothetical protein JCGZ_08018 [Jatropha curcas]
Length=142

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A++ C  D  S EC  AWDEVEE+S A ++ R + +   
Sbjct  63   FKGTQMREKQLTEMIEQKVIEAKEVCEGDRTSDECKVAWDEVEEVSEAKANFRLKLEKR-  121

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE +C+DNPETDECR Y++
Sbjct  122  DPLEYFCQDNPETDECRIYED  142



>ref|XP_002276622.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Vitis 
vinifera]
Length=134

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A+Q C  D  S EC  AWDEVEE+S A +  R R+    
Sbjct  55   FKGTQMREKQLTELIEKKVLEAKQVCEGDETSDECKVAWDEVEEVSQAKADLR-RKMEKE  113

Query  441  DPLENYCKDNPETDECRTYDN  503
            DPLE+YC++NPE +ECR Y++
Sbjct  114  DPLESYCQENPENEECRIYED  134



>gb|ABD37968.1| CP12 [Mesostigma viride]
Length=131

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 68/101 (67%), Gaps = 13/101 (13%)
 Frame = +3

Query  222  LNNPLWVWK----RSKGFRPVAAA-PDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEV  386
            +  PL + K    + +  R +AAA PD     VA+S+K+AE+TCA    +GEC AAWDEV
Sbjct  37   VGRPLCLRKSHAVQKRAVRAMAAADPD-----VAKSIKDAEETCASG-TTGECAAAWDEV  90

Query  387  EELSAAASHARDRQKSNSD--PLENYCKDNPETDECRTYDN  503
            EELSAAAS  + ++K  +   PLE +C+DNPETDECR Y++
Sbjct  91   EELSAAASDKKKKEKEIAKKDPLEKFCEDNPETDECRVYED  131



>ref|XP_011400908.1| Calvin cycle protein CP12, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM27918.1| Calvin cycle protein CP12, chloroplastic [Auxenochlorella protothecoides]
Length=117

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = +3

Query  228  NPLWVWKRSKGFRPVA-----AAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEE  392
            +PL + +     RP+      A PD+    +  ++  A+  CA    + EC AAWD VEE
Sbjct  20   SPLGLSRACARPRPMQRMVPRATPDTQKGPIEGAITEAQDACATG-STDECAAAWDTVEE  78

Query  393  LSAAASHARDRQKS--NSDPLENYCKDNPETDECRTYDN  503
            LSAAA+H RD  K+   SDPLE YC+  P+ DECR Y++
Sbjct  79   LSAAAAHKRDNAKTAQQSDPLEQYCEGAPDADECRVYED  117



>ref|XP_002510743.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52930.1| conserved hypothetical protein [Ricinus communis]
Length=142

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS  440
            F+        L+E + + V  A++ C  D  S EC  AWDEVEE+S A +  R + +   
Sbjct  63   FKGTQMREKHLTEMIEKKVMEAKEVCEGDQTSDECKVAWDEVEEVSQAKADFRLKLEKR-  121

Query  441  DPLENYCKDNPETDECRTYD  500
            DPLE +C+DNPETDECR Y+
Sbjct  122  DPLEYFCQDNPETDECRVYE  141



>gb|KJB60285.1| hypothetical protein B456_009G298200 [Gossypium raimondii]
Length=136

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR-QKSNSDPLENYCKD  467
            L+E + + V  A+Q C  D  S EC  AWDEVEE+S A +  R R +    DPLE++C++
Sbjct  65   LTEMIEKKVTEAKQVCEGDETSDECKVAWDEVEEVSQAKADLRLRLEIEKKDPLESFCQE  124

Query  468  NPETDECRTYDN  503
            NPET+EC+ Y++
Sbjct  125  NPETEECKIYED  136



>ref|WP_010475694.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=75

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ + ++ A +TC      SGEC AAWD VEEL A ASH R     + + LE YC D
Sbjct  4    IQEKIEKELEQARETCDTSGATSGECAAAWDAVEELQAEASHQRKSNNEDKNSLEQYCDD  63

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  64   NPDAAECRIYDD  75



>ref|WP_012162957.1| hypothetical protein [Acaryochloris marina]
 gb|ABW27497.1| CP12 domain protein [Acaryochloris marina MBIC11017]
Length=75

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ + ++ A +TC      SGEC AAWD VEEL A ASH R     + + LE YC D
Sbjct  4    IQEKIEKELEQARETCDTSGATSGECAAAWDAVEELQAEASHQRKGNNEDKNSLEQYCDD  63

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  64   NPDAAECRIYDD  75



>ref|WP_012306885.1| MULTISPECIES: hypothetical protein [Synechococcus]
 gb|ACA99262.1| CP12 domain protein [Synechococcus sp. PCC 7002]
Length=73

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            + +K+ +    A + C+ D  S EC AAWD VEEL A A+H R+++   S PLE +C DN
Sbjct  4    IHQKIEQERDAAREACSTDSTSAECAAAWDAVEELQAEAAHQREKEPEKS-PLEKFCDDN  62

