BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF032G09

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772309.1|  PREDICTED: glutamate receptor 3.6-like             243   1e-75   Nicotiana sylvestris
ref|XP_006340926.1|  PREDICTED: glutamate receptor 3.6-like             244   5e-71   
ref|XP_009605827.1|  PREDICTED: glutamate receptor 3.6-like             239   1e-69   Nicotiana tomentosiformis
ref|XP_004232576.1|  PREDICTED: glutamate receptor 3.6 isoform X1       236   2e-68   
ref|XP_010316484.1|  PREDICTED: glutamate receptor 3.6 isoform X2       236   2e-68   Solanum lycopersicum
ref|XP_010316485.1|  PREDICTED: glutamate receptor 3.6 isoform X3       236   3e-68   Solanum lycopersicum
emb|CDP01776.1|  unnamed protein product                                221   6e-63   Coffea canephora [robusta coffee]
ref|XP_007203997.1|  hypothetical protein PRUPE_ppa001054mg             209   6e-59   
gb|ABO28526.1|  glutamate receptor                                      209   1e-58   Malus hupehensis
ref|XP_008337897.1|  PREDICTED: glutamate receptor 3.6-like             208   1e-58   
ref|XP_011022199.1|  PREDICTED: glutamate receptor 3.6-like isofo...    208   2e-58   Populus euphratica
ref|XP_008245275.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    206   4e-58   
gb|KDP43782.1|  hypothetical protein JCGZ_22409                         207   4e-58   Jatropha curcas
ref|XP_011022202.1|  PREDICTED: glutamate receptor 3.6-like isofo...    207   5e-58   Populus euphratica
ref|XP_007203996.1|  hypothetical protein PRUPE_ppa000995mg             206   1e-57   Prunus persica
ref|XP_002306436.1|  glutamate receptor family protein                  206   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009359614.1|  PREDICTED: glutamate receptor 3.6-like isofo...    205   2e-57   Pyrus x bretschneideri [bai li]
ref|XP_008241916.1|  PREDICTED: glutamate receptor 3.6-like isofo...    205   2e-57   Prunus mume [ume]
ref|XP_008241921.1|  PREDICTED: glutamate receptor 3.6-like isofo...    204   5e-57   
ref|XP_010266234.1|  PREDICTED: glutamate receptor 3.3-like isofo...    203   8e-57   Nelumbo nucifera [Indian lotus]
ref|XP_004134824.1|  PREDICTED: glutamate receptor 3.6-like             203   1e-56   Cucumis sativus [cucumbers]
ref|XP_004158839.1|  PREDICTED: glutamate receptor 3.6-like             203   2e-56   
ref|XP_010266353.1|  PREDICTED: glutamate receptor 3.6-like             201   3e-56   
ref|XP_007203104.1|  hypothetical protein PRUPE_ppa023817mg             201   4e-56   Prunus persica
ref|XP_007203235.1|  hypothetical protein PRUPE_ppa001033mg             201   5e-56   Prunus persica
ref|XP_002276999.1|  PREDICTED: glutamate receptor 3.6                  200   1e-55   Vitis vinifera
ref|XP_009369789.1|  PREDICTED: glutamate receptor 3.6-like             200   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_011022201.1|  PREDICTED: glutamate receptor 3.6-like isofo...    200   1e-55   Populus euphratica
ref|XP_007046473.1|  Glutamate receptor 3.6                             199   2e-55   
ref|XP_009359612.1|  PREDICTED: glutamate receptor 3.6-like isofo...    199   3e-55   
ref|XP_009359613.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   6e-55   
emb|CBI21566.3|  unnamed protein product                                198   7e-55   Vitis vinifera
ref|XP_008337900.1|  PREDICTED: glutamate receptor 3.6-like             197   2e-54   
ref|XP_002521736.1|  glutamate receptor 3 plant, putative               196   2e-54   
ref|XP_003533409.1|  PREDICTED: glutamate receptor 3.3-like isofo...    196   3e-54   Glycine max [soybeans]
ref|XP_009392853.1|  PREDICTED: glutamate receptor 3.1-like isofo...    195   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392852.1|  PREDICTED: glutamate receptor 3.1-like isofo...    195   7e-54   
ref|XP_007018097.1|  Glutamate receptor 3.3 isoform 4                   194   9e-54   
ref|XP_011465033.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    195   1e-53   Fragaria vesca subsp. vesca
ref|XP_002272859.2|  PREDICTED: glutamate receptor 3.3                  195   1e-53   Vitis vinifera
ref|XP_009359611.1|  PREDICTED: glutamate receptor 3.6-like             194   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_007018099.1|  Glutamate receptor 3.3 isoform 6                   194   2e-53   
ref|XP_008440927.1|  PREDICTED: glutamate receptor 3.6 isoform X2       194   2e-53   Cucumis melo [Oriental melon]
ref|XP_007018094.1|  Glutamate receptor 3.3 isoform 1                   194   2e-53   
ref|XP_007018096.1|  Glutamate receptor 3.3 isoform 3                   194   2e-53   
ref|XP_008440920.1|  PREDICTED: glutamate receptor 3.6 isoform X1       194   3e-53   
ref|XP_008241924.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    194   3e-53   
gb|KCW56490.1|  hypothetical protein EUGRSUZ_I02216                     194   4e-53   Eucalyptus grandis [rose gum]
ref|XP_010029575.1|  PREDICTED: glutamate receptor 3.6                  193   4e-53   
ref|XP_004287716.1|  PREDICTED: glutamate receptor 3.6                  193   6e-53   Fragaria vesca subsp. vesca
gb|AAR27949.1|  GLR3.3                                                  192   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_174978.1|  glutamate receptor 3.3                                192   8e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010103244.1|  Glutamate receptor 3.6                             193   8e-53   
ref|XP_010266233.1|  PREDICTED: glutamate receptor 3.3-like isofo...    192   9e-53   Nelumbo nucifera [Indian lotus]
ref|XP_007156250.1|  hypothetical protein PHAVU_003G270600g             190   2e-52   Phaseolus vulgaris [French bean]
ref|XP_010266235.1|  PREDICTED: glutamate receptor 3.3-like isofo...    191   3e-52   
ref|XP_010266230.1|  PREDICTED: glutamate receptor 3.3-like isofo...    191   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_002891241.1|  predicted protein                                  189   9e-52   Arabidopsis lyrata subsp. lyrata
emb|CBI40741.3|  unnamed protein product                                189   1e-51   Vitis vinifera
emb|CDY70557.1|  BnaC08g46160D                                          186   1e-51   Brassica napus [oilseed rape]
gb|AET03597.2|  glutamate receptor 3.2                                  189   1e-51   Medicago truncatula
ref|XP_008786666.1|  PREDICTED: glutamate receptor 3.1                  189   1e-51   
emb|CDY68928.1|  BnaA08g29720D                                          185   2e-51   Brassica napus [oilseed rape]
gb|KHG10460.1|  Glutamate receptor 3.6 -like protein                    189   2e-51   Gossypium arboreum [tree cotton]
ref|XP_007156251.1|  hypothetical protein PHAVU_003G270800g             186   4e-51   Phaseolus vulgaris [French bean]
ref|XP_007156252.1|  hypothetical protein PHAVU_003G270800g             187   5e-51   Phaseolus vulgaris [French bean]
ref|XP_007046475.1|  Glutamate receptor isoform 2                       186   5e-51   
ref|XP_010266236.1|  PREDICTED: glutamate receptor 3.2-like             187   6e-51   Nelumbo nucifera [Indian lotus]
ref|XP_008237957.1|  PREDICTED: glutamate receptor 3.3                  187   8e-51   Prunus mume [ume]
ref|XP_007046474.1|  Glutamate receptor isoform 1                       187   8e-51   
ref|XP_006855692.1|  hypothetical protein AMTR_s00044p00137040          186   1e-50   Amborella trichopoda
ref|XP_010240316.1|  PREDICTED: glutamate receptor 3.1-like             186   1e-50   
ref|XP_010110512.1|  Glutamate receptor 3.6                             186   1e-50   
gb|KJB17458.1|  hypothetical protein B456_003G001400                    184   1e-50   Gossypium raimondii
ref|XP_009107641.1|  PREDICTED: glutamate receptor 3.3 isoform X2       185   2e-50   Brassica rapa
ref|XP_011034846.1|  PREDICTED: glutamate receptor 3.3-like isofo...    185   2e-50   Populus euphratica
gb|KHG26328.1|  Glutamate receptor 3.3 -like protein                    186   2e-50   Gossypium arboreum [tree cotton]
ref|XP_009418664.1|  PREDICTED: glutamate receptor 3.3-like             186   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB57945.1|  hypothetical protein B456_009G186500                    183   3e-50   Gossypium raimondii
ref|XP_007135963.1|  hypothetical protein PHAVU_009G006500g             185   3e-50   Phaseolus vulgaris [French bean]
ref|XP_010935350.1|  PREDICTED: glutamate receptor 3.1                  185   3e-50   Elaeis guineensis
ref|XP_008804484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    185   3e-50   Phoenix dactylifera
ref|XP_009107640.1|  PREDICTED: glutamate receptor 3.3 isoform X1       185   3e-50   Brassica rapa
ref|XP_008804475.1|  PREDICTED: glutamate receptor 3.1-like isofo...    185   4e-50   Phoenix dactylifera
ref|XP_011034844.1|  PREDICTED: glutamate receptor 3.3-like isofo...    185   4e-50   Populus euphratica
ref|XP_002301908.2|  Glutamate receptor 3.3 precursor family protein    185   4e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011034842.1|  PREDICTED: glutamate receptor 3.3-like isofo...    185   4e-50   Populus euphratica
gb|KJB17456.1|  hypothetical protein B456_003G001400                    184   4e-50   Gossypium raimondii
gb|KJB57941.1|  hypothetical protein B456_009G186500                    183   4e-50   Gossypium raimondii
gb|KJB17453.1|  hypothetical protein B456_003G001400                    185   5e-50   Gossypium raimondii
ref|XP_010094542.1|  Glutamate receptor 3.3                             185   5e-50   Morus notabilis
ref|XP_009786332.1|  PREDICTED: glutamate receptor 3.3 isoform X2       182   5e-50   Nicotiana sylvestris
gb|KDP36767.1|  hypothetical protein JCGZ_08058                         184   7e-50   Jatropha curcas
ref|XP_006342151.1|  PREDICTED: glutamate receptor 3.3-like isofo...    184   7e-50   Solanum tuberosum [potatoes]
ref|XP_003533408.1|  PREDICTED: glutamate receptor 3.3-like             184   8e-50   Glycine max [soybeans]
gb|KJB57940.1|  hypothetical protein B456_009G186500                    184   9e-50   Gossypium raimondii
ref|XP_009786331.1|  PREDICTED: glutamate receptor 3.3 isoform X1       184   9e-50   Nicotiana sylvestris
ref|XP_008337899.1|  PREDICTED: glutamate receptor 3.6-like             184   1e-49   Malus domestica [apple tree]
ref|XP_006425257.1|  hypothetical protein CICLE_v10024813mg             184   1e-49   Citrus clementina [clementine]
ref|XP_010500221.1|  PREDICTED: glutamate receptor 3.3                  184   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006473826.1|  PREDICTED: glutamate receptor 3.3-like isofo...    184   1e-49   Citrus sinensis [apfelsine]
gb|KDO71523.1|  hypothetical protein CISIN_1g002301mg                   182   1e-49   Citrus sinensis [apfelsine]
ref|XP_010478979.1|  PREDICTED: glutamate receptor 3.3-like             183   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004238633.2|  PREDICTED: glutamate receptor 3.3                  183   2e-49   Solanum lycopersicum
gb|KDO85164.1|  hypothetical protein CISIN_1g002309mg                   181   2e-49   Citrus sinensis [apfelsine]
gb|KDO85163.1|  hypothetical protein CISIN_1g002309mg                   182   2e-49   Citrus sinensis [apfelsine]
gb|KDO71521.1|  hypothetical protein CISIN_1g002301mg                   183   3e-49   Citrus sinensis [apfelsine]
ref|XP_011100274.1|  PREDICTED: glutamate receptor 3.3                  182   3e-49   Sesamum indicum [beniseed]
ref|XP_006467103.1|  PREDICTED: glutamate receptor 3.6-like isofo...    182   3e-49   Citrus sinensis [apfelsine]
gb|KDO71522.1|  hypothetical protein CISIN_1g002301mg                   182   3e-49   Citrus sinensis [apfelsine]
ref|XP_010680623.1|  PREDICTED: glutamate receptor 3.6-like             182   3e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006383780.1|  hypothetical protein POPTR_0005s27520g             181   3e-49   
dbj|BAL15056.1|  glutamate receptor 3.3                                 181   4e-49   Solanum lycopersicum
ref|XP_011034843.1|  PREDICTED: glutamate receptor 3.3-like isofo...    182   4e-49   Populus euphratica
ref|XP_009359749.1|  PREDICTED: glutamate receptor 3.6-like             182   5e-49   
ref|XP_006383781.1|  hypothetical protein POPTR_0005s27520g             180   5e-49   
gb|KDO71518.1|  hypothetical protein CISIN_1g002505mg                   179   6e-49   Citrus sinensis [apfelsine]
ref|XP_007203444.1|  hypothetical protein PRUPE_ppa022019mg             181   6e-49   
ref|XP_010923968.1|  PREDICTED: glutamate receptor 3.4-like             182   6e-49   Elaeis guineensis
ref|XP_006435401.1|  hypothetical protein CICLE_v10000195mg             182   6e-49   Citrus clementina [clementine]
ref|XP_009372603.1|  PREDICTED: glutamate receptor 3.3-like             182   7e-49   Pyrus x bretschneideri [bai li]
gb|KDO85161.1|  hypothetical protein CISIN_1g002309mg                   182   7e-49   Citrus sinensis [apfelsine]
gb|KDO85160.1|  hypothetical protein CISIN_1g002309mg                   181   8e-49   Citrus sinensis [apfelsine]
ref|XP_007202847.1|  hypothetical protein PRUPE_ppa014700mg             180   8e-49   
ref|XP_009401867.1|  PREDICTED: glutamate receptor 3.1-like             181   1e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008803655.1|  PREDICTED: glutamate receptor 3.5-like             181   1e-48   Phoenix dactylifera
gb|KDO71515.1|  hypothetical protein CISIN_1g002505mg                   179   1e-48   Citrus sinensis [apfelsine]
ref|XP_002306988.2|  Glutamate receptor 3.3 precursor family protein    181   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_008373417.1|  PREDICTED: glutamate receptor 3.3                  181   1e-48   
ref|XP_006467099.1|  PREDICTED: glutamate receptor 3.6-like isofo...    179   1e-48   
ref|XP_007043077.1|  Glutamate receptor 2 isoform 3                     179   2e-48   
ref|XP_006306244.1|  hypothetical protein CARUB_v10012075mg             180   2e-48   
ref|XP_008667836.1|  PREDICTED: hypothetical protein isoform X1         180   3e-48   
gb|KDO71514.1|  hypothetical protein CISIN_1g002505mg                   179   4e-48   Citrus sinensis [apfelsine]
gb|KGN48998.1|  hypothetical protein Csa_6G509670                       179   4e-48   Cucumis sativus [cucumbers]
dbj|BAK04480.1|  predicted protein                                      179   4e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010550509.1|  PREDICTED: glutamate receptor 3.6 isoform X2       179   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_010550505.1|  PREDICTED: glutamate receptor 3.6 isoform X1       179   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_006425260.1|  hypothetical protein CICLE_v10024825mg             177   4e-48   
ref|XP_006425259.1|  hypothetical protein CICLE_v10024825mg             177   4e-48   
ref|XP_006467097.1|  PREDICTED: glutamate receptor 3.6-like isofo...    179   5e-48   Citrus sinensis [apfelsine]
ref|XP_011041194.1|  PREDICTED: glutamate receptor 3.3-like             179   5e-48   Populus euphratica
ref|XP_006425263.1|  hypothetical protein CICLE_v10024825mg             178   5e-48   
gb|KDO68418.1|  hypothetical protein CISIN_1g002211mg                   176   5e-48   Citrus sinensis [apfelsine]
ref|XP_004976611.1|  PREDICTED: glutamate receptor 3.1-like             179   7e-48   
ref|XP_007043076.1|  Glutamate receptor 2 isoform 2                     179   8e-48   
ref|XP_006396004.1|  hypothetical protein EUTSA_v10003614mg             179   8e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010918356.1|  PREDICTED: glutamate receptor 3.1                  179   8e-48   Elaeis guineensis
ref|XP_010270507.1|  PREDICTED: glutamate receptor 3.3-like isofo...    179   8e-48   
ref|XP_007043075.1|  Glutamate receptor 2 isoform 1                     179   9e-48   
ref|XP_002520606.1|  glutamate receptor 3 plant, putative               178   9e-48   Ricinus communis
ref|XP_009618635.1|  PREDICTED: glutamate receptor 3.3-like             178   1e-47   Nicotiana tomentosiformis
dbj|BAJ34460.1|  unnamed protein product                                174   1e-47   Eutrema halophilum
ref|XP_006422387.1|  hypothetical protein CICLE_v10027770mg             176   1e-47   
ref|XP_006425261.1|  hypothetical protein CICLE_v10024825mg             178   1e-47   
ref|XP_008235912.1|  PREDICTED: glutamate receptor 3.2-like             178   1e-47   Prunus mume [ume]
gb|KDP47011.1|  hypothetical protein JCGZ_10738                         177   2e-47   Jatropha curcas
gb|KDO68413.1|  hypothetical protein CISIN_1g002211mg                   176   2e-47   Citrus sinensis [apfelsine]
ref|XP_008241922.1|  PREDICTED: glutamate receptor 3.6-like             177   2e-47   Prunus mume [ume]
ref|XP_007203978.1|  hypothetical protein PRUPE_ppa025247mg             176   2e-47   
ref|XP_007200076.1|  hypothetical protein PRUPE_ppa021130mg             177   2e-47   
ref|XP_003527293.1|  PREDICTED: glutamate receptor 3.3-like isofo...    177   3e-47   Glycine max [soybeans]
ref|XP_006577929.1|  PREDICTED: glutamate receptor 3.3-like             177   3e-47   Glycine max [soybeans]
ref|XP_004500848.1|  PREDICTED: glutamate receptor 3.3-like isofo...    177   4e-47   Cicer arietinum [garbanzo]
gb|KDO68407.1|  hypothetical protein CISIN_1g002211mg                   177   4e-47   Citrus sinensis [apfelsine]
ref|XP_004512282.1|  PREDICTED: glutamate receptor 3.6-like isofo...    176   4e-47   Cicer arietinum [garbanzo]
ref|XP_006486565.1|  PREDICTED: glutamate receptor 3.2-like isofo...    176   5e-47   Citrus sinensis [apfelsine]
ref|XP_006422390.1|  hypothetical protein CICLE_v10027770mg             176   5e-47   Citrus clementina [clementine]
ref|XP_002510703.1|  glutamate receptor 3 plant, putative               176   5e-47   Ricinus communis
ref|XP_010267713.1|  PREDICTED: glutamate receptor 3.5-like isofo...    176   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_004512281.1|  PREDICTED: glutamate receptor 3.6-like isofo...    176   6e-47   Cicer arietinum [garbanzo]
ref|XP_010267711.1|  PREDICTED: glutamate receptor 3.5-like isofo...    176   6e-47   
ref|XP_010267710.1|  PREDICTED: glutamate receptor 3.5-like isofo...    176   8e-47   
ref|XP_010267709.1|  PREDICTED: glutamate receptor 3.5-like isofo...    176   8e-47   Nelumbo nucifera [Indian lotus]
ref|XP_010923978.1|  PREDICTED: glutamate receptor 3.5-like             174   9e-47   
gb|EMT00479.1|  Glutamate receptor 3.1                                  177   9e-47   
ref|XP_006403911.1|  hypothetical protein EUTSA_v10010111mg             175   1e-46   Eutrema salsugineum [saltwater cress]
emb|CAN72607.1|  hypothetical protein VITISV_021339                     174   3e-46   Vitis vinifera
ref|XP_002313575.2|  Glutamate receptor 3.1 precursor family protein    174   3e-46   
emb|CBI37733.3|  unnamed protein product                                175   4e-46   Vitis vinifera
gb|KEH36347.1|  glutamate receptor 3.2                                  172   4e-46   Medicago truncatula
ref|XP_002279899.1|  PREDICTED: glutamate receptor 3.2                  174   4e-46   Vitis vinifera
ref|XP_010530328.1|  PREDICTED: glutamate receptor 3.3                  174   5e-46   Tarenaya hassleriana [spider flower]
emb|CDP07274.1|  unnamed protein product                                174   5e-46   Coffea canephora [robusta coffee]
ref|XP_008452999.1|  PREDICTED: glutamate receptor 3.3 isoform X1       173   9e-46   Cucumis melo [Oriental melon]
gb|KEH36348.1|  glutamate receptor 3.2                                  171   1e-45   Medicago truncatula
gb|KDP43780.1|  hypothetical protein JCGZ_22407                         172   1e-45   Jatropha curcas
gb|KJB50477.1|  hypothetical protein B456_008G173300                    171   1e-45   Gossypium raimondii
ref|XP_004145549.1|  PREDICTED: glutamate receptor 3.3-like             172   2e-45   Cucumis sativus [cucumbers]
ref|XP_008242065.1|  PREDICTED: glutamate receptor 3.6-like             172   2e-45   Prunus mume [ume]
ref|XP_010270514.1|  PREDICTED: glutamate receptor 3.2-like isofo...    171   2e-45   Nelumbo nucifera [Indian lotus]
gb|KEH36349.1|  glutamate receptor 3.2                                  171   2e-45   Medicago truncatula
gb|KEH36346.1|  glutamate receptor 3.2                                  172   2e-45   Medicago truncatula
gb|KJB50478.1|  hypothetical protein B456_008G173300                    171   3e-45   Gossypium raimondii
gb|KEH27628.1|  glutamate receptor 3.2                                  172   3e-45   Medicago truncatula
gb|KJB50474.1|  hypothetical protein B456_008G173300                    171   3e-45   Gossypium raimondii
ref|XP_003612376.1|  Glutamate receptor 3.6                             171   4e-45   
ref|XP_008230073.1|  PREDICTED: glutamate receptor 3.4-like             171   4e-45   
ref|XP_011087614.1|  PREDICTED: glutamate receptor 3.2-like isofo...    170   4e-45   Sesamum indicum [beniseed]
ref|XP_006364369.1|  PREDICTED: glutamate receptor 3.2-like             171   4e-45   Solanum tuberosum [potatoes]
ref|XP_011000874.1|  PREDICTED: glutamate receptor 3.2                  171   4e-45   Populus euphratica
ref|XP_003603849.1|  Glutamate-gated kainate-type ion channel rec...    171   4e-45   
gb|KJB50476.1|  hypothetical protein B456_008G173300                    171   4e-45   Gossypium raimondii
gb|KJB50475.1|  hypothetical protein B456_008G173300                    171   5e-45   Gossypium raimondii
gb|KJB50471.1|  hypothetical protein B456_008G173300                    171   5e-45   Gossypium raimondii
ref|XP_010270512.1|  PREDICTED: glutamate receptor 3.2-like isofo...    171   5e-45   
ref|XP_004952125.1|  PREDICTED: glutamate receptor 3.1-like isofo...    171   7e-45   
emb|CAB63012.1|  putative glutamate receptor                            171   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952127.1|  PREDICTED: glutamate receptor 3.1-like isofo...    170   8e-45   Setaria italica
gb|KHG21169.1|  Glutamate receptor 3.2 -like protein                    170   8e-45   Gossypium arboreum [tree cotton]
gb|EYU41186.1|  hypothetical protein MIMGU_mgv1a000937mg                170   9e-45   Erythranthe guttata [common monkey flower]
gb|KJB79726.1|  hypothetical protein B456_013G064100                    167   9e-45   Gossypium raimondii
gb|KJB47170.1|  hypothetical protein B456_008G013900                    170   1e-44   Gossypium raimondii
ref|XP_003608170.1|  Glutamate receptor 3.6                             166   1e-44   
ref|XP_004487403.1|  PREDICTED: glutamate receptor 3.4-like isofo...    170   1e-44   
emb|CDX73718.1|  BnaC08g22850D                                          169   1e-44   
ref|XP_011087613.1|  PREDICTED: glutamate receptor 3.2-like isofo...    170   1e-44   Sesamum indicum [beniseed]
ref|NP_190716.3|  glutamate receptor 3.6                                169   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004161019.1|  PREDICTED: glutamate receptor 3.2-like             167   2e-44   
ref|XP_006412122.1|  hypothetical protein EUTSA_v10024351mg             169   2e-44   Eutrema salsugineum [saltwater cress]
ref|XP_004290072.1|  PREDICTED: glutamate receptor 3.2-like             169   2e-44   Fragaria vesca subsp. vesca
ref|XP_011092253.1|  PREDICTED: glutamate receptor 3.2-like             169   2e-44   
gb|KHG01323.1|  Glutamate receptor 3.4 -like protein                    169   2e-44   Gossypium arboreum [tree cotton]
ref|XP_009115834.1|  PREDICTED: glutamate receptor 3.6 isoform X1       169   2e-44   Brassica rapa
ref|XP_002876089.1|  ATGLR3.6                                           169   2e-44   
ref|XP_010907850.1|  PREDICTED: glutamate receptor 3.4-like             169   3e-44   Elaeis guineensis
ref|XP_009115836.1|  PREDICTED: glutamate receptor 3.6 isoform X2       168   3e-44   Brassica rapa
ref|XP_010530965.1|  PREDICTED: glutamate receptor 3.2-like             168   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_004154082.1|  PREDICTED: glutamate receptor 3.2-like             167   3e-44   
gb|KJB79724.1|  hypothetical protein B456_013G064100                    167   4e-44   Gossypium raimondii
gb|EEC72350.1|  hypothetical protein OsI_05591                          168   4e-44   Oryza sativa Indica Group [Indian rice]