Query  471  PETDECRTYDN  503
            P+ DECR Y++
Sbjct  63   PDADECRLYED  73



>ref|WP_017749890.1| hypothetical protein [Scytonema hofmanni]
Length=73

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 45/72 (63%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ + V+ A  TC      SGEC AAWD VEEL A ASH R  ++ NS  LE YC  
Sbjct  4    IQDKIDQEVEQARATCDVTGSTSGECAAAWDAVEELQAEASHQRQAKRKNS--LEQYCDA  61

Query  468  NPETDECRTYDN  503
            NPE DECR Y++
Sbjct  62   NPEADECRVYED  73



>ref|XP_008799141.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Phoenix 
dactylifera]
Length=143

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +3

Query  255  KGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGE--CVAAWDEVEELSAAASHARDR-  425
            K ++      + L+  +   V+ A+  C  +   G   C  AWDEVEE+S A +H R R 
Sbjct  58   KKYKGTVMREEKLAGMIERKVEEAKAACEGEEGKGSDGCKVAWDEVEEVSQAMAHLRRRL  117

Query  426  QKSNSDPLENYCKDNPETDECRTYDN  503
             +S+ DPLE++C+DNPETDECR Y++
Sbjct  118  AESDRDPLESFCQDNPETDECRVYED  143



>ref|XP_010061244.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic-like [Eucalyptus 
grandis]
Length=148

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            L+E + E V+ A + C  D  S  C  AWDEVEE+S A +  R R +   DPLE++C+ N
Sbjct  78   LAEMIEEKVREAREVCEGDARSDGCKVAWDEVEEVSQAKADLRLRLEKQQDPLESFCEQN  137

Query  471  PETDECRTY  497
            P+TDECR +
Sbjct  138  PDTDECRVH  146



>ref|XP_007010913.1| CP12 domain-containing protein 3 [Theobroma cacao]
 gb|EOY19723.1| CP12 domain-containing protein 3 [Theobroma cacao]
Length=135

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR-QKSNSDPLENYCKD  467
            L+E + + V  A++ C  D  S EC  AWDEVEE+S A +  R R +    DPLE +C++
Sbjct  64   LAEMIEKKVTEAKEVCEGDETSDECKVAWDEVEEVSQAKADLRLRLEIEKKDPLEFFCQE  123

Query  468  NPETDECRTYDN  503
            NPET+ECR Y++
Sbjct  124  NPETEECRVYED  135



>ref|WP_017651373.1| hypothetical protein [Microchaete sp. PCC 7126]
Length=73

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ + V+ A   C      S EC AAWD VEEL A ASH R  ++ NS  LE YC D
Sbjct  4    IQEKIQDEVEQARTVCDTSGSSSAECAAAWDAVEELQAEASHQRQSKQKNS--LEKYCDD  61

Query  468  NPETDECRTYDN  503
            NPE DECR Y++
Sbjct  62   NPEADECRLYED  73



>ref|WP_006453737.1| hypothetical protein [Synechococcus sp. PCC 7335]
 gb|EDX83993.1| hypothetical protein S7335_1690 [Synechococcus sp. PCC 7335]
Length=74

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGE-CVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+   ++ A + C+ D    E C AAWD VEEL A ASH R ++   S P + YC D
Sbjct  4    IQEKIKTEIEAAREACSADNNDAEGCAAAWDAVEELQAEASHQRTKKPEKS-PFDQYCDD  62

Query  468  NPETDECRTYDN  503
            NPE DECR YDN
Sbjct  63   NPEADECRVYDN  74



>ref|XP_005706707.1| small chloroplast protein [Galdieria sulphuraria]
 emb|CAI34857.1| small chloroplast protein [Galdieria sulphuraria]
 emb|CAI34858.1| small chloroplast protein [Galdieria sulphuraria]
 gb|EME30187.1| small chloroplast protein [Galdieria sulphuraria]
Length=129

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  APDSLSEKVAESVKNAEQ-TCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            + D   +++ ES+K AE+ T      S E  AAWD VEEL A ASH R RQK+  DPLE 
Sbjct  56   SSDGWKQQIQESIKKAEEATKKFGRDSKEAAAAWDAVEELDAEASHQRVRQKT--DPLET  113

Query  456  YCKDNPETDECRTYDN  503
            +C ++PE +ECR YDN
Sbjct  114  FCDESPEAEECRVYDN  129



>ref|WP_024544448.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=73

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            + +K+ +  + A + C  +  S EC AAWD VEEL A ASH R+++   S PLE +C DN
Sbjct  4    IHQKIEQEREAAREACNTNATSAECAAAWDAVEELQAEASHQREQEPEKS-PLEKFCDDN  62

Query  471  PETDECRTYDN  503
            P+ DECR Y++
Sbjct  63   PDADECRLYED  73



>ref|WP_035156951.1| hypothetical protein [Calothrix sp. 336/3]
 gb|KFB85537.1| hypothetical protein IJ00_23715 [Calothrix sp. 336/3]
Length=73

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 44/74 (59%), Gaps = 7/74 (9%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG---ECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            + EK+ E V+ A   C  D   G   EC AAWD VEEL A ASH R  ++ NS  LE YC
Sbjct  4    IQEKIQEEVEQARAVC--DVTGGNSPECAAAWDAVEELQAEASHQRQTKQKNS--LEQYC  59

Query  462  KDNPETDECRTYDN  503
             DNPE  ECR YD+
Sbjct  60   DDNPEAAECRVYDD  73



>ref|WP_019501875.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=74

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ E ++ A + C A+ P S EC AAWD VEEL A ASH +  +  NS  L+ YC D
Sbjct  5    IQEKIQEELQGAREACEANGPGSKECAAAWDAVEELQAEASHQKQEKGKNS--LQQYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR Y++
Sbjct  63   NPDAAECRIYED  74



>ref|WP_035991854.1| hypothetical protein [Leptolyngbya sp. KIOST-1]
Length=75

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +3

Query  285  DSLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            +++ E++ + ++ A   C A    S EC AAWD VEEL A ASH RD+  ++   LE YC
Sbjct  3    ENIKERIEKEIEGARAACDASGSGSQECAAAWDAVEELQAEASHQRDK-GTDRTSLEAYC  61

Query  462  KDNPETDECRTYDN  503
              NPE DECR YDN
Sbjct  62   DSNPEADECRVYDN  75



>ref|WP_006635891.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK83626.1| protein of unknown function CP12 [Microcoleus vaginatus FGP-2]
Length=78

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENY  458
            P ++ EK+ E +++A   C      SGEC AAWD VEEL A ASH +  +  NS   E Y
Sbjct  6    PSNIQEKIEEELESARTVCDVKGATSGECAAAWDAVEELQAEASHQKQVKPKNS--FEKY  63

Query  459  CKDNPETDECRTYD  500
            C DNP+  ECR YD
Sbjct  64   CDDNPDAAECRIYD  77



>ref|WP_015218820.1| hypothetical protein [Cyanobacterium aponinum]
 gb|AFZ53089.1| protein of unknown function CP12 [Cyanobacterium aponinum PCC 
10605]
Length=74

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQ-KSNSDPLENYCK  464
            + +++ E +K+A + C + D  SGEC AAWD VEEL A ASH + ++ K NS  LE YC 
Sbjct  4    IQDQIQEELKHAREVCDSPDSNSGECAAAWDAVEELQAEASHQKTKEPKKNS--LEQYCS  61

Query  465  DNPETDECRTYDN  503
            +NPE  ECR YD+
Sbjct  62   ENPEAAECRLYDD  74



>ref|WP_027842240.1| hypothetical protein [Mastigocoleus testarum]
Length=73

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            +  K++E VK A + C      S EC AAWD VEEL A ASH R  ++  S   E YC D
Sbjct  4    IQNKISEEVKQAREVCDTSGDSSAECAAAWDAVEELQAEASHQRQEKQKTS--FEKYCDD  61

Query  468  NPETDECRTYDN  503
            NPE  ECR YD+
Sbjct  62   NPEAAECRVYDD  73



>ref|WP_015223198.1| hypothetical protein [Cyanobacterium stanieri]
 gb|AFZ47882.1| protein of unknown function CP12 [Cyanobacterium stanieri PCC 
7202]
Length=74

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCA-DDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +++ E +K A + C+ +   SG+C AAWD VEEL A ASH +  +K  +  LE YC D
Sbjct  4    IQDQIQEELKQAREVCSTEGATSGDCAAAWDAVEELQAEASHQQQGEKKKT-SLEQYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  63   NPDAAECRVYDD  74



>ref|WP_006516336.1| CP12 domai nprotein [Leptolyngbya sp. PCC 7375]
 gb|EKV01948.1| CP12 domai nprotein [Leptolyngbya sp. PCC 7375]
Length=74

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPV-SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK++E +K A   C  D   S  C AAWD VEEL A ASH R+ +K  ++  E YC +
Sbjct  4    IQEKISEEIKAARDVCTTDGSGSDACAAAWDAVEELQAEASHQRESEKPKTN-FETYCDE  62

Query  468  NPETDECRTYDN  503
            NPE DECR Y++
Sbjct  63   NPEADECRIYED  74



>ref|WP_010997001.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB74549.1| asl2850 [Nostoc sp. PCC 7120]
Length=78

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 9/74 (12%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLENY  458
            + +++ E V+ A   C    +SG    EC AAWD VEEL A ASH R  +K NS  LE Y
Sbjct  9    IQDQIQEEVEQARAVC---DISGSNSAECAAAWDAVEELQAEASHQRQDKKKNS--LEQY  63

Query  459  CKDNPETDECRTYD  500
            C DNPE  ECR YD
Sbjct  64   CDDNPEAAECRVYD  77



>ref|WP_017714302.1| hypothetical protein [Prochlorothrix hollandica]
Length=74

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 9/77 (12%)
 Frame = +3

Query  285  DSLSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLE  452
            D+L E++ + ++ A  TC    VSG    EC AAWD VEEL A ASH R+  K +S   E
Sbjct  3    DNLKEQITKELEQARATC---DVSGSNSPECAAAWDAVEELQAEASHQREEPKKSS--FE  57

Query  453  NYCKDNPETDECRTYDN  503
             YC DNP+ DECR Y++
Sbjct  58   QYCADNPDADECRLYED  74



>ref|WP_015207783.1| CP12 domain protein [Cylindrospermum stagnale]
 gb|AFZ24529.1| CP12 domain protein [Cylindrospermum stagnale PCC 7417]
Length=81