gb|EEE56178.1|  hypothetical protein OsJ_05129                          168   4e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010503844.1|  PREDICTED: glutamate receptor 3.6-like isofo...    166   5e-44   Camelina sativa [gold-of-pleasure]
gb|KGN43348.1|  hypothetical protein Csa_7G025200                       168   5e-44   Cucumis sativus [cucumbers]
ref|XP_004144891.1|  PREDICTED: glutamate receptor 3.2-like             168   5e-44   
ref|NP_001045687.1|  Os02g0117500                                       168   6e-44   
ref|XP_007204033.1|  hypothetical protein PRUPE_ppa020695mg             167   6e-44   
ref|XP_002306435.2|  hypothetical protein POPTR_0005s10560g             167   6e-44   
gb|KEH20344.1|  glutamate receptor 3.2                                  165   6e-44   Medicago truncatula
gb|KJB79723.1|  hypothetical protein B456_013G064100                    167   7e-44   Gossypium raimondii
ref|XP_010515559.1|  PREDICTED: glutamate receptor 3.6-like isofo...    166   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010426706.1|  PREDICTED: glutamate receptor 3.6 isoform X2       166   8e-44   Camelina sativa [gold-of-pleasure]
gb|KJB79725.1|  hypothetical protein B456_013G064100                    167   8e-44   Gossypium raimondii
ref|XP_006292183.1|  hypothetical protein CARUB_v10018389mg             167   8e-44   Capsella rubella
ref|XP_008812265.1|  PREDICTED: glutamate receptor 3.4 isoform X1       167   9e-44   Phoenix dactylifera
ref|XP_003573352.1|  PREDICTED: glutamate receptor 3.1 isoform X1       167   9e-44   Brachypodium distachyon [annual false brome]
ref|XP_010028859.1|  PREDICTED: glutamate receptor 3.2-like isofo...    166   9e-44   
ref|XP_009353274.1|  PREDICTED: glutamate receptor 3.4-like isofo...    167   1e-43   Pyrus x bretschneideri [bai li]
gb|KEH39010.1|  glutamate receptor 3.2                                  165   1e-43   Medicago truncatula
ref|XP_008353536.1|  PREDICTED: glutamate receptor 3.4-like             167   1e-43   Malus domestica [apple tree]
ref|XP_009353273.1|  PREDICTED: glutamate receptor 3.4-like isofo...    167   1e-43   
ref|XP_010548165.1|  PREDICTED: glutamate receptor 3.1-like isofo...    167   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_010515558.1|  PREDICTED: glutamate receptor 3.6-like isofo...    166   1e-43   Camelina sativa [gold-of-pleasure]
gb|AFW69814.1|  hypothetical protein ZEAMMB73_405216                    167   1e-43   
gb|KEH39012.1|  glutamate receptor 3.2                                  165   1e-43   Medicago truncatula
gb|KEH20343.1|  glutamate receptor 3.2                                  165   1e-43   Medicago truncatula
ref|XP_008645171.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    167   1e-43   
ref|XP_009608800.1|  PREDICTED: glutamate receptor 3.2-like             167   1e-43   Nicotiana tomentosiformis
ref|NP_567981.1|  glutamate receptor 3.2                                167   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAL24126.1|  unknown protein                                         167   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503841.1|  PREDICTED: glutamate receptor 3.6-like isofo...    166   2e-43   Camelina sativa [gold-of-pleasure]
gb|AAK13248.1|AF159498_1  putative glutamate receptor like-protein      166   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KEH20342.1|  glutamate receptor 3.2                                  164   2e-43   Medicago truncatula
ref|XP_007217063.1|  hypothetical protein PRUPE_ppa001079mg             166   2e-43   
ref|XP_006657772.1|  PREDICTED: glutamate receptor 3.4-like             166   2e-43   
ref|XP_010426704.1|  PREDICTED: glutamate receptor 3.6 isoform X1       166   2e-43   Camelina sativa [gold-of-pleasure]
gb|KCW55682.1|  hypothetical protein EUGRSUZ_I01532                     166   2e-43   Eucalyptus grandis [rose gum]
ref|XP_010515556.1|  PREDICTED: glutamate receptor 3.6-like isofo...    166   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010028854.1|  PREDICTED: glutamate receptor 3.2-like isofo...    166   3e-43   
ref|XP_009353269.1|  PREDICTED: glutamate receptor 3.4-like             166   4e-43   
ref|XP_010463180.1|  PREDICTED: glutamate receptor 3.3-like             165   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_003596996.1|  Glutamate receptor 3.4                             165   4e-43   Medicago truncatula
gb|AFW66756.1|  hypothetical protein ZEAMMB73_452909                    166   4e-43   
ref|XP_008447826.1|  PREDICTED: glutamate receptor 3.2                  165   5e-43   Cucumis melo [Oriental melon]
gb|KHG05232.1|  Glutamate receptor 3.2 -like protein                    165   5e-43   Gossypium arboreum [tree cotton]
ref|XP_007156253.1|  hypothetical protein PHAVU_003G270900g             165   6e-43   Phaseolus vulgaris [French bean]
gb|AET03581.2|  glutamate receptor 3.2                                  165   6e-43   Medicago truncatula
ref|XP_010237639.1|  PREDICTED: glutamate receptor 3.5-like isofo...    163   6e-43   
ref|XP_011022198.1|  PREDICTED: glutamate receptor 3.6-like             165   6e-43   Populus euphratica
ref|XP_007142574.1|  hypothetical protein PHAVU_008G292200g             164   6e-43   
ref|XP_010090700.1|  Glutamate receptor 3.2                             165   8e-43   
ref|XP_006858062.1|  hypothetical protein AMTR_s00062p00050250          164   8e-43   
ref|XP_006646788.1|  PREDICTED: glutamate receptor 3.1-like             164   9e-43   
ref|XP_009341487.1|  PREDICTED: glutamate receptor 3.2-like             164   1e-42   
ref|XP_009333813.1|  PREDICTED: glutamate receptor 3.2-like             164   1e-42   
ref|XP_003527492.1|  PREDICTED: glutamate receptor 3.4-like isofo...    164   1e-42   
ref|XP_002869097.1|  hypothetical protein ARALYDRAFT_491120             164   1e-42   
ref|XP_009763348.1|  PREDICTED: glutamate receptor 3.2-like             164   1e-42   
gb|KHN41219.1|  Glutamate receptor 3.4                                  164   1e-42   
ref|XP_010423149.1|  PREDICTED: glutamate receptor 3.1-like             158   1e-42   
ref|XP_003547880.2|  PREDICTED: glutamate receptor 3.6-like             164   1e-42   
gb|KHN12498.1|  Glutamate receptor 3.6                                  164   2e-42   
ref|XP_006590755.1|  PREDICTED: glutamate receptor 3.6-like isofo...    164   2e-42   
ref|XP_007158020.1|  hypothetical protein PHAVU_002G117500g             163   2e-42   
ref|XP_009121142.1|  PREDICTED: glutamate receptor 3.1 isoform X1       163   2e-42   
ref|XP_009121143.1|  PREDICTED: glutamate receptor 3.1 isoform X2       163   2e-42   
gb|EYU33298.1|  hypothetical protein MIMGU_mgv1a001051mg                163   2e-42   
ref|XP_003533407.2|  PREDICTED: glutamate receptor 3.6-like isofo...    163   2e-42   
ref|XP_010237634.1|  PREDICTED: glutamate receptor 3.4-like isofo...    163   2e-42   
ref|XP_010109511.1|  Glutamate receptor 3.4                             163   3e-42   
gb|EMT06987.1|  Glutamate receptor 3.3                                  163   3e-42   
ref|XP_007158021.1|  hypothetical protein PHAVU_002G117500g             163   3e-42   
ref|XP_003563011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    163   3e-42   
gb|KHN41809.1|  Glutamate receptor 3.6                                  163   3e-42   
ref|XP_004289031.1|  PREDICTED: glutamate receptor 3.3-like             160   3e-42   
ref|XP_008379927.1|  PREDICTED: glutamate receptor 3.4-like             163   3e-42   
emb|CDY24327.1|  BnaA07g02520D                                          163   3e-42   
gb|KHN33784.1|  Glutamate receptor 3.3                                  162   4e-42   
emb|CDY65624.1|  BnaCnng48020D                                          162   4e-42   
ref|XP_003517130.1|  PREDICTED: glutamate receptor 3.6-like isofo...    162   4e-42   
ref|XP_006595635.1|  PREDICTED: glutamate receptor 3.2-like isofo...    161   5e-42   
ref|XP_010276016.1|  PREDICTED: glutamate receptor 3.4-like             162   5e-42   
ref|XP_010496956.1|  PREDICTED: glutamate receptor 3.6-like             159   6e-42   
ref|XP_009340816.1|  PREDICTED: glutamate receptor 3.2-like             160   6e-42   
ref|XP_009625694.1|  PREDICTED: glutamate receptor 3.4-like isofo...    162   6e-42   
gb|EMT02755.1|  Glutamate receptor 3.3                                  162   6e-42   
emb|CDP11785.1|  unnamed protein product                                162   7e-42   
ref|XP_010426707.1|  PREDICTED: glutamate receptor 3.6-like isofo...    162   7e-42   
ref|XP_010507397.1|  PREDICTED: glutamate receptor 3.6-like             160   7e-42   
ref|XP_011005110.1|  PREDICTED: glutamate receptor 3.4 isoform X2       162   8e-42   
gb|KHG17978.1|  Glutamate receptor 3.4 -like protein                    162   8e-42   
ref|XP_009108612.1|  PREDICTED: glutamate receptor 3.2-like isofo...    162   8e-42   
ref|XP_008348134.1|  PREDICTED: glutamate receptor 3.4-like             162   8e-42   
ref|XP_003545055.1|  PREDICTED: glutamate receptor 3.2-like isofo...    162   8e-42   
ref|XP_009108616.1|  PREDICTED: glutamate receptor 3.2-like isofo...    162   9e-42   
ref|XP_008670454.1|  PREDICTED: glutamate receptor 3.4-like             162   9e-42   
ref|XP_006595634.1|  PREDICTED: glutamate receptor 3.2-like isofo...    162   9e-42   
emb|CDX76331.1|  BnaA08g10690D                                          161   9e-42   
ref|XP_009108617.1|  PREDICTED: glutamate receptor 3.2-like isofo...    161   9e-42   
gb|EMT17124.1|  Glutamate receptor 3.1                                  161   1e-41   
ref|XP_004289164.2|  PREDICTED: glutamate receptor 3.5 isoform X1       161   1e-41   
ref|XP_008377883.1|  PREDICTED: glutamate receptor 3.2-like             161   1e-41   
ref|XP_011463243.1|  PREDICTED: glutamate receptor 3.4 isoform X2       161   1e-41   
ref|XP_009416682.1|  PREDICTED: glutamate receptor 3.4-like             161   2e-41   
pir||A84550  probable ligand-gated ion channel protein [imported]...    161   2e-41
ref|XP_003540841.1|  PREDICTED: glutamate receptor 3.4-like isofo...    161   2e-41   
gb|KHN38860.1|  Glutamate receptor 3.6                                  161   2e-41   
gb|AAB92421.1|  ligand gated channel-like protein                       161   2e-41   
gb|AAR88099.1|  putative glutamate receptor ion channel                 161   2e-41   
ref|XP_009419590.1|  PREDICTED: glutamate receptor 3.5-like             161   2e-41   
ref|NP_028351.2|  glutamate receptor                                    161   2e-41   
sp|Q7XJL2.2|GLR31_ARATH  RecName: Full=Glutamate receptor 3.1; Sh...    160   2e-41   
emb|CDY52597.1|  BnaCnng22760D                                          160   2e-41   
ref|XP_006652702.1|  PREDICTED: glutamate receptor 3.1-like isofo...    160   2e-41   
gb|KJB80500.1|  hypothetical protein B456_013G100600                    159   2e-41   
emb|CAA18740.1|  putative protein                                       160   2e-41   
ref|XP_008379630.1|  PREDICTED: glutamate receptor 3.4                  160   2e-41   
ref|XP_010515561.1|  PREDICTED: glutamate receptor 3.6-like isofo...    160   3e-41   
ref|XP_010680624.1|  PREDICTED: glutamate receptor 3.6-like             160   3e-41   
emb|CDX75490.1|  BnaA01g02120D                                          158   3e-41   
ref|XP_009119183.1|  PREDICTED: glutamate receptor 3.4                  160   4e-41   
gb|KJB80502.1|  hypothetical protein B456_013G100600                    159   4e-41   
ref|XP_006296930.1|  hypothetical protein CARUB_v10012924mg             160   4e-41   
ref|XP_009399220.1|  PREDICTED: glutamate receptor 3.5-like             160   4e-41   
gb|KHN35947.1|  Glutamate receptor 3.6                                  160   4e-41   
dbj|BAJ99508.1|  predicted protein                                      160   4e-41   
emb|CDY49512.1|  BnaC05g03240D                                          160   4e-41   
gb|AAF21901.1|AF109392_1  ligand gated channel-like protein             159   5e-41   
ref|XP_004957886.1|  PREDICTED: glutamate receptor 3.4-like             159   5e-41   
sp|Q7XP59.1|GLR31_ORYSJ  RecName: Full=Glutamate receptor 3.1; Al...    159   5e-41   
ref|XP_004509455.1|  PREDICTED: glutamate receptor 3.6-like isofo...    159   5e-41   
emb|CAH66856.1|  H0307D04.1                                             159   5e-41   
ref|XP_010426717.1|  PREDICTED: glutamate receptor 3.6-like isofo...    159   5e-41   
emb|CDY46839.1|  BnaA10g03230D                                          159   5e-41   
ref|XP_009589003.1|  PREDICTED: glutamate receptor 3.4 isoform X1       159   5e-41   
emb|CDX69127.1|  BnaC01g03260D                                          159   6e-41   
ref|XP_010657306.1|  PREDICTED: glutamate receptor 3.4 isoform X3       158   6e-41   
ref|XP_010515560.1|  PREDICTED: glutamate receptor 3.6-like isofo...    159   6e-41   
gb|EMS57750.1|  Glutamate receptor 3.3                                  159   6e-41   
ref|XP_004500849.1|  PREDICTED: glutamate receptor 3.3-like isofo...    159   6e-41   
gb|KJB80503.1|  hypothetical protein B456_013G100600                    159   6e-41   
ref|XP_010657305.1|  PREDICTED: glutamate receptor 3.4 isoform X2       158   7e-41   
ref|XP_002884045.1|  predicted protein                                  159   7e-41   
ref|XP_002524179.1|  glutamate receptor 3 plant, putative               159   7e-41   
dbj|BAL15055.1|  glutamate receptor 3.2                                 159   8e-41   
ref|XP_004966221.1|  PREDICTED: glutamate receptor 3.5-like             159   8e-41   
ref|XP_004243468.1|  PREDICTED: glutamate receptor 3.4 isoform X1       159   8e-41   
ref|XP_008666833.1|  PREDICTED: glutamate receptor 3.1-like             157   8e-41   
ref|XP_010469597.1|  PREDICTED: glutamate receptor 3.5 isoform X3       157   1e-40   
ref|XP_003563418.1|  PREDICTED: glutamate receptor 3.4                  158   1e-40   
ref|XP_009118614.1|  PREDICTED: glutamate receptor 3.4-like             158   1e-40   
ref|XP_002273744.3|  PREDICTED: glutamate receptor 3.4 isoform X1       158   1e-40   
emb|CAN66741.1|  hypothetical protein VITISV_021644                     158   2e-40   
ref|XP_006293634.1|  hypothetical protein CARUB_v10022588mg             158   2e-40   
emb|CBI28943.3|  unnamed protein product                                159   2e-40   
ref|XP_004158559.1|  PREDICTED: glutamate receptor 3.4-like             158   2e-40   
ref|XP_004151885.1|  PREDICTED: glutamate receptor 3.4-like             158   2e-40   
ref|NP_001059814.1|  Os07g0522600                                       155   2e-40   
ref|XP_010467484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    158   2e-40   
ref|XP_010467485.1|  PREDICTED: glutamate receptor 3.1-like isofo...    158   2e-40   
ref|XP_002451391.1|  hypothetical protein SORBIDRAFT_04g001290          157   2e-40   
ref|XP_011008408.1|  PREDICTED: glutamate receptor 3.4 isoform X2       156   2e-40   
ref|XP_008382743.1|  PREDICTED: glutamate receptor 3.2-like             157   2e-40   
ref|XP_010686867.1|  PREDICTED: glutamate receptor 3.3                  157   2e-40   
ref|XP_009417233.1|  PREDICTED: glutamate receptor 3.4-like             157   2e-40   
ref|XP_010469598.1|  PREDICTED: glutamate receptor 3.5 isoform X4       157   2e-40   
ref|XP_008812269.1|  PREDICTED: glutamate receptor 3.7 isoform X2       157   2e-40   
gb|AFW69063.1|  hypothetical protein ZEAMMB73_044126                    157   3e-40   
ref|XP_009765706.1|  PREDICTED: glutamate receptor 3.7 isoform X1       157   3e-40   
ref|XP_009103268.1|  PREDICTED: glutamate receptor 3.2                  157   3e-40   
ref|XP_006409331.1|  hypothetical protein EUTSA_v10022533mg             157   3e-40   
gb|KHN36534.1|  hypothetical protein glysoja_001265                     150   3e-40   
ref|XP_010690549.1|  PREDICTED: glutamate receptor 3.2-like             157   3e-40   
ref|XP_008644923.1|  PREDICTED: glutamate receptor 3.4-like isofo...    157   3e-40   
ref|XP_008644922.1|  PREDICTED: glutamate receptor 3.4-like isofo...    157   3e-40   
ref|XP_008812267.1|  PREDICTED: glutamate receptor 3.7 isoform X1       157   3e-40   
ref|XP_006303897.1|  hypothetical protein CARUB_v10008205mg             157   3e-40   
ref|XP_002460792.1|  hypothetical protein SORBIDRAFT_02g034960          157   3e-40   
ref|XP_006367285.1|  PREDICTED: glutamate receptor 3.4-like isofo...    157   3e-40   
ref|XP_006303896.1|  hypothetical protein CARUB_v10008205mg             157   3e-40   
ref|XP_010469595.1|  PREDICTED: glutamate receptor 3.5 isoform X1       157   3e-40   
dbj|BAK00799.1|  predicted protein                                      155   4e-40   
gb|EMS61084.1|  Glutamate receptor 3.4                                  157   4e-40   
ref|XP_002448402.1|  hypothetical protein SORBIDRAFT_06g026600          149   4e-40   
ref|XP_009794414.1|  PREDICTED: glutamate receptor 3.4-like isofo...    157   5e-40   
gb|KDP25838.1|  hypothetical protein JCGZ_22868                         157   5e-40   
ref|XP_009132846.1|  PREDICTED: glutamate receptor 3.5-like isofo...    157   6e-40   
ref|XP_003539503.1|  PREDICTED: glutamate receptor 3.4-like isofo...    156   8e-40   
gb|EEE67292.1|  hypothetical protein OsJ_24491                          156   8e-40   
ref|XP_002321123.2|  hypothetical protein POPTR_0014s15030g             156   9e-40   
ref|XP_002301627.1|  Glutamate receptor 3.5 precursor family protein    156   1e-39   
gb|EEC82165.1|  hypothetical protein OsI_26240                          155   1e-39   
ref|XP_011008405.1|  PREDICTED: glutamate receptor 3.4 isoform X1       156   1e-39   
ref|XP_002881224.1|  glutamate receptor 3.5 precursor                   155   1e-39   
ref|XP_009765170.1|  PREDICTED: glutamate receptor 3.4                  155   1e-39   
dbj|BAJ91183.1|  predicted protein                                      155   2e-39   
ref|XP_004287941.2|  PREDICTED: glutamate receptor 3.7                  155   2e-39   
emb|CDP16877.1|  unnamed protein product                                155   2e-39   
ref|XP_002437456.1|  hypothetical protein SORBIDRAFT_10g027420          154   2e-39   
gb|AAQ02674.1|  glutamate receptor                                      155   3e-39   
ref|XP_010510025.1|  PREDICTED: glutamate receptor 3.5-like isofo...    155   3e-39   
emb|CDX84735.1|  BnaA03g14950D                                          154   3e-39   
emb|CDY10044.1|  BnaC08g44070D                                          154   3e-39   
ref|XP_010510026.1|  PREDICTED: glutamate receptor 3.5-like isofo...    154   3e-39   
gb|EAZ38031.1|  hypothetical protein OsJ_22375                          154   3e-39   
ref|XP_006447544.1|  hypothetical protein CICLE_v10014175mg             154   3e-39   
ref|XP_007045625.1|  Glutamate receptor isoform 6                       152   3e-39   
ref|XP_010432300.1|  PREDICTED: glutamate receptor 3.2                  154   3e-39   
gb|AGN92471.1|  glutamate receptor 1                                    154   4e-39   
emb|CDY66698.1|  BnaCnng51940D                                          154   4e-39   
gb|EAZ02098.1|  hypothetical protein OsI_24185                          154   4e-39   
ref|XP_002273713.1|  PREDICTED: glutamate receptor 3.7                  154   5e-39   
ref|XP_010276026.1|  PREDICTED: glutamate receptor 3.7-like isofo...    154   5e-39   
ref|XP_010475194.1|  PREDICTED: glutamate receptor 3.4-like isofo...    154   6e-39   
ref|XP_006447543.1|  hypothetical protein CICLE_v10014175mg             154   6e-39   
ref|XP_007045621.1|  Glutamate receptor isoform 2                       153   6e-39   
ref|XP_007132553.1|  hypothetical protein PHAVU_011G104300g             154   6e-39   
ref|XP_008230072.1|  PREDICTED: glutamate receptor 3.7                  153   7e-39   
ref|XP_009589001.1|  PREDICTED: glutamate receptor 3.7 isoform X1       153   7e-39   
ref|XP_010276025.1|  PREDICTED: glutamate receptor 3.7-like isofo...    153   7e-39   
ref|XP_010437494.1|  PREDICTED: glutamate receptor 3.2-like             153   7e-39   
ref|XP_010276019.1|  PREDICTED: glutamate receptor 3.7-like isofo...    153   7e-39   
gb|KDP43779.1|  hypothetical protein JCGZ_22406                         153   7e-39   
emb|CDY48271.1|  BnaA05g10830D                                          152   8e-39   
ref|XP_004966219.1|  PREDICTED: glutamate receptor 3.4-like             153   9e-39   
ref|XP_007045624.1|  Glutamate receptor isoform 5                       153   9e-39   
ref|XP_007045620.1|  Glutamate receptor isoform 1                       153   9e-39   
gb|EMS53869.1|  Glutamate receptor 3.3                                  153   9e-39   
ref|NP_001189655.1|  glutamate receptor 3.5                             153   1e-38   
dbj|BAC42828.1|  putative ligand-gated ion channel protein              151   1e-38   
ref|XP_010548171.1|  PREDICTED: glutamate receptor 3.1-like isofo...    152   1e-38   
sp|Q9SW97.2|GLR35_ARATH  RecName: Full=Glutamate receptor 3.5; Al...    153   1e-38   
ref|XP_010515365.1|  PREDICTED: glutamate receptor 3.1                  152   1e-38   
ref|XP_010440065.1|  PREDICTED: glutamate receptor 3.2-like             142   1e-38   
ref|XP_010414004.1|  PREDICTED: glutamate receptor 3.5-like             153   1e-38   
gb|KDP25837.1|  hypothetical protein JCGZ_22867                         153   1e-38   
ref|XP_004966220.1|  PREDICTED: glutamate receptor 3.5-like             152   1e-38   
gb|KHN20098.1|  Glutamate receptor 3.3                                  152   1e-38   
dbj|BAH57236.1|  AT1G05200                                              151   1e-38   
ref|XP_008341999.1|  PREDICTED: glutamate receptor 3.7-like             152   1e-38   
ref|XP_010484773.1|  PREDICTED: glutamate receptor 3.4 isoform X1       152   2e-38   
ref|XP_002524180.1|  glutamate receptor 3 plant, putative               152   2e-38   
gb|EMT06356.1|  Glutamate receptor 3.1                                  152   2e-38   
ref|XP_010457602.1|  PREDICTED: glutamate receptor 3.4-like             152   2e-38   
ref|XP_009403107.1|  PREDICTED: glutamate receptor 3.5-like             152   2e-38   
ref|XP_007210370.1|  hypothetical protein PRUPE_ppa001283mg             152   2e-38   
ref|XP_009143978.1|  PREDICTED: glutamate receptor 3.5 isoform X1       152   3e-38   
ref|XP_009143980.1|  PREDICTED: glutamate receptor 3.5 isoform X3       152   3e-38   
ref|XP_002437454.1|  hypothetical protein SORBIDRAFT_10g027370          152   3e-38   
ref|XP_010522331.1|  PREDICTED: glutamate receptor 3.4                  152   3e-38   
ref|NP_172012.2|  glutamate receptor 3.4                                152   3e-38   
gb|AAB71458.1|  Similar to Arabidopsis putative ion-channel PID:g...    152   3e-38   
pir||T51137  ionotropic glutamate receptor homolog GLR4 [imported...    152   3e-38
ref|XP_008455863.1|  PREDICTED: glutamate receptor 3.7-like             152   3e-38   
dbj|BAK06938.1|  predicted protein                                      152   3e-38   
ref|XP_010909025.1|  PREDICTED: glutamate receptor 3.7                  151   3e-38   
ref|XP_002459199.1|  hypothetical protein SORBIDRAFT_02g000430          151   4e-38   
ref|XP_008455424.1|  PREDICTED: glutamate receptor 3.7 isoform X1       151   4e-38   
ref|XP_006356916.1|  PREDICTED: glutamate receptor 3.4-like isofo...    150   4e-38   
ref|XP_011005108.1|  PREDICTED: glutamate receptor 3.4 isoform X1       151   4e-38   
ref|XP_007149970.1|  hypothetical protein PHAVU_005G114800g             151   5e-38   
ref|XP_010557011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    151   5e-38   
ref|XP_006657254.1|  PREDICTED: glutamate receptor 3.5-like             151   5e-38   
ref|XP_010035564.1|  PREDICTED: glutamate receptor 3.4                  151   6e-38   
ref|XP_007045627.1|  Glutamate receptor isoform 1                       151   6e-38   
ref|XP_006356918.1|  PREDICTED: glutamate receptor 3.4-like isofo...    151   6e-38   
ref|XP_011008403.1|  PREDICTED: glutamate receptor 3.7                  150   6e-38   
gb|KGN63257.1|  hypothetical protein Csa_2G418920                       150   6e-38   
ref|XP_010063139.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    151   6e-38   
ref|XP_003541945.1|  PREDICTED: glutamate receptor 3.4-like isofo...    150   8e-38   



>ref|XP_009772309.1| PREDICTED: glutamate receptor 3.6-like, partial [Nicotiana sylvestris]
Length=335

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+ FW ++ +  Y+GY  EGVNSTLS RP VVN+GC+L+F + +GKV K AVEAAV+D+N
Sbjct  1    MRLFWTLILIFLYNGYSSEGVNSTLSARPKVVNVGCMLSFNTAVGKVTKVAVEAAVEDIN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SNP VLGGTKLNV  LDSNSSGFLGIVEA+RFMETD +AIIGPQ+SVIAHV+S++ANELQ
Sbjct  61   SNPSVLGGTKLNVISLDSNSSGFLGIVEAIRFMETDIMAIIGPQSSVIAHVVSNIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFAATDPTLSSLQYPFFVRTSP+D+F MAA+A I+++Y WREV+A
Sbjct  121  VPLLSFAATDPTLSSLQYPFFVRTSPSDMFQMAAIAEIIEHYEWREVIA  169



>ref|XP_006340926.1| PREDICTED: glutamate receptor 3.6-like [Solanum tuberosum]
Length=976

 Score =   244 bits (622),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = +3

Query  123  VKSGGLVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvak  302
            VK    V +L M+ FW ++ +  Y+GY  EGVNSTLS RP VVNIGC+L+F + +GK+ K
Sbjct  29   VKIAHFVPKLTMRLFWTLILIVLYNGYSSEGVNSTLSARPKVVNIGCMLSFSTLVGKITK  88

Query  303  aaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIA  482
             A EAAV+D+NSNPDV+GGTKLN+  LDSN SGFLGIVEA+RFMETDT+AI+GPQ+SVIA
Sbjct  89   IAAEAAVEDINSNPDVIGGTKLNMITLDSNGSGFLGIVEAIRFMETDTMAIVGPQSSVIA  148

Query  483  HVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            HV+S++ANELQVPLLSFAATDP+L+SLQYPFFVRTSP+D F M A+A IV+YY WREV+A
Sbjct  149  HVVSNIANELQVPLLSFAATDPSLASLQYPFFVRTSPSDKFQMEAIAQIVEYYEWREVIA  208



>ref|XP_009605827.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605828.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605829.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
Length=936