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 45/75 (60%), Gaps = 9/75 (12%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLENY  458
            + EK+ + V+ A   C    +SG    EC AAWD VEEL A ASH R  ++ NS  LE Y
Sbjct  12   IQEKIQDEVEQARTVC---DISGSNSAECAAAWDAVEELQAEASHQRQSKQKNS--LEQY  66

Query  459  CKDNPETDECRTYDN  503
            C DNP+  ECR YD+
Sbjct  67   CDDNPDAIECRVYDD  81



>ref|WP_015200789.1| hypothetical protein [Calothrix parietina]
 gb|AFZ04179.1| protein of unknown function CP12 [Calothrix sp. PCC 6303]
Length=74

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 9/78 (12%)
 Frame = +3

Query  282  PDSLSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPL  449
             +++ +++ E V+ A   C    VSG    EC AAWD VEEL A ASH R  ++ NS  L
Sbjct  2    TNNIQDQIQEEVQQARTVC---DVSGTNSAECAAAWDAVEELQAEASHQRQAKQKNS--L  56

Query  450  ENYCKDNPETDECRTYDN  503
            E YC DNPE DEC+ Y++
Sbjct  57   ERYCDDNPEADECKIYED  74



>ref|WP_016953179.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=81

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 48/78 (62%), Gaps = 6/78 (8%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPVSG--ECVAAWDEVEELSAAASHARDRQKSNSDPL  449
            A PD + EK+ E V+ A   C D   SG  EC AAWD VEEL A ASH R ++  NS  L
Sbjct  8    ANPD-IQEKIQEEVEQARVVC-DITGSGSPECAAAWDAVEELQAEASHQRQQKPKNS--L  63

Query  450  ENYCKDNPETDECRTYDN  503
            E YC  NPE DECR Y++
Sbjct  64   EKYCDANPEADECRLYED  81



>ref|XP_010932153.1| PREDICTED: calvin cycle protein CP12-3, chloroplastic [Elaeis 
guineensis]
Length=142

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +3

Query  255  KGFRPVAAAPDSLSEKVAESVKNAEQTCADDPVSGE--CVAAWDEVEELSAAASHARDR-  425
            K ++  A     L+E + + V+ A+  C  +   G   C  AWDEVEE+S A +  R R 
Sbjct  57   KRYKGTAMREKQLAEMIEKKVEEAKAACEGEERRGSDGCKVAWDEVEEVSQAMARLRRRL  116

Query  426  QKSNSDPLENYCKDNPETDECRTYD  500
             +S+ DPL+ +C++NPETDECR YD
Sbjct  117  AESDRDPLDAFCQENPETDECRVYD  141



>ref|WP_015120210.1| CP12 domain-containing protein [Rivularia sp. PCC 7116]
 gb|AFY56648.1| CP12 domain protein [Rivularia sp. PCC 7116]
Length=73

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E ++ A   C      S EC AAWD VEEL A ASH R  +  NS  LE YC +
Sbjct  4    IKDKIQEELQEARTVCDTSGSNSAECAAAWDAVEELQAEASHQRQSKPKNS--LEKYCDE  61

Query  468  NPETDECRTYDN  503
            NPE DECR YD+
Sbjct  62   NPEADECRVYDD  73



>ref|WP_012407493.1| hypothetical protein [Nostoc punctiforme]
 gb|ACC79468.1| protein of unknown function CP12 [Nostoc punctiforme PCC 73102]
Length=81

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  APDSLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A   + EK+ E V+ A   C  +   S EC AAWD VEEL A ASH R  +  NS  LE 
Sbjct  8    ATSDIQEKIQEEVEQARTVCDINGSGSPECAAAWDAVEELQAEASHKRQSKPKNS--LEQ  65

Query  456  YCKDNPETDECRTYDN  503
            YC DNP+  ECR YD+
Sbjct  66   YCDDNPDAIECRVYDD  81



>ref|WP_017297697.1| hypothetical protein [Nodosilinea nodulosa]
Length=75

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 8/77 (10%)
 Frame = +3

Query  285  DSLSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLE  452
            D++ E++ + ++ A   C    VSG    EC AAWD VEEL A ASH R +    +  LE
Sbjct  3    DNIKERIEKEIEGARAAC---DVSGGSSQECAAAWDAVEELQAEASHQRVKGTGKT-SLE  58

Query  453  NYCKDNPETDECRTYDN  503
             YC  NPE DECR YDN
Sbjct  59   AYCDSNPEADECRVYDN  75



>ref|WP_023072932.1| protein regulation of calvin cycle via association dissociation 
of prk cp12 gapdh complex [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36245.1| protein regulation of calvin cycle via association dissociation 
of prk cp12 gapdh complex [Leptolyngbya sp. Heron Island 
J]
Length=74

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGE-CVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK++E +K A   C+ D  + E C AAWD VEEL A ASH R+  K  ++  E YC +
Sbjct  4    IQEKISEEIKAARDVCSTDGGNSETCAAAWDAVEELQAEASHQREASKPKTN-FETYCDE  62