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+ FW +  +  Y+G+  EGVNSTLS RP +VN+GC+L+F + +GK+ K AVEAAV+D+N
Sbjct  1    MRLFWTLTLIFLYNGHSSEGVNSTLSARPKIVNVGCMLSFNTVVGKITKVAVEAAVEDIN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SNP VLGGTKLNV  LDSNSSGFLGIVEA+RFMETD +AIIGPQ+SVIAHV+S++ANELQ
Sbjct  61   SNPSVLGGTKLNVATLDSNSSGFLGIVEAIRFMETDIMAIIGPQSSVIAHVVSNIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFAATDPTLSSLQYPFFVRTSP+D+F MAA+A I+D+Y WREV+A
Sbjct  121  VPLLSFAATDPTLSSLQYPFFVRTSPSDMFQMAAIAEIIDHYEWREVIA  169



>ref|XP_004232576.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Solanum lycopersicum]
 dbj|BAL15058.1| glutamate receptor 3.5 [Solanum lycopersicum]
Length=958

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaavea  317
             V +  M+ FW ++ +  Y+G   EGVNSTLS RP VVNIGC+++F + +GKV K A EA
Sbjct  16   FVPKFTMRLFWTIILVVLYNGCSSEGVNSTLSARPKVVNIGCMVSFNTLVGKVTKVAAEA  75

Query  318  avddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISH  497
            AV+D+NSNPDVLGGTKLN+  LDSN+SGFLGIVEA+RFMETDT+AI+GPQ+SVIAHV+S+
Sbjct  76   AVEDINSNPDVLGGTKLNMITLDSNASGFLGIVEAIRFMETDTMAIVGPQSSVIAHVVSN  135

Query  498  LANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +ANELQVPLLSFAATDP+LSSLQYPFFVRTSP+D + M A+A +V+YY WREV+A
Sbjct  136  IANELQVPLLSFAATDPSLSSLQYPFFVRTSPSDKYQMEAIAEMVEYYEWREVIA  190



>ref|XP_010316484.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Solanum lycopersicum]
Length=951

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaavea  317
             V +  M+ FW ++ +  Y+G   EGVNSTLS RP VVNIGC+++F + +GKV K A EA
Sbjct  9    FVPKFTMRLFWTIILVVLYNGCSSEGVNSTLSARPKVVNIGCMVSFNTLVGKVTKVAAEA  68

Query  318  avddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISH  497
            AV+D+NSNPDVLGGTKLN+  LDSN+SGFLGIVEA+RFMETDT+AI+GPQ+SVIAHV+S+
Sbjct  69   AVEDINSNPDVLGGTKLNMITLDSNASGFLGIVEAIRFMETDTMAIVGPQSSVIAHVVSN  128

Query  498  LANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +ANELQVPLLSFAATDP+LSSLQYPFFVRTSP+D + M A+A +V+YY WREV+A
Sbjct  129  IANELQVPLLSFAATDPSLSSLQYPFFVRTSPSDKYQMEAIAEMVEYYEWREVIA  183



>ref|XP_010316485.1| PREDICTED: glutamate receptor 3.6 isoform X3 [Solanum lycopersicum]
Length=937

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+ FW ++ +  Y+G   EGVNSTLS RP VVNIGC+++F + +GKV K A EAAV+D+N
Sbjct  1    MRLFWTIILVVLYNGCSSEGVNSTLSARPKVVNIGCMVSFNTLVGKVTKVAAEAAVEDIN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SNPDVLGGTKLN+  LDSN+SGFLGIVEA+RFMETDT+AI+GPQ+SVIAHV+S++ANELQ
Sbjct  61   SNPDVLGGTKLNMITLDSNASGFLGIVEAIRFMETDTMAIVGPQSSVIAHVVSNIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFAATDP+LSSLQYPFFVRTSP+D + M A+A +V+YY WREV+A
Sbjct  121  VPLLSFAATDPSLSSLQYPFFVRTSPSDKYQMEAIAEMVEYYEWREVIA  169



>emb|CDP01776.1| unnamed protein product [Coffea canephora]
Length=940

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK F V++ +   +G   +G N+ +S RPDV+NIG ILT  S IGKVAK A++AAV+DVN
Sbjct  1    MKLFMVMVLMLSGNGQFSKGFNTNVSGRPDVLNIGSILTLNSVIGKVAKVAIDAAVEDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VL GTKLN+T LDSN SGFLGIVEA+RFMET T+AIIGPQ+SVIAHVISH+ANELQ
Sbjct  61   SSPAVLRGTKLNITTLDSNYSGFLGIVEAIRFMETQTMAIIGPQSSVIAHVISHIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VP+LS+AATDPTLSSL+YPFFVRTSPNDLF MAA+A +V+YY WREV+A
Sbjct  121  VPMLSYAATDPTLSSLEYPFFVRTSPNDLFQMAAIAELVEYYGWREVIA  169



>ref|XP_007203997.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
 gb|EMJ05196.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
Length=922

 Score =   209 bits (533),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ + FY+G    GV++ +STRP+ VN+G + +F S +GKVAK A+EAA++DVNS+P 
Sbjct  5    WLLVLMVFYNGVASNGVSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPA  64

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTK+ V M DSN SGFLGIVEA+RFME DTVAIIGPQ +V AH+ISH+ANELQVPLL
Sbjct  65   VLGGTKMIVQMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNAVTAHIISHIANELQVPLL  124

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+Y W+EV+A
Sbjct  125  SFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDHYGWKEVIA  169



>gb|ABO28526.1| glutamate receptor [Malus hupehensis]
Length=946

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaave  314
            +V +L M   W+++ + F +G    G ++T +STRPDVVN+G I +F + IGKVAK A+E
Sbjct  1    MVEQLAMSIVWLLVLMIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIE  60

Query  315  aavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVIS  494
            AAV DVNS+P VLGGTK+ VTM DSN SG LGI+EA+RFME DT+AIIGPQ +V AHVIS
Sbjct  61   AAVKDVNSDPSVLGGTKMIVTMQDSNYSGLLGIIEALRFMEKDTIAIIGPQNAVTAHVIS  120

Query  495  HLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            H+ANELQVPL+SF+ TDPTLS+LQ+PFFVR++ NDL+ MAA+A +VDYY WREV+A
Sbjct  121  HIANELQVPLVSFSVTDPTLSALQFPFFVRSTQNDLYQMAAIAEMVDYYGWREVIA  176



>ref|XP_008337897.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
 ref|XP_008337898.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=946

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaave  314
            +V +L M   W+++ + F +G    G ++T +STRPDVVN+G I +F + IGKVAK A+E
Sbjct  1    MVEQLAMSIVWLLVLMIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIE  60

Query  315  aavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVIS  494
            AAV DVNS+P VLGGTK+ VTM DSN SG LGI+EA+RFME DT+AIIGPQ +V AHVIS
Sbjct  61   AAVKDVNSDPSVLGGTKMIVTMQDSNYSGLLGIIEALRFMEKDTIAIIGPQNAVTAHVIS  120

Query  495  HLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            H+ANELQVPL+SF+ TDPTLS+LQ+PFFVR++ NDL+ MAA+A +VDYY WREV+A
Sbjct  121  HIANELQVPLVSFSVTDPTLSALQFPFFVRSTQNDLYQMAAIAEMVDYYGWREVIA  176



>ref|XP_011022199.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Populus euphratica]
Length=967

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = +3

Query  147  ELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavd  326
            ++ MK  WV++ L  Y+G   +GV + ++TRP  VNIG +L++ + IGKVAK A++AAVD
Sbjct  28   KITMKLIWVLVLLVCYNGVCLDGVTTNVTTRPPFVNIGALLSYNTTIGKVAKVAIQAAVD  87

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            DVNS+P VLGGTKL + M ++N SGFLGIVE+++FMETDTVAIIGPQ+SV AHVIS +AN
Sbjct  88   DVNSDPSVLGGTKLRLQMQNANQSGFLGIVESLKFMETDTVAIIGPQSSVTAHVISFVAN  147

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ELQVPLLS+++TDPTLSSLQ+P+F+ TS NDL+ MAA+A IVDYY WREV+A
Sbjct  148  ELQVPLLSYSSTDPTLSSLQFPYFIMTSRNDLYQMAAIAEIVDYYGWREVIA  199



>ref|XP_008245275.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=761

 Score =   206 bits (525),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 10/188 (5%)
 Frame = +3

Query  129  SGGLVI-----ELKMKGF-----WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFI  278
            SG LV+     +LK+ GF     W+++ + FY+     G ++ +STRP+ VN+G + +F 
Sbjct  15   SGWLVLLPLQSKLKIGGFTMNIVWLLVLMVFYNVVASNGGSTNVSTRPEFVNVGAVFSFN  74

Query  279  SPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAII  458
            S +GKVAK A+EAA++DVNS+P VLGGTK+ V M DSN SGFLGIVEA+RFME DTVAII
Sbjct  75   SIVGKVAKVAIEAAIEDVNSDPAVLGGTKMIVKMQDSNYSGFLGIVEALRFMEKDTVAII  134

Query  459  GPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDY  638
            GPQ +V AHVISH+ANELQVPLLSF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+
Sbjct  135  GPQNAVTAHVISHIANELQVPLLSFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDH  194

Query  639  YXWREVVA  662
            Y W+EV+A
Sbjct  195  YGWKEVIA  202



>gb|KDP43782.1| hypothetical protein JCGZ_22409 [Jatropha curcas]
Length=941

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (80%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK FW ++F+ F +G    G       RP+ VNIG  L+F S IGKVA+ A++AAVDDVN
Sbjct  1    MKVFWFLVFMVFSNGVCLNGFTRATKRRPEFVNIGATLSFNSTIGKVARIAIQAAVDDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P +LGGTKL + M D+N SGFLGI+EA++FME DT+AI+GPQAS+ AHV+S +ANELQ
Sbjct  61   SDPSILGGTKLRIKMQDTNYSGFLGIIEALKFMEDDTIAIVGPQASLTAHVVSFIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLS++ATDPTL+SLQ+PFFVRTS NDLF MAAVA IV YY WREV+A
Sbjct  121  VPLLSYSATDPTLTSLQFPFFVRTSQNDLFQMAAVAEIVYYYGWREVIA  169



>ref|XP_011022202.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022203.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022204.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
Length=937

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  WV++ L  Y+G   +GV + ++TRP  VNIG +L++ + IGKVAK A++AAVDDVN
Sbjct  1    MKLIWVLVLLVCYNGVCLDGVTTNVTTRPPFVNIGALLSYNTTIGKVAKVAIQAAVDDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGGTKL + M ++N SGFLGIVE+++FMETDTVAIIGPQ+SV AHVIS +ANELQ
Sbjct  61   SDPSVLGGTKLRLQMQNANQSGFLGIVESLKFMETDTVAIIGPQSSVTAHVISFVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLS+++TDPTLSSLQ+P+F+ TS NDL+ MAA+A IVDYY WREV+A
Sbjct  121  VPLLSYSSTDPTLSSLQFPYFIMTSRNDLYQMAAIAEIVDYYGWREVIA  169



>ref|XP_007203996.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
 gb|EMJ05195.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
Length=937

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+ + + FY+G    G ++ +STRP+ VN+G + +F S +GKVAK A+EAA++DVNS+P 
Sbjct  5    WLSVLMVFYNGVASNGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPA  64

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTK+ V M DSN SGFLGIVEA+RFME DTVAIIGPQ +V AH+ISH+ANELQVPLL
Sbjct  65   VLGGTKMIVQMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNAVTAHIISHIANELQVPLL  124

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+Y W+EV+A
Sbjct  125  SFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDHYGWKEVIA  169



>ref|XP_002306436.1| glutamate receptor family protein [Populus trichocarpa]
 gb|EEE93432.1| glutamate receptor family protein [Populus trichocarpa]
Length=937

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 141/169 (83%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  WV++ +  Y+G    GV + ++TRP  VNIG +L++ S IGKVAK A++AAVDDVN
Sbjct  1    MKLIWVLVLVVCYNGVCLNGVTTNVTTRPPFVNIGALLSYNSTIGKVAKVAIQAAVDDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGGTKL + M ++N+SGFLGIVE+++FMETDTVAIIGPQ+SV AHVIS +ANELQ
Sbjct  61   SDPSVLGGTKLRLQMQNTNNSGFLGIVESLKFMETDTVAIIGPQSSVTAHVISFVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLS+++TDPTLSSLQ+P+F+ TS NDL+ MAA+A IVDYY WREV+A
Sbjct  121  VPLLSYSSTDPTLSSLQFPYFIMTSRNDLYQMAAIAEIVDYYGWREVIA  169



>ref|XP_009359614.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359616.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359617.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359618.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
Length=937

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 142/176 (81%), Gaps = 1/176 (1%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaave  314
            +V +L M   W+ + + F +G    G ++T +STRPDVVN+G I +F + IGKVAK A+E
Sbjct  1    MVEQLTMSIVWLQVLMIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIE  60

Query  315  aavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVIS  494
            AAV+DVNS+P VLGGTK+ VT  DSN SG LGI+EA+RFME DT+AIIGPQ +V AHVIS
Sbjct  61   AAVEDVNSDPSVLGGTKMIVTKQDSNYSGLLGIIEALRFMEKDTIAIIGPQNAVTAHVIS  120

Query  495  HLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            H+ANELQVPL+SF+ TDPTLS+LQ+PFFVR++ NDL+ MAA+A +VDYY WREV+A
Sbjct  121  HIANELQVPLVSFSVTDPTLSALQFPFFVRSTQNDLYQMAAIAEMVDYYGWREVIA  176



>ref|XP_008241916.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241917.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241918.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
Length=937

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ + FY+G    G ++ +STRP+ VN+G + +F S +GKVAK A+EAA++DVNS+P 
Sbjct  5    WLLVLMVFYNGVASNGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPA  64

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTK+ V M DSN SGFLGIVE +RFME DTVAIIGPQ +V AH+ISH+ANELQVPLL
Sbjct  65   VLGGTKMIVQMQDSNYSGFLGIVEVLRFMEKDTVAIIGPQNAVTAHIISHIANELQVPLL  124

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+Y W+EV+A
Sbjct  125  SFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDHYGWKEVIA  169



>ref|XP_008241921.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Prunus mume]
Length=937

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ + FY+G    G ++ +STRP  VN+G + +F S +GKVAK A+EAA++DVNS+P 
Sbjct  5    WLLVLMVFYNGVASNGGSTNVSTRPKFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPA  64

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTK+ V M DSN SGFLGIVE +RFME DTVAIIGPQ +V AH+ISH+ANELQVPLL
Sbjct  65   VLGGTKMIVQMQDSNYSGFLGIVEVLRFMEKDTVAIIGPQNAVTAHIISHIANELQVPLL  124

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+Y W+EV+A
Sbjct  125  SFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDHYGWKEVIA  169



>ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=928

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            L +K F +++F+ F SG   +G     S+RP  VNIG I TF S IG+VAK A+E AV+D
Sbjct  3    LAIKAFLLLLFMVFCSGVFSDGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVED  62

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNSN  +LGGTKL + M +SN SGF+GIVEA++FMETDTVA++GPQ+SV+AHVISH++NE
Sbjct  63   VNSNSSILGGTKLAIKMQNSNCSGFVGIVEALQFMETDTVAVVGPQSSVLAHVISHVSNE  122

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            L+VPL+SFA TDPTLSSLQ+PFFVR + +DL+ M AVA IVDYY W+EVVA
Sbjct  123  LRVPLVSFAVTDPTLSSLQFPFFVRMTQSDLYQMTAVAEIVDYYGWKEVVA  173



>ref|XP_004134824.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=932

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+   +++ +  +SG    G  + +S RP+VVNIG + +F S IGKV K AVEAA++DVN
Sbjct  1    MRIVCILVLILLFSGSYSFGDGANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SNP ++GGTKL +++ D+N SGFLGI+E++RFMET T+AIIGPQ SV AHVISH+ANELQ
Sbjct  61   SNPSIMGGTKLKLSLHDTNYSGFLGIIESLRFMETKTMAIIGPQNSVTAHVISHIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF+ATDPTLSSLQ+PFF+RTS NDL+ MAAVA IVDY+ W+EV+A
Sbjct  121  VPLLSFSATDPTLSSLQFPFFIRTSQNDLYQMAAVAEIVDYFQWKEVIA  169



>ref|XP_004158839.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=943

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 138/169 (82%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+   +++ +  +SG    G  + +S RP+VVNIG + +F S IGKV K AVEAA++DVN
Sbjct  1    MRIVCILVLILLFSGSYSFGDGANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SNP ++GGTKL +++ D+N SGFLGI+E++RFMET T+AIIGPQ SV AHVISH+ANELQ
Sbjct  61   SNPSIMGGTKLKLSLHDTNYSGFLGIIESLRFMETKTMAIIGPQNSVTAHVISHIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF+ATDPTLSSLQ+PFF+RTS NDL+ MAAVA IVDY+ W+EV+A
Sbjct  121  VPLLSFSATDPTLSSLQFPFFIRTSQNDLYQMAAVAEIVDYFQWKEVIA  169



>ref|XP_010266353.1| PREDICTED: glutamate receptor 3.6-like [Nelumbo nucifera]
Length=881

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 134/169 (79%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W ++ L  Y   +  GV +  S+RP  VNIG IL+F S IGKVAK A+EAAV+DVN
Sbjct  1    MNMVWFLLHLVCYFVALSYGVYTNASSRPAYVNIGAILSFNSTIGKVAKIAIEAAVEDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  VLGGTKL +TM D+  SGFLGI+EA++FMETDTVAI+GPQ+SVI H+ISH+ANELQ
Sbjct  61   SNSAVLGGTKLVLTMQDTRYSGFLGILEALKFMETDTVAIVGPQSSVITHIISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPL+SFAATDPTLSSLQYPFFVR   NDLF MAAVA +VDYY W+EV A
Sbjct  121  VPLVSFAATDPTLSSLQYPFFVRAVXNDLFQMAAVAEVVDYYGWKEVTA  169



>ref|XP_007203104.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
 gb|EMJ04303.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
Length=937

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 137/165 (83%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ + FY+G      ++ +STRP+ VN+G + +F S +GKVAK A+EAA++DVNS+P 
Sbjct  5    WLLVLMVFYNGVASNRGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDPA  64

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTK+ V M DSN SGFLG+VEA+RFME DTVAIIGP+ +V AH+ISH+ANELQVPLL
Sbjct  65   VLGGTKMIVQMQDSNYSGFLGVVEALRFMEKDTVAIIGPENAVTAHIISHIANELQVPLL  124

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+Y W+EV+A
Sbjct  125  SFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDHYGWKEVIA  169



>ref|XP_007203235.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
 gb|EMJ04434.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
Length=927

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 135/166 (81%), Gaps = 1/166 (1%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            W ++ + FY G    G  ST +STRP+ VN+G + +F S +GKVAK A+EAA++DVNS+P
Sbjct  5    WPLVLMVFYKGVASNGGGSTNVSTRPEFVNVGAVFSFNSIVGKVAKVAIEAAIEDVNSDP  64

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             VLGGTK+ V M DSN SGFLGIVEA+RFME DTVAIIGPQ +V AH+I H+ANELQVPL
Sbjct  65   AVLGGTKMIVQMQDSNYSGFLGIVEALRFMEKDTVAIIGPQNAVTAHIICHIANELQVPL  124

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LSF+ TDPTLSSLQ+PFFVRT+ NDL  MAAVA+++D+Y W+EV+A
Sbjct  125  LSFSVTDPTLSSLQFPFFVRTTQNDLHQMAAVAAMIDHYGWKEVIA  170



>ref|XP_002276999.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
 ref|XP_010652906.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
Length=938

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W ++ + F +G +  GV + +S+RP VVNIG I +F S IGKVAK A+EAAV DVN
Sbjct  1    MKMVWFLLLMVFLNGIISNGVGTNVSSRPSVVNIGAIFSFNSTIGKVAKFALEAAVQDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGGTKL +   D+N SGF  I+EA++FME DTVAIIGPQ+SV+AHV+SH+ANELQ
Sbjct  61   SDPTVLGGTKLKLRTQDTNFSGFGAIMEALQFMEGDTVAIIGPQSSVMAHVVSHIANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPL+S+AATDPTL SLQYPFF+ T+ +DL+ MAA+A +VDYY WREV+A
Sbjct  121  VPLISYAATDPTLFSLQYPFFLMTTHSDLYQMAAIADLVDYYGWREVIA  169



>ref|XP_009369789.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369790.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369791.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369792.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=943

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaave  314
            +V +L M   W+++ + F SG+   G ++T +STRPDVVN+G I +F + IGKVAK A+E
Sbjct  1    MVEQLAMSIVWLLVLMIFCSGFASNGASTTNVSTRPDVVNLGAIFSFDTFIGKVAKVAIE  60

Query  315  aavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVIS  494
            AAV+DVNS+P VLGGTK+ VTM DSN SG LG++EA+RFME DT+AIIGP  +V AH++S
Sbjct  61   AAVEDVNSDPSVLGGTKMRVTMKDSNYSGLLGLIEALRFMEEDTMAIIGPLNAVTAHILS  120

Query  495  HLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ++ANEL VPL+SF+ TDPTLS+LQ+PFFVRT+ NDL+ MAA+A +VDYY WREV+A
Sbjct  121  NIANELLVPLVSFSVTDPTLSALQFPFFVRTAQNDLYQMAAIADMVDYYEWREVIA  176



>ref|XP_011022201.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Populus euphratica]
Length=965

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +3

Query  147  ELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavd  326
            ++ MK  WV++ L  Y+G   +GV + ++TRP  VNIG +L++ + IGKVAK A++AAVD
Sbjct  28   KITMKLIWVLVLLVCYNGVCLDGVTTNVTTRPPFVNIGALLSYNTTIGKVAKVAIQAAVD  87

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            DVNS+P VLGGTKL + M ++N SGFLGI  A++FMETDTVAIIGPQ+SV AHVIS +AN
Sbjct  88   DVNSDPSVLGGTKLRLQMQNANQSGFLGI--ALKFMETDTVAIIGPQSSVTAHVISFVAN  145

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ELQVPLLS+++TDPTLSSLQ+P+F+ TS NDL+ MAA+A IVDYY WREV+A
Sbjct  146  ELQVPLLSYSSTDPTLSSLQFPYFIMTSRNDLYQMAAIAEIVDYYGWREVIA  197



>ref|XP_007046473.1| Glutamate receptor 3.6 [Theobroma cacao]
 gb|EOX90630.1| Glutamate receptor 3.6 [Theobroma cacao]
Length=939

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 138/172 (80%), Gaps = 0/172 (0%)
 Frame = +3

Query  147  ELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavd  326
            +  M   W++  +  Y+G+   GV++ +STRP+VVNIG I +F S IGK AK AVEAA++
Sbjct  4    QFTMNIAWLLASMILYNGFPIIGVSTNVSTRPEVVNIGAIFSFQSVIGKAAKVAVEAAIE  63

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            D+NSNPD+L GTKLN+ + DSN SGFL +VEA+ FME DTVAIIGPQ+SV AHVISH+AN
Sbjct  64   DINSNPDILRGTKLNLQLKDSNYSGFLAMVEALLFMERDTVAIIGPQSSVTAHVISHIAN  123

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             L+VPLLSF++TDPTLS +Q+PFFVRT+ NDL+ MAA+A I+D++ WRE +A
Sbjct  124  ALRVPLLSFSSTDPTLSPIQFPFFVRTAQNDLYQMAAIAEIIDHFEWREAIA  175



>ref|XP_009359612.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Pyrus x bretschneideri]
Length=946

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 141/175 (81%), Gaps = 1/175 (1%)
 Frame = +3

Query  141  VIELKMKGFWVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaavea  317
            ++ L+   F + + + F +G    G ++T +STRPDVVN+G I +F + IGKVAK A+EA
Sbjct  11   ILFLESSCFSLKVLMIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEA  70

Query  318  avddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISH  497
            AV+DVNS+P VLGGTK+ VT  DSN SG LGI+EA+RFME DT+AIIGPQ +V AHVISH
Sbjct  71   AVEDVNSDPSVLGGTKMIVTKQDSNYSGLLGIIEALRFMEKDTIAIIGPQNAVTAHVISH  130

Query  498  LANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +ANELQVPL+SF+ TDPTLS+LQ+PFFVR++ NDL+ MAA+A +VDYY WREV+A
Sbjct  131  IANELQVPLVSFSVTDPTLSALQFPFFVRSTQNDLYQMAAIAEMVDYYGWREVIA  185



>ref|XP_009359613.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Pyrus x bretschneideri]
Length=942

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +3

Query  174  VMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            ++ + F +G    G ++T +STRPDVVN+G I +F + IGKVAK A+EAAV+DVNS+P V
Sbjct  18   LVLMIFCNGLASNGASTTNVSTRPDVVNLGAIFSFDTIIGKVAKVAIEAAVEDVNSDPSV  77

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGGTK+ VT  DSN SG LGI+EA+RFME DT+AIIGPQ +V AHVISH+ANELQVPL+S
Sbjct  78   LGGTKMIVTKQDSNYSGLLGIIEALRFMEKDTIAIIGPQNAVTAHVISHIANELQVPLVS  137

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            F+ TDPTLS+LQ+PFFVR++ NDL+ MAA+A +VDYY WREV+A
Sbjct  138  FSVTDPTLSALQFPFFVRSTQNDLYQMAAIAEMVDYYGWREVIA  181



>emb|CBI21566.3| unnamed protein product [Vitis vinifera]
Length=936

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 134/165 (81%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W ++ + F +G +  GV + +S+RP VVNIG I +F S IGKVAK A+EAAV DVNS+P 
Sbjct  3    WFLLLMVFLNGIISNGVGTNVSSRPSVVNIGAIFSFNSTIGKVAKFALEAAVQDVNSDPT  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTKL +   D+N SGF  I+EA++FME DTVAIIGPQ+SV+AHV+SH+ANELQVPL+
Sbjct  63   VLGGTKLKLRTQDTNFSGFGAIMEALQFMEGDTVAIIGPQSSVMAHVVSHIANELQVPLI  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            S+AATDPTL SLQYPFF+ T+ +DL+ MAA+A +VDYY WREV+A
Sbjct  123  SYAATDPTLFSLQYPFFLMTTHSDLYQMAAIADLVDYYGWREVIA  167



>ref|XP_008337900.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=929

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaave  314
            +V +L M   W ++ + F SG+   G ++T +STRPDVV +G I +F   IGKVAK A+E
Sbjct  1    MVEQLAMSIVWXLVXMIFCSGFASNGASTTNVSTRPDVVKLGAIFSFDXLIGKVAKVAIE  60

Query  315  aavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVIS  494
            AAV+DVNS+P VLGGTK+ VTM DSN SG LG++EA++FME DTVAIIGPQ S  AHVIS
Sbjct  61   AAVEDVNSDPSVLGGTKMKVTMQDSNYSGLLGLIEALQFMENDTVAIIGPQFSATAHVIS  120

Query  495  HLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            H+A+ELQVPLLSFAATDP LS  Q+PF VRT+ +DLF MAAVA +V YY WR+V+A
Sbjct  121  HIADELQVPLLSFAATDPXLSPNQFPFLVRTTRSDLFEMAAVADLVGYYEWRDVIA  176



>ref|XP_002521736.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF40723.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=769

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = +3

Query  183  LTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGT  362
            + F  G    GV    +TRP  +N+G I++F + +GKVA+ A++AAV+DVNSNP +LGGT
Sbjct  1    MVFNKGVTLNGV----TTRPRRLNVGAIMSFNTTVGKVARIAIKAAVNDVNSNPSILGGT  56

Query  363  KLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAAT  542
            +LN+ + D+N SGFLGI+EA+RFME DTVAIIGPQ+SV AHV+S +ANELQVPL+S++AT
Sbjct  57   ELNIKIQDTNYSGFLGIIEALRFMEGDTVAIIGPQSSVTAHVVSFVANELQVPLMSYSAT  116

Query  543  DPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            DPTLSSLQ+PFFVRTS NDLF MAAVA+IV+YY WREV+A
Sbjct  117  DPTLSSLQFPFFVRTSQNDLFQMAAVAAIVEYYGWREVIA  156



>ref|XP_003533409.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006587553.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006587554.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
 ref|XP_006587555.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Glycine max]
 gb|KHN38862.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 142/170 (84%), Gaps = 2/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+  W+++ + FY  +  +G+ S +STRP  VNIG +++F S +G+VAK A+EAAVDD+N
Sbjct  1    MRKVWLLVIVMFYHVFPSKGI-SNVSTRPSTVNIGALMSFNSTVGRVAKVAIEAAVDDIN  59

Query  336  SNPDVLGGTKLNVTMLDSN-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            SN  +L GTKLN++MLD+  S+GFLGI++++R ME DTVAIIGPQ SV+AHVISH+ANE+
Sbjct  60   SNATILNGTKLNISMLDTKLSTGFLGIIDSLRLMEKDTVAIIGPQFSVMAHVISHIANEM  119

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPLLSFAATDPTL+SLQ+P+FVRT+ +DL+ MAAVA IVD++ WR+V+A
Sbjct  120  QVPLLSFAATDPTLTSLQFPYFVRTTQSDLYQMAAVAEIVDHFQWRDVIA  169



>ref|XP_009392853.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=915

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  177  MFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLG  356
            +F   +S  +  G   ++S+RP VV++G I TF S IG+VAK A++AA  DVNS+P VL 
Sbjct  8    LFFCLFS--ITSGATRSVSSRPAVVHVGAIFTFNSTIGRVAKVAIDAAKQDVNSDPTVLR  65

Query  357  GTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFA  536
            GT+L++TM ++N SGF G++EA++FMETDTVAI+GPQ S IAHVISHLANEL VPLLSF+
Sbjct  66   GTRLDITMRNTNCSGFFGMMEALQFMETDTVAIVGPQCSTIAHVISHLANELHVPLLSFS  125

Query  537  ATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ATDPTL++L+YP+FVRTS +DLF MAA+A IVDYY WR+V+A
Sbjct  126  ATDPTLTALEYPYFVRTSQSDLFQMAAIAKIVDYYQWRQVIA  167



>ref|XP_009392852.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392854.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=941

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 132/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  177  MFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLG  356
            +F   +S  +  G   ++S+RP VV++G I TF S IG+VAK A++AA  DVNS+P VL 
Sbjct  34   LFFCLFS--ITSGATRSVSSRPAVVHVGAIFTFNSTIGRVAKVAIDAAKQDVNSDPTVLR  91

Query  357  GTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFA  536
            GT+L++TM ++N SGF G++EA++FMETDTVAI+GPQ S IAHVISHLANEL VPLLSF+
Sbjct  92   GTRLDITMRNTNCSGFFGMMEALQFMETDTVAIVGPQCSTIAHVISHLANELHVPLLSFS  151

Query  537  ATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ATDPTL++L+YP+FVRTS +DLF MAA+A IVDYY WR+V+A
Sbjct  152  ATDPTLTALEYPYFVRTSQSDLFQMAAIAKIVDYYQWRQVIA  193



>ref|XP_007018097.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 ref|XP_007018098.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 gb|EOY15322.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 gb|EOY15323.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
Length=843

 Score =   194 bits (494),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W ++ L+ + G    G     STRP VVNIG I +F + +G+VAK A+  AV DVN
Sbjct  1    MNAAWFLLLLSLHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL VTM DSN SGF+G+VEA+++METD VAIIGPQ +V+AH+ISH+ANELQ
Sbjct  61   SNLSILQGTKLAVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCAVVAHIISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFA TDPTLSSLQ+PFFVRT+ +DL+ M AVA IV++Y W+EV+A
Sbjct  121  VPLLSFAVTDPTLSSLQFPFFVRTTQSDLYQMTAVAEIVEHYGWKEVIA  169



>ref|XP_011465033.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3 [Fragaria 
vesca subsp. vesca]
Length=942

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 135/174 (78%), Gaps = 0/174 (0%)
 Frame = +3

Query  141  VIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaa  320
            ++  KM+  WV   +  Y G    G +  +S+RP VVNIG + T  S IGKVAK A+E A
Sbjct  1    MLSFKMELVWVCPLVVLYLGVFSFGSSKNVSSRPAVVNIGALFTMDSTIGKVAKIAIEEA  60

Query  321  vddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHL  500
            V DVNSN  +L GTKL V M ++N SGFLG+VEA++FMETD VAIIGPQ+SV+AH++SH+
Sbjct  61   VKDVNSNFSILHGTKLVVKMQNTNCSGFLGMVEALQFMETDIVAIIGPQSSVVAHIVSHV  120

Query  501  ANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ANELQVPLLSFAATDPTLSSLQ+P+F+RT+ +DL+ M AVA IVD+Y WR+V+A
Sbjct  121  ANELQVPLLSFAATDPTLSSLQFPYFIRTTQSDLYQMTAVAQIVDHYGWRDVIA  174



>ref|XP_002272859.2| PREDICTED: glutamate receptor 3.3 [Vitis vinifera]
Length=964

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 133/173 (77%), Gaps = 0/173 (0%)
 Frame = +3

Query  144  IELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaav  323
            I LKM   W++  L    G +  G    LS+RP VVN+G + TF S IG+VAK A+E AV
Sbjct  27   IHLKMNVIWLLSLLFLCFGVLSNGSQKNLSSRPAVVNVGAVFTFESTIGRVAKIAIEEAV  86

Query  324  ddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLA  503
             DVNS+  VL GTK  +TM +SN SGF+G++ A++FMET+T+AIIGPQ+SV+AH+ISH+A
Sbjct  87   KDVNSDAGVLTGTKFVLTMRNSNCSGFIGMIGALQFMETETIAIIGPQSSVVAHMISHVA  146

Query  504  NELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            NELQVPLLSFAATDPTLSSLQ+PFFVRT+ +DL+ M A+  +VDYY WR V+A
Sbjct  147  NELQVPLLSFAATDPTLSSLQFPFFVRTTQSDLYQMKAITELVDYYGWRSVIA  199



>ref|XP_009359611.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=923

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            +++F+ FY G    G+N T ++ RPDVVN+G I TF S IGK+AK A+  AV+DVNSNP+
Sbjct  6    LLLFMVFYKGSSTSGLNPTNVTARPDVVNVGAIFTFDSVIGKIAKLAITLAVEDVNSNPE  65

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L GTKL + M ++ SS FLGI+EA++FME DTVAIIGPQ S  AHVISH+A+ELQVPLL
Sbjct  66   ILNGTKLALKMQNTKSSDFLGIIEALQFMENDTVAIIGPQFSATAHVISHIADELQVPLL  125

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SFAATDPTLS  Q+PF VRT+ +DLF MAAVA +V YY WR+V+A
Sbjct  126  SFAATDPTLSPNQFPFLVRTTRSDLFEMAAVADLVGYYEWRDVIA  170



>ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
 gb|EOY15324.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
Length=870

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W ++ L+ + G    G     STRP VVNIG I +F + +G+VAK A+  AV DVN
Sbjct  1    MNAAWFLLLLSLHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL VTM DSN SGF+G+VEA+++METD VAIIGPQ +V+AH+ISH+ANELQ
Sbjct  61   SNLSILQGTKLAVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCAVVAHIISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFA TDPTLSSLQ+PFFVRT+ +DL+ M AVA IV++Y W+EV+A
Sbjct  121  VPLLSFAVTDPTLSSLQFPFFVRTTQSDLYQMTAVAEIVEHYGWKEVIA  169



>ref|XP_008440927.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Cucumis melo]
Length=900

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +3

Query  222  STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSG  401
            + +S RP+VVNIG + +F S IGKV K AVEAA++DVNS+P +LG TKLN+++ D+N SG
Sbjct  27   ANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVNSDPSILGVTKLNLSLHDTNYSG  86

Query  402  FLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFV  581
            FLGI+E++RFMET T+AIIGPQ SV AHVISH+ANE+QVPLLSF+ATDPTLSSLQ+PFF+
Sbjct  87   FLGIIESLRFMETKTMAIIGPQNSVTAHVISHIANEVQVPLLSFSATDPTLSSLQFPFFI  146

Query  582  RTSPNDLFXMAAVASIVDYYXWREVVA  662
            RTS NDL+ MAAVA IVDY+ W+EV+A
Sbjct  147  RTSQNDLYQMAAVAEIVDYFQWKEVIA  173



>ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 ref|XP_007018095.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15319.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15320.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
Length=933

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W ++ L+ + G    G     STRP VVNIG I +F + +G+VAK A+  AV DVN
Sbjct  1    MNAAWFLLLLSLHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL VTM DSN SGF+G+VEA+++METD VAIIGPQ +V+AH+ISH+ANELQ
Sbjct  61   SNLSILQGTKLAVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCAVVAHIISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFA TDPTLSSLQ+PFFVRT+ +DL+ M AVA IV++Y W+EV+A
Sbjct  121  VPLLSFAVTDPTLSSLQFPFFVRTTQSDLYQMTAVAEIVEHYGWKEVIA  169



>ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
 gb|EOY15321.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
Length=941

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W ++ L+ + G    G     STRP VVNIG I +F + +G+VAK A+  AV DVN
Sbjct  1    MNAAWFLLLLSLHFGVFKIGYGRNASTRPPVVNIGAIFSFDTTVGRVAKIAINEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL VTM DSN SGF+G+VEA+++METD VAIIGPQ +V+AH+ISH+ANELQ
Sbjct  61   SNLSILQGTKLAVTMQDSNCSGFVGMVEALQYMETDVVAIIGPQCAVVAHIISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFA TDPTLSSLQ+PFFVRT+ +DL+ M AVA IV++Y W+EV+A
Sbjct  121  VPLLSFAVTDPTLSSLQFPFFVRTTQSDLYQMTAVAEIVEHYGWKEVIA  169



>ref|XP_008440920.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440921.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440922.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440924.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440925.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440926.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
Length=938

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +3

Query  222  STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSG  401
            + +S RP+VVNIG + +F S IGKV K AVEAA++DVNS+P +LG TKLN+++ D+N SG
Sbjct  27   ANVSPRPEVVNIGALFSFRSMIGKVGKIAVEAAIEDVNSDPSILGVTKLNLSLHDTNYSG  86

Query  402  FLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFV  581
            FLGI+E++RFMET T+AIIGPQ SV AHVISH+ANE+QVPLLSF+ATDPTLSSLQ+PFF+
Sbjct  87   FLGIIESLRFMETKTMAIIGPQNSVTAHVISHIANEVQVPLLSFSATDPTLSSLQFPFFI  146

Query  582  RTSPNDLFXMAAVASIVDYYXWREVVA  662
            RTS NDL+ MAAVA IVDY+ W+EV+A
Sbjct  147  RTSQNDLYQMAAVAEIVDYFQWKEVIA  173



>ref|XP_008241924.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=922

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +3

Query  159  KGFWVVMFLTFYSGYVCEGVNSTLST-RPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            K  WV++F+ FY+G    G+ + ++T RPDVVNIG I TF S IGK+AK A+  A++DVN
Sbjct  3    KTLWVMLFMVFYNGASSNGLGANVTTARPDVVNIGAIFTFDSVIGKIAKVAIALAIEDVN  62

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P++L GTKL + M ++ SS FLGI+EA++F+E DTVAIIGPQ S  AHVISH+A+EL+
Sbjct  63   SDPEILNGTKLTLKMQNTKSSDFLGIIEALQFLENDTVAIIGPQFSATAHVISHIADELK  122

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFAATDPTLS  Q+PF VRT+ +DLF M AVA +V YY WR+V+A
Sbjct  123  VPLLSFAATDPTLSPTQFPFLVRTTRSDLFQMTAVADLVFYYEWRDVIA  171



>gb|KCW56490.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=944

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+V  L   SG    G ++  S RP+ VN+G + +  + IG VAK AV AAV+DVNS+P 
Sbjct  9    WLVALLVLQSGSGLFGASTNASARPEFVNVGGVFSVNTLIGSVAKVAVLAAVEDVNSDPS  68

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTKL V + D+N SGFLGIVEA++FME+DTVAIIGPQ SV AHVISH+ANELQVPLL
Sbjct  69   VLGGTKLKVMIHDTNYSGFLGIVEALQFMESDTVAIIGPQTSVTAHVISHIANELQVPLL  128

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPTL+SLQ+P+F+RT+ NDLF MA +A++V++Y WREV A
Sbjct  129  SFSATDPTLASLQFPYFIRTAQNDLFQMATIAAMVEFYGWREVTA  173



>ref|XP_010029575.1| PREDICTED: glutamate receptor 3.6 [Eucalyptus grandis]
 gb|KCW56489.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=942

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+V  L   SG    G ++  S RP+ VN+G + +  + IG VAK AV AAV+DVNS+P 
Sbjct  9    WLVALLVLQSGSGLFGASTNASARPEFVNVGGVFSVNTLIGSVAKVAVLAAVEDVNSDPS  68

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGGTKL V + D+N SGFLGIVEA++FME+DTVAIIGPQ SV AHVISH+ANELQVPLL
Sbjct  69   VLGGTKLKVMIHDTNYSGFLGIVEALQFMESDTVAIIGPQTSVTAHVISHIANELQVPLL  128

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPTL+SLQ+P+F+RT+ NDLF MA +A++V++Y WREV A
Sbjct  129  SFSATDPTLASLQFPYFIRTAQNDLFQMATIAAMVEFYGWREVTA  173



>ref|XP_004287716.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461501.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461505.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461509.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461513.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
Length=940

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ +  ++G    G  +T S RP++VN+G +L + S +GKVAK A+EAAV DVNS+P 
Sbjct  11   WLLLLMVLFNGCASHGATNT-SRRPEIVNVGAMLAYNSIVGKVAKLALEAAVADVNSDPS  69

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L GTK+ V M +SN SGFLGI+EA+RFME DTVAIIGP  +V AHVISH+ANELQ PLL
Sbjct  70   ILNGTKMVVGMQNSNFSGFLGIIEALRFMEKDTVAIIGPHNAVTAHVISHIANELQTPLL  129

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF  TDPTLSSLQ+P+FVRT+ NDLF MAA+A ++DYY W+EV+A
Sbjct  130  SFTVTDPTLSSLQFPYFVRTTQNDLFQMAAIADMIDYYGWKEVIA  174



>gb|AAR27949.1| GLR3.3 [Arabidopsis thaliana]
Length=933

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGV-NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W   FL+F    +C G+   T S +P VV IG I +F S IGKVAK A++ AV DV
Sbjct  1    MKQLWTFFFLSF----LCSGLFRRTHSEKPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GTK +V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILSGTKFSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +VPLLSFA TDP +S LQ+P+F+RT+ +DL+ M A+ASIVD+Y W+EV+A
Sbjct  117  RVPLLSFAVTDPVMSPLQFPYFIRTTQSDLYQMDAIASIVDFYGWKEVIA  166



>ref|NP_174978.1| glutamate receptor 3.3 [Arabidopsis thaliana]
 sp|Q9C8E7.1|GLR33_ARATH RecName: Full=Glutamate receptor 3.3; AltName: Full=Ligand-gated 
ion channel 3.3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51316.1|AC025815_3 ligand-gated ion channel, putative [Arabidopsis thaliana]
 gb|AEE31925.1| glutamate receptor 3.3 [Arabidopsis thaliana]
Length=933

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGV-NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W   FL+F    +C G+   T S +P VV IG I +F S IGKVAK A++ AV DV
Sbjct  1    MKQLWTFFFLSF----LCSGLFRRTHSEKPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GTK +V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILSGTKFSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +VPLLSFA TDP +S LQ+P+F+RT+ +DL+ M A+ASIVD+Y W+EV+A
Sbjct  117  RVPLLSFAVTDPVMSPLQFPYFIRTTQSDLYQMDAIASIVDFYGWKEVIA  166



>ref|XP_010103244.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXB95115.1| Glutamate receptor 3.6 [Morus notabilis]
Length=1034

 Score =   193 bits (491),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 145/201 (72%), Gaps = 1/201 (0%)
 Frame = +3

Query  60   RRKYGGRLPLPLFIK*KLAFRVKSGGLVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTR  239
            RR+Y G     +++   + F  ++   VI   M   W+++ + F +G + + ++  +STR
Sbjct  69   RRRYLGFTKQAVYVS-FIFFTKQAAVRVINTNMNIVWLLLLIVFCNGILSDAISHNVSTR  127

Query  240  PDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVE  419
            P+VV +G ++ F S IGK+AK A+ AAV+DVNSN  +L GT L V M D+ +S FLGIVE
Sbjct  128  PEVVRVGALICFDSMIGKIAKLAITAAVEDVNSNSTILKGTVLKVAMQDTKTSDFLGIVE  187

Query  420  AMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPND  599
            A+RFME DTVAIIGPQ SV AHVISH+ANELQVPLLSFAATD TL+ LQ+P+FVRT+ +D
Sbjct  188  ALRFMENDTVAIIGPQFSVTAHVISHIANELQVPLLSFAATDSTLAPLQFPYFVRTTQSD  247

Query  600  LFXMAAVASIVDYYXWREVVA  662
             F M+AVA +V YY WR+VVA
Sbjct  248  AFQMSAVAELVGYYEWRDVVA  268



>ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=944

 Score =   192 bits (489),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  207  CEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLD  386
            C G     S+RP  VNIG I TF S IG+VAK A+E AV+DVNSN  +LGGTKL + M +
Sbjct  38   CYGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGGTKLAIKMQN  97

Query  387  SNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQ  566
            SN SGF+GIVEA++FMETDTVA++GPQ+SV+AHVISH++NEL+VPL+SFA TDPTLSSLQ
Sbjct  98   SNCSGFVGIVEALQFMETDTVAVVGPQSSVLAHVISHVSNELRVPLVSFAVTDPTLSSLQ  157

Query  567  YPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +PFFVR + +DL+ M AVA IVDYY W+EVVA
Sbjct  158  FPFFVRMTQSDLYQMTAVAEIVDYYGWKEVVA  189



>ref|XP_007156250.1| hypothetical protein PHAVU_003G270600g [Phaseolus vulgaris]
 gb|ESW28244.1| hypothetical protein PHAVU_003G270600g [Phaseolus vulgaris]
Length=819

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M+  W ++ + FY G+   G++S    RP +VN+G +L+F S +G+VAK A+EAAVDDVN
Sbjct  1    MRKIWFLVLVMFYHGFPSMGISSVYG-RPRIVNVGALLSFNSTVGRVAKVAIEAAVDDVN  59

Query  336  SNPDVLGGTKLNVTMLDSN-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            S+P +L GTKL +  LD+  S+GFLGIV+++R ME DTVAIIGPQ SV+AHVISH+ANE+
Sbjct  60   SDPTILNGTKLKILTLDTKLSAGFLGIVDSLRLMENDTVAIIGPQFSVMAHVISHIANEM  119

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPLLSFAATDPTL+SLQ+P+FVRT+ +DL+ M AVA IVD++ WR+V+A
Sbjct  120  QVPLLSFAATDPTLTSLQFPYFVRTTQSDLYQMTAVAEIVDHFQWRDVIA  169



>ref|XP_010266235.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=916

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  201  YVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTM  380
            +  +G     S+RP  VNIG I TF S IG+VAK A+E AV+DVNSN  +LGGTKL + M
Sbjct  39   FFSDGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGGTKLAIKM  98

Query  381  LDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSS  560
             +SN SGF+GIVEA++FMETDTVA++GPQ+SV+AHVISH++NEL+VPL+SFA TDPTLSS
Sbjct  99   QNSNCSGFVGIVEALQFMETDTVAVVGPQSSVLAHVISHVSNELRVPLVSFAVTDPTLSS  158

Query  561  LQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQ+PFFVR + +DL+ M AVA IVDYY W+EVVA
Sbjct  159  LQFPFFVRMTQSDLYQMTAVAEIVDYYGWKEVVA  192



>ref|XP_010266230.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010266231.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=947

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +3

Query  201  YVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTM  380
            +  +G     S+RP  VNIG I TF S IG+VAK A+E AV+DVNSN  +LGGTKL + M
Sbjct  39   FFSDGNKGQASSRPSAVNIGAIFTFDSTIGRVAKIAMELAVEDVNSNSSILGGTKLAIKM  98

Query  381  LDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSS  560
             +SN SGF+GIVEA++FMETDTVA++GPQ+SV+AHVISH++NEL+VPL+SFA TDPTLSS
Sbjct  99   QNSNCSGFVGIVEALQFMETDTVAVVGPQSSVLAHVISHVSNELRVPLVSFAVTDPTLSS  158

Query  561  LQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQ+PFFVR + +DL+ M AVA IVDYY W+EVVA
Sbjct  159  LQFPFFVRMTQSDLYQMTAVAEIVDYYGWKEVVA  192



>ref|XP_002891241.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67500.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=937

 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 131/170 (77%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGV-NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W ++FL+     +C G+     S +P VV IG I +F S IGKVAK A++ AV DV
Sbjct  1    MKQLWALLFLS----CLCTGLFTKAHSEKPKVVKIGSIFSFDSVIGKVAKIAIDEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GTKL+V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILRGTKLSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             VPLLSFA TDP +S LQ+P+F+RT+ +DL+ M A+ASIVD+Y W+EV+A
Sbjct  117  HVPLLSFAVTDPVMSPLQFPYFIRTTQSDLYQMDAIASIVDFYGWKEVIA  166



>emb|CBI40741.3| unnamed protein product [Vitis vinifera]
Length=934

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W++  L    G +  G    LS+RP VVN+G + TF S IG+VAK A+E AV DVN
Sbjct  1    MNVIWLLSLLFLCFGVLSNGSQKNLSSRPAVVNVGAVFTFESTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+  VL GTK  +TM +SN SGF+G++ A++FMET+T+AIIGPQ+SV+AH+ISH+ANELQ
Sbjct  61   SDAGVLTGTKFVLTMRNSNCSGFIGMIGALQFMETETIAIIGPQSSVVAHMISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFAATDPTLSSLQ+PFFVRT+ +DL+ M A+  +VDYY WR V+A
Sbjct  121  VPLLSFAATDPTLSSLQFPFFVRTTQSDLYQMKAITELVDYYGWRSVIA  169



>emb|CDY70557.1| BnaC08g46160D, partial [Brassica napus]
Length=533

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 130/170 (76%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEG-VNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W  +FL+     +C G +    S +P+VV IG I +F S IGKVAK A+E AV DV
Sbjct  1    MKLLWSFLFLSC----LCLGFLGHGYSEKPEVVKIGSIFSFNSVIGKVAKIAIEEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GT+L V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILVGTRLQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +VPLLSFA TDP +S LQ+P+F+RTS +DL+ M A+ASIVD Y W+EV+A
Sbjct  117  RVPLLSFAVTDPVMSPLQFPYFIRTSQSDLYQMEAIASIVDLYGWKEVIA  166



>gb|AET03597.2| glutamate receptor 3.2 [Medicago truncatula]
Length=936

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++ + FY+    + + S +S RP  +NIG IL+F S IG+VAK A+EAAVDD+N
Sbjct  1    MNKVWLLVLMMFYNSLPIKTI-SNVSARPSTINIGAILSFNSTIGRVAKVAIEAAVDDIN  59

Query  336  SNPDVLGGTKLNVTMLDSNSS-GFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            SNP VL GTKLN++MLD+ SS GFLGIV+++  ME +TVAIIGPQ SV+AHVISH+ANE+
Sbjct  60   SNPKVLSGTKLNISMLDTKSSPGFLGIVDSLLLMEKETVAIIGPQFSVMAHVISHIANEM  119

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVP+LSFAATDPTL+SL++P+FVRT+ +DL  MAAVA IVD++ WR+V+A
Sbjct  120  QVPILSFAATDPTLTSLEFPYFVRTTQSDLNQMAAVADIVDHFQWRDVIA  169



>ref|XP_008786666.1| PREDICTED: glutamate receptor 3.1 [Phoenix dactylifera]
Length=921

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            GV   +S+RP VVNIG + TF S IG+VAK A+++AVDDVNS+P VL GTKL + M DS+
Sbjct  19   GVGRNISSRPAVVNIGALFTFNSTIGRVAKVAIDSAVDDVNSDPGVLQGTKLVIDMEDSS  78

Query  393  SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYP  572
             +GFLG+VEA++FME + VA++GPQ+SV+AHVIS++ANELQVPLLSFAATDPTLSSL+YP
Sbjct  79   CNGFLGMVEALQFMEKEIVAVVGPQSSVLAHVISYVANELQVPLLSFAATDPTLSSLEYP  138

Query  573  FFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FFVRT+ +DLF MAA+A +VDYY W+ V+A
Sbjct  139  FFVRTTESDLFQMAAIAELVDYYRWKRVIA  168



>emb|CDY68928.1| BnaA08g29720D, partial [Brassica napus]
Length=533

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/170 (59%), Positives = 130/170 (76%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEG-VNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W  +FL+     +C G +    S +P+VV IG I +F S IG+VAK A+E AV DV
Sbjct  1    MKLLWSFLFLSC----LCLGFLGHGHSEKPEVVKIGSIFSFNSVIGRVAKIAIEEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GT+L V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILVGTRLQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +VPLLSFA TDP +S LQ+P+F+RTS +DL+ M A+ASIVD Y W+EV+A
Sbjct  117  RVPLLSFAVTDPVMSPLQFPYFIRTSQSDLYQMEAIASIVDLYGWKEVIA  166



>gb|KHG10460.1| Glutamate receptor 3.6 -like protein [Gossypium arboreum]
Length=947

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 127/155 (82%), Gaps = 2/155 (1%)
 Frame = +3

Query  204  VCEGV--NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            VC G+  N+ +S RP VVNIG I +F + IGK AK A+E A++DVNSNPD+L GTKL + 
Sbjct  21   VCNGLPLNANVSGRPAVVNIGAIFSFKTVIGKAAKIAIETAIEDVNSNPDILPGTKLILQ  80

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            M DSN SGF+ +VEA+ FME DTVAIIGPQ+SV AHVISH+AN L+VPLLSF++TDPTLS
Sbjct  81   MKDSNYSGFMAVVEALLFMERDTVAIIGPQSSVTAHVISHIANVLRVPLLSFSSTDPTLS  140

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             +Q+PFFVRT+ NDL+ M+A+A I+D+Y WREV+A
Sbjct  141  PIQFPFFVRTAQNDLYQMSAIAEIIDHYEWREVIA  175



>ref|XP_007156251.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
 gb|ESW28245.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
Length=738

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  FYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKL  368
            FYSG+  +G+ S++STRP  VNIG IL+F S IG+VAK A++AAVDDVNS+  +L GTKL
Sbjct  12   FYSGFPSKGI-SSVSTRPRAVNIGAILSFNSRIGRVAKVAIQAAVDDVNSDATILNGTKL  70

Query  369  NVTMLDSN-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATD  545
             ++MLD+  S+GFLGI+++   ME +TVAIIGPQ SV+AHVISH+ANE+QVPLLSFAATD
Sbjct  71   KISMLDTKLSTGFLGIIDSFLLMERETVAIIGPQYSVMAHVISHIANEMQVPLLSFAATD  130