Query  468  NPETDECRTYDN  503
            NP+ DECR Y++
Sbjct  63   NPDADECRIYED  74



>ref|WP_017313122.1| MULTISPECIES: hypothetical protein [Stigonematales]
 gb|KIY13874.1| hypothetical protein SP67_08465 [Mastigocladus laminosus UU774]
Length=73

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 42/75 (56%), Gaps = 9/75 (12%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLENY  458
            +  ++ E VK A   C    VSG    EC AAWD VEEL A ASH   +Q     P E Y
Sbjct  4    IHNRIEEEVKEARAVC---DVSGSNSAECAAAWDAVEELQAEASH--QKQSKQKTPFEKY  58

Query  459  CKDNPETDECRTYDN  503
            C DNPE DECR Y++
Sbjct  59   CDDNPEADECRIYED  73



>ref|WP_011317898.1| hypothetical protein [Anabaena variabilis]
 gb|ABA20674.1| Protein of unknown function CP12 [Anabaena variabilis ATCC 29413]
Length=78

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 9/74 (12%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLENY  458
            + +++ E V+ A   C    +SG    EC AAWD VEEL A ASH R  +K NS  LE Y
Sbjct  9    IQDQIQEEVEQARAVC---DISGSNSAECAAAWDAVEELQAEASHQRQDKKKNS--LEQY  63

Query  459  CKDNPETDECRTYD  500
            C DNP+  ECR YD
Sbjct  64   CDDNPDAAECRVYD  77



>ref|WP_008309502.1| CP12 domain protein [Leptolyngbya sp. PCC 6406]
Length=74

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 47/75 (63%), Gaps = 8/75 (11%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDPLENY  458
            + EK+ + +K+A   C    VSG    EC AAWD VEEL A A+H R++QK  +  LE +
Sbjct  4    IQEKIQQELKSARDAC---DVSGSNSQECAAAWDAVEELQAEAAHQRNQQKPQT-SLEKF  59

Query  459  CKDNPETDECRTYDN  503
            C DNPE  ECR Y++
Sbjct  60   CDDNPEAAECRIYED  74



>ref|WP_015175385.1| protein of unknown function CP12 [Oscillatoria nigro-viridis]
 gb|AFZ06067.1| protein of unknown function CP12 [Oscillatoria nigro-viridis 
PCC 7112]
Length=78

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 3/71 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ E +++A   C      SGEC AAWD VEEL A ASH +  +  NS   E YC D
Sbjct  9    IQEKIEEELESARTVCDLKGATSGECAAAWDAVEELQAEASHQKQVKPKNS--FEKYCDD  66

Query  468  NPETDECRTYD  500
            NP+  ECR YD
Sbjct  67   NPDAAECRIYD  77



>emb|CAB56831.1| hypothetical protein [Cyanophora paradoxa]
Length=85

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = +3

Query  261  FRPVAAAPDSLSEKVAESVKNAEQTCADD-PVSGECVAAWDEVEELSAAASHARDRQKSN  437
            F   A+A  S+ E++ +++  A     +    S E   AWDEVEEL A  SH + + K+ 
Sbjct  6    FGVFASADLSIQERIQKAISQARAVAEEKGATSKEARVAWDEVEELEAELSHQKAQPKA-  64

Query  438  SDPLENYCKDNPETDECRTYDN  503
             DPL+ +CK+NPETDECR Y++
Sbjct  65   -DPLQEFCKENPETDECRLYED  85



>ref|XP_001774010.1| predicted protein [Physcomitrella patens]
 gb|EDQ61200.1| predicted protein [Physcomitrella patens]
Length=126

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 41/69 (59%), Gaps = 7/69 (10%)
 Frame = +3

Query  297  EKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPE  476
            +KVA  +++A++ CA D  S EC AAWDEVE        A   Q    DP++ YC DNPE
Sbjct  65   DKVATKIEDAQEVCAGDNQSEECAAAWDEVE-------AAAKEQAKTEDPIDKYCNDNPE  117

Query  477  TDECRTYDN  503
             DECR Y+ 
Sbjct  118  ADECRVYNT  126



>ref|WP_027404703.1| hypothetical protein [Aphanizomenon flos-aquae]
 gb|KHG39183.1| hypothetical protein OA07_25215 [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=81

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ E V+ A   C      S EC AAWD VEEL A ASH R  +  NS  LE YC  
Sbjct  12   IQEKIQEEVEQARTVCDISGSNSAECAAAWDAVEELQAEASHKRQIKPKNS--LEKYCDA  69

Query  468  NPETDECRTYDN  503
            NPE DECR Y++
Sbjct  70   NPEADECRLYED  81



>ref|WP_022604974.1| CP12 domain protein [Rubidibacter lacunae]
 gb|ERN42522.1| CP12 domain protein [Rubidibacter lacunae KORDI 51-2]
Length=73

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPV-SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + E++ E +K A   C  D   S  C  AWD VEEL A ASH R+  K NS  LE YC D
Sbjct  4    IRERIEEELKTARAVCESDGADSQNCAVAWDNVEELQAEASHQREEPKKNS--LEAYCDD  61

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  62   NPDAAECRVYDD  73



>ref|WP_009629451.1| protein of unknown function CP12 [Pseudanabaena biceps]
 gb|ELS30493.1| protein of unknown function CP12 [Pseudanabaena biceps PCC 7429]
Length=73

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPV-SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + EK+ E V+ A Q C      S EC  AWD VEEL A ASH +  +  NS  LE YC D
Sbjct  4    IKEKILEEVQIARQICETSGTDSKECAVAWDGVEELQAEASHQKQEKSKNS--LEVYCDD  61

Query  468  NPETDECRTYDN  503
            NPE  ECR Y++
Sbjct  62   NPEAAECRLYED  73



>ref|WP_008274506.1| hypothetical protein [Cyanothece sp. CCY0110]
 gb|EAZ92293.1| CP12 polypeptide [Cyanothece sp. CCY0110]
Length=74

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +3

Query  288  SLSEKVAESVKNAEQTCADDPV-SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCK  464
            ++ +++ +  +NA+  C+ D   SG C AAWD VEEL A ASH R +Q   S+  E YC 
Sbjct  3    NIDDQIQQERENAKNVCSTDGSDSGNCAAAWDAVEELQAEASHQRQKQTPKSN-FEQYCD  61

Query  465  DNPETDECRTYDN  503
            DNP+  ECR YD+
Sbjct  62   DNPDAVECRVYDD  74



>ref|WP_007356495.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN57293.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=73

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = +3

Query  285  DSLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            +++ EK+ E + NA   C      SGEC AAWD VEEL A ASH +  +  NS   E YC
Sbjct  2    NNIQEKIDEELANARAVCDIKGGASGECAAAWDAVEELQAEASHQKQNKPKNS--FEKYC  59

Query  462  KDNPETDECRTYDN  503
             DNP+  ECR Y++
Sbjct  60   DDNPDAAECRLYED  73



>ref|WP_008197591.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI30892.1| Calvin cycle protein CP12 [Microcystis sp. T1-4]
Length=74

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCA-DDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E  KNA   C+ +   SGEC AAWD VEEL A A+H R      +   E YC D
Sbjct  4    IQDKIQEERKNARAVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKT-YFEQYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  63   NPDAAECRVYDD  74



>ref|WP_002792997.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI23400.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9808]
 emb|CCI35153.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9701]
 gb|EPF19562.1| CP12 domain protein [Microcystis aeruginosa SPC777]
 gb|EPF21098.1| CP12 domain protein [Microcystis aeruginosa SPC777]
Length=74

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADD-PVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E ++NA   C+ +   SGEC AAWD VEEL A A+H R      +   E YC D
Sbjct  4    IQDKIQEELENARTVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKT-YFEKYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  63   NPDAAECRVYDD  74



>gb|EPS73074.1| hypothetical protein M569_01682 [Genlisea aurea]
Length=84

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNS-DPLENYCKD  467
            L+E +   V+ A + C +D  S EC  AWDEVEE+S A +  R + +  S DPL +YC  
Sbjct  13   LTEMIEAKVEEARRVCGEDERSDECKVAWDEVEEVSQAKADLRLKIRYLSNDPLHHYCVQ  72

Query  468  NPETDECRTYDN  503
            NPE+DEC+ +++
Sbjct  73   NPESDECQIHED  84



>ref|WP_012594266.1| MULTISPECIES: hypothetical protein [Cyanothece]
 gb|ACK64991.1| protein of unknown function CP12 [Cyanothece sp. PCC 8801]
 gb|ACU99874.1| protein of unknown function CP12 [Cyanothece sp. PCC 8802]
Length=74

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +3

Query  288  SLSEKVAESVKNAEQTCADDPV-SGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCK  464
            ++ E + + ++NA + C+ +   SG+C AAWD VEEL A ASH R  Q + +D  + YC 
Sbjct  3    NIEETIEKELQNAREVCSTEGANSGDCAAAWDAVEELQAEASHQRQNQPAKTD-FQKYCD  61

Query  465  DNPETDECRTYDN  503
            DNP+  ECR Y++
Sbjct  62   DNPDAVECRMYED  74



>ref|WP_002739926.1| calvin cycle protein CP12 [Microcystis aeruginosa]
 gb|ELP52274.1| calvin cycle protein CP12 [Microcystis aeruginosa TAIHU98]
Length=74

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADD-PVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E ++NA   C+ +   SGEC AAWD VEEL A A+H R      +   E YC D
Sbjct  4    IQDKIQEELENARAVCSTEGATSGECAAAWDAVEELQAEAAHQRQDHPQKT-YFEKYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  63   NPDAAECRVYDD  74



>ref|WP_002751352.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH95173.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9432]
Length=74

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCA-DDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E ++NA   C+ +   SGEC AAWD VEEL A A+H R      +   E YC D
Sbjct  4    IQDKIQEELENARAVCSTEGAASGECAAAWDAVEELQAEAAHQRQDHPQKT-YFEQYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  63   NPDAAECRVYDD  74



>ref|WP_018396801.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=74

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCA-DDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + E++ +  KNA   C+ +   SG+C AAWD VEEL A ASH R + K     LE YC D
Sbjct  4    IDEQIEQERKNARTVCSTEGGESGDCAAAWDAVEELQAEASHQR-QTKPKKTSLEQYCDD  62