Query  546  PTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PTL+SLQ+P+FVRT+ +DL+ MAAVA I D++ WR+V+A
Sbjct  131  PTLTSLQFPYFVRTTQSDLYQMAAVAEIADHFQWRDVIA  169



>ref|XP_007156252.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
 gb|ESW28246.1| hypothetical protein PHAVU_003G270800g [Phaseolus vulgaris]
Length=906

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  FYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKL  368
            FYSG+  +G+ S++STRP  VNIG IL+F S IG+VAK A++AAVDDVNS+  +L GTKL
Sbjct  12   FYSGFPSKGI-SSVSTRPRAVNIGAILSFNSRIGRVAKVAIQAAVDDVNSDATILNGTKL  70

Query  369  NVTMLDSN-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATD  545
             ++MLD+  S+GFLGI+++   ME +TVAIIGPQ SV+AHVISH+ANE+QVPLLSFAATD
Sbjct  71   KISMLDTKLSTGFLGIIDSFLLMERETVAIIGPQYSVMAHVISHIANEMQVPLLSFAATD  130

Query  546  PTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PTL+SLQ+P+FVRT+ +DL+ MAAVA I D++ WR+V+A
Sbjct  131  PTLTSLQFPYFVRTTQSDLYQMAAVAEIADHFQWRDVIA  169



>ref|XP_007046475.1| Glutamate receptor isoform 2 [Theobroma cacao]
 gb|EOX90632.1| Glutamate receptor isoform 2 [Theobroma cacao]
Length=662

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M    +++F+ F S +   G +  ++TRPDVVNIG + +F S +GKVA+ A+EAA++DVN
Sbjct  1    MNKVGILVFVLFSSEFFPFGNSVNVTTRPDVVNIGALFSFNSTVGKVARVAIEAALEDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S P VL GTKL +TM D+N SGFLGIVEA++ M+ +TVAIIGPQ SV AH++SH+ANEL 
Sbjct  61   SEPGVLNGTKLKLTMQDTNYSGFLGIVEALKLMQNETVAIIGPQLSVTAHLVSHIANELH  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLS AATDP LSSLQY FFVRT+ +DLF MAA+A I++YY WR V+A
Sbjct  121  VPLLSCAATDPALSSLQYRFFVRTTQSDLFQMAAIADIIEYYEWRNVIA  169



>ref|XP_010266236.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266237.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266238.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
Length=928

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 128/165 (78%), Gaps = 5/165 (3%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+V     Y G +  G       RP V+NIG I TF +  G+VAK A++AAVDDVNS+P 
Sbjct  5    WLVPLSILYFGVLSNG-----GPRPSVLNIGAIFTFNTINGRVAKIAMKAAVDDVNSDPS  59

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VLGG+KL +T+ DSN SGF GI+ A+++ME DTVAIIGPQ S++AHVISHLANELQVPLL
Sbjct  60   VLGGSKLVLTLHDSNYSGFSGIIGALQYMEMDTVAIIGPQNSIMAHVISHLANELQVPLL  119

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF A DPTLSSLQYPFFV+T+PNDLF M+A+A IV YY WREV+A
Sbjct  120  SFTALDPTLSSLQYPFFVQTAPNDLFQMSAIAEIVSYYGWREVIA  164



>ref|XP_008237957.1| PREDICTED: glutamate receptor 3.3 [Prunus mume]
Length=945

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaavea  317
            L    KM   W  + L  Y G      ++ +S+RP VVNIG I TF S IGKVAK A+E 
Sbjct  3    LCWSFKMNLIWFFLLLFLYLGVFSCVSSNNVSSRPAVVNIGAIFTFDSTIGKVAKLAIEE  62

Query  318  avddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISH  497
            AV DVNSN  VL GTKL V M +SN SGF G+V+A++FMETD VAIIGPQ+SV+AH+ISH
Sbjct  63   AVKDVNSNFSVLHGTKLAVKMRNSNCSGFGGMVQALQFMETDIVAIIGPQSSVVAHIISH  122

Query  498  LANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +ANELQVPLLSFAATDPTLSSLQ+PFFVRT+ +DL+ M+AVA IVD+Y W+EV+A
Sbjct  123  VANELQVPLLSFAATDPTLSSLQFPFFVRTTHSDLYQMSAVAQIVDHYGWKEVIA  177



>ref|XP_007046474.1| Glutamate receptor isoform 1 [Theobroma cacao]
 gb|EOX90631.1| Glutamate receptor isoform 1 [Theobroma cacao]
Length=932

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M    +++F+ F S +   G +  ++TRPDVVNIG + +F S +GKVA+ A+EAA++DVN
Sbjct  1    MNKVGILVFVLFSSEFFPFGNSVNVTTRPDVVNIGALFSFNSTVGKVARVAIEAALEDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S P VL GTKL +TM D+N SGFLGIVEA++ M+ +TVAIIGPQ SV AH++SH+ANEL 
Sbjct  61   SEPGVLNGTKLKLTMQDTNYSGFLGIVEALKLMQNETVAIIGPQLSVTAHLVSHIANELH  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLS AATDP LSSLQY FFVRT+ +DLF MAA+A I++YY WR V+A
Sbjct  121  VPLLSCAATDPALSSLQYRFFVRTTQSDLFQMAAIADIIEYYEWRNVIA  169



>ref|XP_006855692.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
 gb|ERN17159.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
Length=936

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 126/167 (75%), Gaps = 2/167 (1%)
 Frame = +3

Query  162  GFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSN  341
              WV++ L F       G+N  +S RP VVN+G I +F SPIG V K A++AA  DVN++
Sbjct  5    ALWVLLVLWFVFSGNAMGLN--ISPRPSVVNVGAIFSFKSPIGSVEKIAIKAAEKDVNAD  62

Query  342  PDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVP  521
              VL GTKL +TM D+  S F+ IVEA++FMETDTVAIIGPQ SV AHVISH+ANELQVP
Sbjct  63   SSVLNGTKLVITMQDAAGSYFVAIVEALQFMETDTVAIIGPQTSVTAHVISHVANELQVP  122

Query  522  LLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LLSFAA DPTL+SLQYPFF +T+PND F M A+A +VDY+ +REV+A
Sbjct  123  LLSFAAKDPTLNSLQYPFFFQTAPNDQFEMTAIADVVDYFQYREVIA  169



>ref|XP_010240316.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240317.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240318.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240319.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
 ref|XP_010240320.1| PREDICTED: glutamate receptor 3.1-like [Brachypodium distachyon]
Length=941

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = +3

Query  183  LTFYSGYVC---EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVL  353
            L F+  + C     ++  +S RPD V+IG + TF S IG+VAK A+ AAV+D+N +P +L
Sbjct  5    LHFWGIFCCLCSYALSKNVSARPDEVSIGALFTFNSTIGRVAKVAISAAVNDINDDPSIL  64

Query  354  GGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSF  533
             GTKL V M DSN SGF+GIV+A++FME DTVAI+GPQ+SV+AH+ISH+ANELQVP++SF
Sbjct  65   PGTKLVVQMQDSNCSGFVGIVQALQFMEKDTVAIVGPQSSVLAHIISHVANELQVPMMSF  124

Query  534  AATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            AATDPTLSSLQ+PFFVRT+ +D F MA+VA +VDYY W++V A
Sbjct  125  AATDPTLSSLQFPFFVRTTHSDHFQMASVADLVDYYGWKQVTA  167



>ref|XP_010110512.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXC26730.1| Glutamate receptor 3.6 [Morus notabilis]
Length=961

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLST--RPDVVNIGCILTFISPIGkvakaaveaavddvNSN  341
            W ++ +  ++     GV + +S+  RP +VNIG I +  S IG+VAK A+EAA++DVNS+
Sbjct  44   WYLVLMVLHNCLASTGVGTNVSSSVRPSIVNIGAIFSLNSLIGRVAKVAIEAAIEDVNSD  103

Query  342  PDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVP  521
            P VL GTKL +TM DSN SGFLGI+EA+RFME DTVAIIGPQ +  AHVI+H+ANELQ P
Sbjct  104  PSVLRGTKLKITMQDSNYSGFLGIIEALRFMEKDTVAIIGPQNAATAHVIAHIANELQTP  163

Query  522  LLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +LSF+  DPTL+ LQ+PFFVRT+ +D F MAA+A +VDYY WREV+A
Sbjct  164  MLSFSVADPTLTPLQFPFFVRTTQSDEFQMAAIAEMVDYYGWREVIA  210



>gb|KJB17458.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
Length=645

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  204  VCEGV--NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            VC G+   + +S RP VVNIG I +F + IGK AK A+E A++DVNSNPD+L GTKL + 
Sbjct  22   VCNGLPLKANVSGRPAVVNIGAIFSFKTVIGKAAKIAIETAIEDVNSNPDILPGTKLILQ  81

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            M DSN SGF+ +VEA+ FME +TVAIIGPQ+SV AHVISH+AN L+VPLLSF++TDPTLS
Sbjct  82   MKDSNYSGFMAVVEALLFMERETVAIIGPQSSVTAHVISHIANVLRVPLLSFSSTDPTLS  141

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             +Q+PFFVRT+ NDL+ M+A+A I+D+Y WREV+A
Sbjct  142  PIQFPFFVRTAQNDLYQMSAIAEIIDHYEWREVIA  176



>ref|XP_009107641.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Brassica rapa]
Length=775

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 130/170 (76%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEG-VNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W  +FL+     +C G +    S +P+VV IG I +F S IGKVAK A+E AV DV
Sbjct  1    MKLLWSFLFLSC----LCLGFLGHGHSEKPEVVKIGSIFSFNSVIGKVAKIAIEEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GT+L V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILVGTRLQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +VPLLSFA TDP +S LQ+P+F+RTS +DL+ M A+ASIVD Y W+EV+A
Sbjct  117  RVPLLSFAVTDPVMSPLQFPYFIRTSQSDLYQMEAIASIVDLYGWKEVIA  166



>ref|XP_011034846.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Populus euphratica]
Length=764

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = +3

Query  162  GFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSN  341
            G WV +     S     G +  L++RP VVNIG + TF S IG+VAK A++ AV DVN+N
Sbjct  45   GCWVFLICLLLS---TTGYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNAN  101

Query  342  PDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVP  521
              +L GTKLNV + +SN SGFLG+VEA+RFMETD VAIIGPQ+SV+A +ISH+AN+LQVP
Sbjct  102  SSILRGTKLNVDVRNSNCSGFLGMVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVP  161

Query  522  LLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LLSFAATDP+L+SLQ+PFFV+T+ +DL  MAA++ +VDYY W++V A
Sbjct  162  LLSFAATDPSLNSLQFPFFVQTTQSDLHQMAAISDVVDYYGWKQVTA  208



>gb|KHG26328.1| Glutamate receptor 3.3 -like protein [Gossypium arboreum]
Length=909

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            + + GF  +  L+ + G    G     STRP VVNIG +  F S IG+VAK A++ A+ D
Sbjct  1    MNVAGF--IFLLSLHLGVFQIGYGRNASTRPAVVNIGAMFNFDSIIGRVAKIAIDEALKD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNSN  +L GTKL+VT+ D+N +GFLG+VEA+R+M TD VAIIGPQ SV+A +ISH+A+E
Sbjct  59   VNSNSSILKGTKLSVTLQDTNCNGFLGMVEALRYMATDVVAIIGPQCSVVAPIISHVASE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            L+VPLLSFAATDPTLSSLQ+PFFVRT+ NDL+ M AVA I+D+Y W+EV+A
Sbjct  119  LRVPLLSFAATDPTLSSLQFPFFVRTAQNDLYQMTAVADIIDHYGWKEVIA  169



>ref|XP_009418664.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418665.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418666.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
Length=918

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            G     S+RP VV++G I TF S IG VAK A++AA DDVNS+P VL GT+L + M D+N
Sbjct  18   GATRNASSRPTVVHVGAIFTFDSTIGSVAKVAIDAAEDDVNSDPSVLRGTRLQIIMRDTN  77

Query  393  SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYP  572
             SGFLG++EA++FMETDTVAI+GPQ + IAHVISH++NEL VPLLSF+ATDPTL++L+YP
Sbjct  78   CSGFLGMMEALQFMETDTVAIVGPQCTTIAHVISHVSNELHVPLLSFSATDPTLNALEYP  137

Query  573  FFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +FVRT+ +DLF MAA+A IVDYY W +V+A
Sbjct  138  YFVRTTQSDLFQMAAIAEIVDYYQWSQVIA  167



>gb|KJB57945.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
Length=641

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            + + GF  +  L+ + G    G     STRP VVNIG +  F S IG+VAK A++ A+ D
Sbjct  1    MNVAGF--IFLLSLHLGVFQIGYGRNASTRPAVVNIGAMFNFDSIIGRVAKIAIDEALKD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNSN  +L GTKL+VT+ D+N +GFLG+VEA+R+M TD VAIIGPQ SV+A +ISH+A+E
Sbjct  59   VNSNSSILKGTKLSVTLQDTNCNGFLGMVEALRYMATDVVAIIGPQCSVVAPIISHVASE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            L+VPLLSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+A
Sbjct  119  LRVPLLSFAATDPTLSSLQFPFFVRTAQSDLYQMTAVADIIDHYGWKEVIA  169



>ref|XP_007135963.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 ref|XP_007135964.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07957.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07958.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
Length=918

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 133/169 (79%), Gaps = 2/169 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M  F VV ++ +  G+V  G  +  S RP VVNIG I    S +GKVAK  +E AV DVN
Sbjct  1    MNLFRVVCWVVWCLGFV--GAANVSSLRPSVVNIGAIFNIDSVLGKVAKLTLEEAVKDVN  58

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            ++ ++L GTK+ +TM +SN SGFLG+V+A+RFMETD VAIIGPQ+SV+AH+ISH+ANEL+
Sbjct  59   ADTNILHGTKIVLTMQNSNYSGFLGMVQALRFMETDVVAIIGPQSSVVAHIISHVANELR  118

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSFAATDPTL+SLQ+PFFVRT+ +DL+ M AVA I+DYY W+EV+A
Sbjct  119  VPLLSFAATDPTLTSLQFPFFVRTTQSDLYQMKAVAEIIDYYGWKEVIA  167



>ref|XP_010935350.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010935351.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=916

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +3

Query  180  FLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGG  359
            FL  Y  +V  G +  +S+RP VV IG +  F S IG+VAK A+ AA+DDVN++  VL G
Sbjct  8    FLALYLAFVSSGASRNVSSRPAVVTIGAVFGFNSTIGRVAKVAINAALDDVNADSSVLQG  67

Query  360  TKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAA  539
            TKL + M DSN +GFLGIVEA++FME D +A++GPQ S  AH++SH+ NELQVP+LSFAA
Sbjct  68   TKLAIEMQDSNCNGFLGIVEALQFMEADIIAMVGPQCSTTAHILSHVGNELQVPMLSFAA  127

Query  540  TDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            TDPTLSSLQ+PFFVRT+ +D+F MAA+A ++DYY W++V+A
Sbjct  128  TDPTLSSLQFPFFVRTTQSDVFQMAAIAEMLDYYQWKQVIA  168



>ref|XP_008804484.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Phoenix dactylifera]
Length=916

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  198  GYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            G++  G +  +S+RP VVNIG + TF S IG+ AK A+ AA+DDVN++  VL GTKL +T
Sbjct  14   GFISGGASRNVSSRPAVVNIGAVFTFNSTIGRAAKVAINAAMDDVNADSSVLQGTKLAIT  73

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            M DSN +GFLGIVEA++FME D +AI+GPQ S IAH++ H+ NELQVP+LSFAATDP+LS
Sbjct  74   MQDSNCNGFLGIVEALQFMEVDIIAIVGPQCSTIAHILCHVGNELQVPMLSFAATDPSLS  133

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SLQ+PFFVRT+ +D F MAA+A +++YY W++V+A
Sbjct  134  SLQFPFFVRTTQSDAFQMAAIAEMLEYYQWKQVIA  168



>ref|XP_009107640.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Brassica rapa]
Length=929

 Score =   185 bits (470),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 130/170 (76%), Gaps = 5/170 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYS-GYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            MK  W  +FL+    G++  G     S +P+VV IG I +F S IGKVAK A+E AV DV
Sbjct  1    MKLLWSFLFLSCLCLGFLGHG----HSEKPEVVKIGSIFSFNSVIGKVAKIAIEEAVKDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNPD+L GT+L V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+ANEL
Sbjct  57   NSNPDILVGTRLQVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +VPLLSFA TDP +S LQ+P+F+RTS +DL+ M A+ASIVD Y W+EV+A
Sbjct  117  RVPLLSFAVTDPVMSPLQFPYFIRTSQSDLYQMEAIASIVDLYGWKEVIA  166



>ref|XP_008804475.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Phoenix dactylifera]
Length=932

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = +3

Query  198  GYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            G++  G +  +S+RP VVNIG + TF S IG+ AK A+ AA+DDVN++  VL GTKL +T
Sbjct  30   GFISGGASRNVSSRPAVVNIGAVFTFNSTIGRAAKVAINAAMDDVNADSSVLQGTKLAIT  89

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            M DSN +GFLGIVEA++FME D +AI+GPQ S IAH++ H+ NELQVP+LSFAATDP+LS
Sbjct  90   MQDSNCNGFLGIVEALQFMEVDIIAIVGPQCSTIAHILCHVGNELQVPMLSFAATDPSLS  149

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SLQ+PFFVRT+ +D F MAA+A +++YY W++V+A
Sbjct  150  SLQFPFFVRTTQSDAFQMAAIAEMLEYYQWKQVIA  184



>ref|XP_011034844.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
 ref|XP_011034845.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
Length=931

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = +3

Query  162  GFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSN  341
            G WV +     S     G +  L++RP VVNIG + TF S IG+VAK A++ AV DVN+N
Sbjct  7    GCWVFLICLLLS---TTGYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNAN  63

Query  342  PDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVP  521
              +L GTKLNV + +SN SGFLG+VEA+RFMETD VAIIGPQ+SV+A +ISH+AN+LQVP
Sbjct  64   SSILRGTKLNVDVRNSNCSGFLGMVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVP  123