Query  468  NPETDECRTYD  500
            NP+  ECR YD
Sbjct  63   NPDAVECRVYD  73



>ref|WP_002743917.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO87254.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCI07063.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 7941]
 gb|ELS47967.1| CP12 domain protein [Microcystis aeruginosa DIANCHI905]
Length=74

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCA-DDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E ++NA   C+ +   SGEC AAWD VEEL A A+H R      +   E YC D
Sbjct  4    IQDKIQEELENARAVCSTEGAASGECAAAWDAVEELQAEAAHQRQDHPQKT-YFEKYCDD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  63   NPDAAECRVYDD  74



>ref|WP_015202341.1| hypothetical protein [Crinalium epipsammum]
 gb|AFZ12219.1| protein of unknown function CP12 [Crinalium epipsammum PCC 9333]
Length=75

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ +  + A Q C  +   SGEC AAWD VEEL A ASH R  +  NS  LE +C D
Sbjct  6    IQQKIEQEREQARQACDVNGANSGECAAAWDAVEELQAEASHQRTTKPKNS--LEKFCDD  63

Query  468  NPETDECRTYDN  503
            NPE  ECR Y++
Sbjct  64   NPEAAECRLYED  75



>ref|WP_029636735.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=81

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 44/79 (56%), Gaps = 9/79 (11%)
 Frame = +3

Query  279  APDSLSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDP  446
            A   +  ++ E V+ A   C    +SG    EC AAWD VEEL A ASH R  +K NS  
Sbjct  8    AKSDIQAQINEEVEQARTVC---DISGTNSAECAAAWDAVEELQAEASHQRQNKKKNS--  62

Query  447  LENYCKDNPETDECRTYDN  503
            LE YC DNPE  ECR  DN
Sbjct  63   LEQYCDDNPEAIECRIDDN  81



>ref|WP_012627347.1| hypothetical protein [Cyanothece sp. PCC 7425]
 gb|ACL44262.1| protein of unknown function CP12 [Cyanothece sp. PCC 7425]
Length=75

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +3

Query  351  VSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDNPETDECRTYDN  503
             SGEC AAWD VEEL A ASH R  +      L+ YC DNPE  ECR YD+
Sbjct  25   TSGECAAAWDAVEELQAEASHQRASEGQVKTSLQQYCDDNPEAVECRIYDD  75



>ref|WP_039754825.1| hypothetical protein [Hassallia byssoidea]
 gb|KIF28430.1| hypothetical protein PI95_57615 [Hassallia byssoidea VB512170]
Length=81

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 9/79 (11%)
 Frame = +3

Query  279  APDSLSEKVAESVKNAEQTCADDPVSG----ECVAAWDEVEELSAAASHARDRQKSNSDP  446
            A  ++ +++ + V+ A   C    +SG    EC AAWD VEEL A ASH R  +K NS  
Sbjct  8    AKSNIDDQIEQEVEQARTVC---DISGNNSAECAAAWDAVEELRAEASHQRQNKKKNS--  62

Query  447  LENYCKDNPETDECRTYDN  503
            LE YC DNPE  ECR  DN
Sbjct  63   LEQYCDDNPEAIECRIDDN  81



>ref|WP_011057657.1| MULTISPECIES: hypothetical protein [Thermosynechococcus]
 ref|NP_682610.1| CP12 polypeptide [Thermosynechococcus elongatus BP-1]
 dbj|BAC09372.1| CP12 polypeptide [Thermosynechococcus elongatus BP-1]
 gb|AHB88465.1| regulation of Calvin cycle via association/dissociation of PRK/CP12/GAPDH 
complex CP12 [Thermosynechococcus sp. NK55a]
Length=75

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            L +++ ++ + A + C  +   SG+C AAWD +EEL A A+H R  Q+ +    + YC D
Sbjct  4    LEKQIEQAREEAHKICDTEGATSGQCAAAWDALEELQAEAAHQRAEQQDHKTSFQQYCDD  63

Query  468  NPETDECRTYDN  503
            NP+  ECR YD+
Sbjct  64   NPDAAECRIYDD  75



>gb|KIE08862.1| hypothetical protein DA73_0230645 [Tolypothrix bouteillei VB521301]
Length=73

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ + V+ A  TC      S EC AAWD VEEL A ASH R  ++  S  LE YC  
Sbjct  4    IQDKIDQEVEQARATCDVTGSNSAECAAAWDAVEELQAEASHQRQAKRKTS--LEQYCDA  61

Query  468  NPETDECRTYDN  503
            NPE DECR Y++
Sbjct  62   NPEADECRVYED  73



>ref|WP_015081465.1| hypothetical protein [Anabaena sp. 90]
 gb|AFW96333.1| hypothetical protein ANA_C13680 [Anabaena sp. 90]
Length=81

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (57%), Gaps = 3/76 (4%)
 Frame = +3

Query  279  APDSLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLEN  455
            A   + EK+ E ++ A   C      S EC AAWD VEEL A ASH R  +  N+  LE 
Sbjct  8    ATGDIQEKIQEELEQARTVCDISGSNSAECAAAWDAVEELQAEASHQRQIKPKNA--LEQ  65

Query  456  YCKDNPETDECRTYDN  503
            YC  NPE DECR Y++
Sbjct  66   YCDANPEADECRLYED  81



>ref|WP_019493833.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=72

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 42/72 (58%), Gaps = 3/72 (4%)
 Frame = +3

Query  288  SLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCK  464
            S+ E++ + ++ A   C A    S EC AAWD VEEL A ASH   RQ+     LE YC 
Sbjct  2    SIQERIQQELEQARAVCDATGGESSECAAAWDAVEELQAEASH--QRQEKPKSSLEQYCD  59

Query  465  DNPETDECRTYD  500
            DNPE  ECR Y+
Sbjct  60   DNPEAAECRVYE  71



>ref|WP_015126619.1| hypothetical protein [Calothrix sp. PCC 7507]
 gb|AFY30791.1| protein of unknown function CP12 [Calothrix sp. PCC 7507]
Length=73

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 7/74 (9%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSG---ECVAAWDEVEELSAAASHARDRQKSNSDPLENYC  461
            + EK+ + V+ A   C  D   G   EC AAWD VEEL A ASH R  ++ NS  LE YC
Sbjct  4    IQEKIQDEVEQARAVC--DIAGGNSPECAAAWDAVEELQAEASHQRQGKQKNS--LEQYC  59

Query  462  KDNPETDECRTYDN  503
             DNP+  ECR Y++
Sbjct  60   DDNPDAAECRLYED  73



>ref|WP_017293080.1| hypothetical protein [Geminocystis herdmanii]
Length=74

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 8/76 (11%)
 Frame = +3

Query  288  SLSEKVAESVKNAEQTC-ADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDP---LEN  455
            ++ EK+ E +K A + C  +   S EC AAWD VEEL A ASH    QK N  P   LE 
Sbjct  3    NIQEKIQEEIKEAREVCDINGKGSPECAAAWDAVEELQAEASH----QKENEHPKTSLEQ  58

Query  456  YCKDNPETDECRTYDN  503
            YC DNP+  ECR Y++
Sbjct  59   YCDDNPDAAECRLYED  74



>gb|ACB49980.1| putative CP12 [Cyanothece sp. ATCC 51142]
Length=81

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = +3

Query  276  AAPDSLSEKVAESVKNAEQTCADDPV-SGECVAAWDEVEELSAAASHARDRQKSNSDPLE  452
            A   ++ +++ +  +NA+  C+ +   SG C AAWD VEEL A ASH R +Q   ++  E
Sbjct  6    AIMSNIDDQIQQERENAKNVCSTEGSDSGNCAAAWDAVEELQAEASHQRQKQTPKTN-FE  64

Query  453  NYCKDNPETDECRTYDN  503
             YC DNP+  ECR YD+
Sbjct  65   QYCDDNPDAVECRVYDD  81



>ref|WP_015136220.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 gb|AFY40508.1| protein of unknown function CP12 [Leptolyngbya sp. PCC 7376]
Length=73

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKDN  470
            + +++ +    A + C  D  SGEC AAWD VEEL A ASH R+++   ++ L+ +C  N
Sbjct  4    IQQQIEKERDAAREACNTDATSGECAAAWDAVEELQAEASHQREQEPEKTE-LDKFCDAN  62

Query  471  PETDECRTYDN  503
            P+ DECR Y++
Sbjct  63   PDADECRIYED  73



>ref|WP_019504562.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=73

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADDPVSGECVAAWDEVEELSAAASHARDR--QKSNSDPLENYCK  464
            + E++ +  ++A + C  D  S EC AAWD VEELSA A+H +    QKS+   LE YC 
Sbjct  4    IQEQIQKERQSAREVCDLDATSAECAAAWDAVEELSAEAAHQKQNAPQKSS---LEKYCD  60

Query  465  DNPETDECRTYDN  503
            DNP+  ECR Y++
Sbjct  61   DNPDALECRVYED  73



>ref|WP_018400793.1| CP12 polypeptide [filamentous cyanobacterium ESFC-1]
Length=203

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCADD-PVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            L EK+ E+  +A Q CA+  P S EC AAWD VEEL A A+H RD Q+      E YC++
Sbjct  133  LQEKIIEARDSARQICAEKGPTSPECAAAWDVVEELQAEAAHRRD-QRLEKTHFEEYCEE  191

Query  468  NPETDECRTYDN  503
             P+  E R YD+
Sbjct  192  YPDALEARMYDS  203



>ref|WP_002788843.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI18803.1| Similar to tr|P73654|P73654 [Microcystis aeruginosa PCC 9807]
Length=74

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = +3

Query  291  LSEKVAESVKNAEQTCA-DDPVSGECVAAWDEVEELSAAASHARDRQKSNSDPLENYCKD  467
            + +K+ E ++NA   C+ +   SGEC AAWD VEEL A A+H R      +   E YC D
Sbjct  4    IQDKIQEELENARAVCSIEGSTSGECAAAWDAVEELQAEAAHQRQDHPQKT-YFEKYCAD  62

Query  468  NPETDECRTYDN  503
            NP+  ECR Y++
Sbjct  63   NPDAAECRLYED  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340