Query  522  LLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LLSFAATDP+L+SLQ+PFFV+T+ +DL  MAA++ +VDYY W++V A
Sbjct  124  LLSFAATDPSLNSLQFPFFVQTTQSDLHQMAAISDVVDYYGWKQVTA  170



>ref|XP_002301908.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE81181.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=931

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  162  GFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSN  341
            G WV +     S     G +  L++RP VVNIG + TF S IG+VAK A++ AV DVN+N
Sbjct  7    GCWVFLICLLLS---TTGYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNAN  63

Query  342  PDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVP  521
              +L GTKLNV M +SN SGFLG+VEA+RFMETD VAIIGPQ+SV+A +ISH+ N+LQVP
Sbjct  64   SSILRGTKLNVDMRNSNCSGFLGMVEALRFMETDIVAIIGPQSSVVARIISHVTNQLQVP  123

Query  522  LLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LLSFAATDP+L+SLQ+PFFV+T+ +DL  MAA++ +VDYY W++V A
Sbjct  124  LLSFAATDPSLNSLQFPFFVQTTHSDLHQMAAISDVVDYYGWKQVTA  170



>ref|XP_011034842.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Populus euphratica]
Length=969

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = +3

Query  162  GFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSN  341
            G WV +     S     G +  L++RP VVNIG + TF S IG+VAK A++ AV DVN+N
Sbjct  45   GCWVFLICLLLS---TTGYSRNLTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNAN  101

Query  342  PDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVP  521
              +L GTKLNV + +SN SGFLG+VEA+RFMETD VAIIGPQ+SV+A +ISH+AN+LQVP
Sbjct  102  SSILRGTKLNVDVRNSNCSGFLGMVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVP  161

Query  522  LLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LLSFAATDP+L+SLQ+PFFV+T+ +DL  MAA++ +VDYY W++V A
Sbjct  162  LLSFAATDPSLNSLQFPFFVQTTQSDLHQMAAISDVVDYYGWKQVTA  208



>gb|KJB17456.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
Length=836

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  204  VCEGV--NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            VC G+   + +S RP VVNIG I +F + IGK AK A+E A++DVNSNPD+L GTKL + 
Sbjct  22   VCNGLPLKANVSGRPAVVNIGAIFSFKTVIGKAAKIAIETAIEDVNSNPDILPGTKLILQ  81

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            M DSN SGF+ +VEA+ FME +TVAIIGPQ+SV AHVISH+AN L+VPLLSF++TDPTLS
Sbjct  82   MKDSNYSGFMAVVEALLFMERETVAIIGPQSSVTAHVISHIANVLRVPLLSFSSTDPTLS  141

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             +Q+PFFVRT+ NDL+ M+A+A I+D+Y WREV+A
Sbjct  142  PIQFPFFVRTAQNDLYQMSAIAEIIDHYEWREVIA  176



>gb|KJB57941.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
 gb|KJB57943.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
Length=672

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            + + GF  +  L+ + G    G     STRP VVNIG +  F S IG+VAK A++ A+ D
Sbjct  1    MNVAGF--IFLLSLHLGVFQIGYGRNASTRPAVVNIGAMFNFDSIIGRVAKIAIDEALKD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNSN  +L GTKL+VT+ D+N +GFLG+VEA+R+M TD VAIIGPQ SV+A +ISH+A+E
Sbjct  59   VNSNSSILKGTKLSVTLQDTNCNGFLGMVEALRYMATDVVAIIGPQCSVVAPIISHVASE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            L+VPLLSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+A
Sbjct  119  LRVPLLSFAATDPTLSSLQFPFFVRTAQSDLYQMTAVADIIDHYGWKEVIA  169



>gb|KJB17453.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
 gb|KJB17454.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
 gb|KJB17455.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
 gb|KJB17457.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
Length=944

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 126/155 (81%), Gaps = 2/155 (1%)
 Frame = +3

Query  204  VCEGV--NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            VC G+   + +S RP VVNIG I +F + IGK AK A+E A++DVNSNPD+L GTKL + 
Sbjct  22   VCNGLPLKANVSGRPAVVNIGAIFSFKTVIGKAAKIAIETAIEDVNSNPDILPGTKLILQ  81

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            M DSN SGF+ +VEA+ FME +TVAIIGPQ+SV AHVISH+AN L+VPLLSF++TDPTLS
Sbjct  82   MKDSNYSGFMAVVEALLFMERETVAIIGPQSSVTAHVISHIANVLRVPLLSFSSTDPTLS  141

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             +Q+PFFVRT+ NDL+ M+A+A I+D+Y WREV+A
Sbjct  142  PIQFPFFVRTAQNDLYQMSAIAEIIDHYEWREVIA  176



>ref|XP_010094542.1| Glutamate receptor 3.3 [Morus notabilis]
 gb|EXB56296.1| Glutamate receptor 3.3 [Morus notabilis]
Length=932

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            +V+FL +  G+   G    +S+RP VVN+G I +F S IG+VA  A+E AV DVNSN  +
Sbjct  8    LVVFLLYLGGFPF-GHGKNVSSRPAVVNVGAIFSFDSTIGRVATLAIEEAVKDVNSNSSI  66

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            L GTKL+V M +SN SGF+G+VEA++ +E D +AIIGPQ+SV+AH+ISH+ANEL+ PLLS
Sbjct  67   LRGTKLSVQMQNSNCSGFVGMVEALQLLEKDVIAIIGPQSSVVAHIISHVANELKTPLLS  126

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FAATDPTLSSLQ+P+FVRT+ +DL+ MAAVA IVD+Y W+E++A
Sbjct  127  FAATDPTLSSLQFPYFVRTTHSDLYQMAAVAEIVDFYGWKELIA  170



>ref|XP_009786332.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Nicotiana sylvestris]
Length=641

 Score =   182 bits (463),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+ +      G   +G++   ++RP VVN+G I TF S IG+VAK A++ AV DVN
Sbjct  1    MNALWIFVLCLLCFGVGSDGLSGNGTSRPAVVNVGGIFTFDSTIGRVAKIAIQEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL V + +SN SGFLG+V A++FMETD VA+IGPQ+SV+AH ISH+ANELQ
Sbjct  61   SNSSLLRGTKLVVKLQNSNCSGFLGMVGALKFMETDVVAVIGPQSSVVAHSISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VP LSFAATDPTLSSLQ+P+F+RT+ +DL+ M A A IV+YY W+EV+A
Sbjct  121  VPFLSFAATDPTLSSLQFPYFLRTTQSDLYQMTATAEIVEYYGWKEVIA  169



>gb|KDP36767.1| hypothetical protein JCGZ_08058 [Jatropha curcas]
Length=926

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 128/163 (79%), Gaps = 5/163 (3%)
 Frame = +3

Query  174  VMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVL  353
            V F+ F SG+     +   ++RP VVNIG I T  S IGKVAK A+E AV DVN+N  +L
Sbjct  12   VFFVLFSSGH-----SRNATSRPAVVNIGAIFTLDSTIGKVAKIAMEEAVKDVNANSSIL  66

Query  354  GGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSF  533
             GTKL +TM DSN SGF G+VEA++FMETD VAIIGPQ+SV+AH+ISH+ NELQVPLLSF
Sbjct  67   HGTKLVITMHDSNCSGFTGMVEALKFMETDVVAIIGPQSSVVAHIISHVVNELQVPLLSF  126

Query  534  AATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            AATDPTL+SLQ+PFFVRT  +DL+ M A+A IV+YY W++V++
Sbjct  127  AATDPTLNSLQFPFFVRTIQSDLYQMTAIAEIVNYYGWKQVIS  169



>ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006342152.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006342153.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Solanum tuberosum]
Length=946

 Score =   184 bits (468),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 129/170 (76%), Gaps = 0/170 (0%)
 Frame = +3

Query  153  KMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            +M   W+++      G   +G++   ++RP VVN+G I TF S IG+ AK A++ AV DV
Sbjct  15   RMNVVWIIVSCIVCFGVCSDGLSGNGTSRPAVVNVGAIFTFDSTIGRAAKIAIQEAVKDV  74

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSN  VL GTKL V + +SN SGFLG+V A++FMETD VA+IGPQ+SV+AH ISH+ANEL
Sbjct  75   NSNSSVLQGTKLVVQLQNSNCSGFLGMVGALKFMETDVVAVIGPQSSVVAHTISHVANEL  134

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVP LSFAATDPTLS LQ+P+F+RT+ +DL+ M A+A I+++Y W+EV+A
Sbjct  135  QVPFLSFAATDPTLSCLQFPYFLRTTQSDLYQMTAIAEIIEFYAWKEVIA  184



>ref|XP_003533408.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
 gb|KHN38861.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++ +  YSG+   G  +T ST P  VNIG IL+F S IGKVAK A+ AAVDD+N
Sbjct  1    MSKVWLLVLVILYSGFPSIGTTTTDSTSPSAVNIGAILSFNSTIGKVAKVAIHAAVDDIN  60

Query  336  SNPDVLGGTKLNVTMLDSN-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            SN  +L GTKLN+T+LD+  S+GFLGI+++   ME DTVAIIGPQ SV+AHVISH+ANE+
Sbjct  61   SNATILNGTKLNITLLDTKLSTGFLGIIDSFLLMEKDTVAIIGPQYSVMAHVISHIANEM  120

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPLLSFAATDPTL+SLQ+P+FVRT+ +DL+ MAAVA IVD++ WR+V+A
Sbjct  121  QVPLLSFAATDPTLTSLQFPYFVRTTQSDLYQMAAVAEIVDHFQWRDVIA  170



>gb|KJB57940.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
 gb|KJB57942.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
 gb|KJB57944.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
Length=909

 Score =   184 bits (466),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 131/171 (77%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            + + GF  +  L+ + G    G     STRP VVNIG +  F S IG+VAK A++ A+ D
Sbjct  1    MNVAGF--IFLLSLHLGVFQIGYGRNASTRPAVVNIGAMFNFDSIIGRVAKIAIDEALKD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNSN  +L GTKL+VT+ D+N +GFLG+VEA+R+M TD VAIIGPQ SV+A +ISH+A+E
Sbjct  59   VNSNSSILKGTKLSVTLQDTNCNGFLGMVEALRYMATDVVAIIGPQCSVVAPIISHVASE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            L+VPLLSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+A
Sbjct  119  LRVPLLSFAATDPTLSSLQFPFFVRTAQSDLYQMTAVADIIDHYGWKEVIA  169



>ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Nicotiana sylvestris]
Length=930

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+ +      G   +G++   ++RP VVN+G I TF S IG+VAK A++ AV DVN
Sbjct  1    MNALWIFVLCLLCFGVGSDGLSGNGTSRPAVVNVGGIFTFDSTIGRVAKIAIQEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL V + +SN SGFLG+V A++FMETD VA+IGPQ+SV+AH ISH+ANELQ
Sbjct  61   SNSSLLRGTKLVVKLQNSNCSGFLGMVGALKFMETDVVAVIGPQSSVVAHSISHVANELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VP LSFAATDPTLSSLQ+P+F+RT+ +DL+ M A A IV+YY W+EV+A
Sbjct  121  VPFLSFAATDPTLSSLQFPYFLRTTQSDLYQMTATAEIVEYYGWKEVIA  169



>ref|XP_008337899.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=925

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNS--TLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            +V+F+ FY G    G+++   ++ RPDVVNIG I TF S IGK+AK A+  AV+DVNSNP
Sbjct  6    LVLFMVFYKGSSSSGLSTTTNVTARPDVVNIGAIFTFDSVIGKIAKLAITLAVEDVNSNP  65

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
            ++L GTKL + M ++ SS FLGI+EA++F E DTVAIIGPQ S  AHVISH+A+EL+VPL
Sbjct  66   EILNGTKLTLKMQNTKSSDFLGIIEALQFTENDTVAIIGPQYSATAHVISHIADELKVPL  125

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LSFAATDPTLS  Q+PFFVRT+ +DLF MAAVA +V YY WR+V+A
Sbjct  126  LSFAATDPTLSPNQFPFFVRTTRSDLFQMAAVADLVGYYEWRDVIA  171



>ref|XP_006425257.1| hypothetical protein CICLE_v10024813mg [Citrus clementina]
 gb|ESR38497.1| hypothetical protein CICLE_v10024813mg [Citrus clementina]
Length=940

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            +K+ G  V++ + FY       + +  S RP VVNIG +L+F + +GKVAK A++AAVDD
Sbjct  1    MKLSG--VMLLMIFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNS+P  LGGTKL + M D N SGFL + EA+  ME  TVAIIGPQ +V AHV+SH+ANE
Sbjct  59   VNSDPTTLGGTKLKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDAVTAHVVSHVANE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQVPLLSF+ATDPTLSSLQ+P+FVRT+ +D + MAA+A IVD+Y WREV+A
Sbjct  119  LQVPLLSFSATDPTLSSLQFPYFVRTTQSDQYQMAAIAEIVDHYGWREVIA  169



>ref|XP_010500221.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
 ref|XP_010500222.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
Length=936

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 129/172 (75%), Gaps = 11/172 (6%)
 Frame = +3

Query  153  KMKGFWVVMFLT--FYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavd  326
            + +  W + FL+  F  GY         S +P VV IG I +F S IGKVAK A++ AV 
Sbjct  3    QQQQLWALFFLSLVFGKGY---------SGKPKVVKIGSIFSFNSVIGKVAKIAIDEAVK  53

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            DVNSNP++L GTK +V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+AN
Sbjct  54   DVNSNPNILTGTKFSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMAN  113

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            EL+VPLLSFA TDP +S LQ+P+F+RT+ +DL+ M A+ASIVDYY W+EV+A
Sbjct  114  ELRVPLLSFAVTDPVMSPLQFPYFIRTTQSDLYQMDAIASIVDYYGWKEVIA  165



>ref|XP_006473826.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Citrus sinensis]
 ref|XP_006473827.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Citrus sinensis]
Length=930

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W +  +  Y G    G    +S RP VVN+G + T  S IG+VAK A+E AV DVN
Sbjct  1    MKTIWFLPLVFLYFGLFSFGYCKNVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKLN+TM  SN SGF+G+VEA+RFMETD VAIIGPQ S +AH++S+++NELQ
Sbjct  61   SNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            VPLLSF  TDPTLSSLQYPFFVRT+ +D F M AVA +V YY W+ V
Sbjct  121  VPLLSFGVTDPTLSSLQYPFFVRTTQSDSFQMTAVAEMVSYYGWKAV  167



>gb|KDO71523.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=784

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            +K+ G  V++ + FY       + +  S RP VVNIG +L+F + +GKVAK A++AAVDD
Sbjct  1    MKLSG--VMLLMIFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNS+P  LGGTKL + M D N SGFL + EA+  ME  TVAIIGPQ +V +HV+SH+ANE
Sbjct  59   VNSDPTTLGGTKLKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDAVTSHVVSHVANE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQVPLLSF+ATDPTLSSLQ+P+FVRT+ +D + MAA+A IVD+Y WREV+A
Sbjct  119  LQVPLLSFSATDPTLSSLQFPYFVRTTQSDQYQMAAIAEIVDHYGWREVIA  169



>ref|XP_010478979.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
 ref|XP_010478980.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=936

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 129/172 (75%), Gaps = 11/172 (6%)
 Frame = +3

Query  153  KMKGFWVVMFLT--FYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavd  326
            + +  W + FL+  F  GY         S +P VV IG I +F S IGKVAK A++ AV 
Sbjct  3    QQEQLWALFFLSLVFGKGY---------SGKPKVVKIGSIFSFNSVIGKVAKIAIDEAVK  53

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            DVNSNP++L GTK +V+M +SN SGF+G+VEA+RFME D V IIGPQ SV+AH+ISH+AN
Sbjct  54   DVNSNPNILTGTKFSVSMQNSNCSGFMGMVEALRFMEKDIVGIIGPQCSVVAHMISHMAN  113

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            EL+VPLLSFA TDP +S LQ+P+F+RT+ +DL+ M A+ASIVDYY W+EV+A
Sbjct  114  ELRVPLLSFAVTDPVMSPLQFPYFIRTTQSDLYQMDAIASIVDYYGWKEVIA  165



>ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320472.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320473.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320474.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320475.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
Length=945

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 130/170 (76%), Gaps = 0/170 (0%)
 Frame = +3

Query  153  KMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            +M   W+++      G   +G++   ++RP VV++G I TF S IG+ AK A++ AV DV
Sbjct  17   RMNVVWIIVSCIVCFGVCSDGLSRNGTSRPAVVSVGAIFTFDSTIGRAAKIAIQEAVKDV  76

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSN  +L GTKL V + +SN SGFLG+V A++FMETD VA+IGPQ+SV+AH ISH+ANEL
Sbjct  77   NSNSSILQGTKLVVQLQNSNCSGFLGMVGALKFMETDVVAVIGPQSSVVAHTISHVANEL  136

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVP LSFAATDPTLSSLQ+P+F+RT+ +DL+ M A+A I+++Y W+EV+A
Sbjct  137  QVPFLSFAATDPTLSSLQFPYFLRTTQSDLYQMTAIAEIIEFYAWKEVIA  186



>gb|KDO85164.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=640

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W +  +  Y G    G   ++S RP VVN+G + T  S IG+VAK A+E AV DVN
Sbjct  1    MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKLN+TM  SN SGF+G+VEA+RFMETD VAIIGPQ S +AH++S+++NELQ
Sbjct  61   SNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            VPLLSF  TDPTLSSLQYPFFVRT+ +D + M AVA +V YY W  V
Sbjct  121  VPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAV  167



>gb|KDO85163.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=777

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W +  +  Y G    G   ++S RP VVN+G + T  S IG+VAK A+E AV DVN
Sbjct  1    MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKLN+TM  SN SGF+G+VEA+RFMETD VAIIGPQ S +AH++S+++NELQ
Sbjct  61   SNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            VPLLSF  TDPTLSSLQYPFFVRT+ +D + M AVA +V YY W  V
Sbjct  121  VPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAV  167



>gb|KDO71521.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=940

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            +K+ G  V++ + FY       + +  S RP VVNIG +L+F + +GKVAK A++AAVDD
Sbjct  1    MKLSG--VMLLMIFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNS+P  LGGTKL + M D N SGFL + EA+  ME  TVAIIGPQ +V +HV+SH+ANE
Sbjct  59   VNSDPTTLGGTKLKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDAVTSHVVSHVANE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQVPLLSF+ATDPTLSSLQ+P+FVRT+ +D + MAA+A IVD+Y WREV+A
Sbjct  119  LQVPLLSFSATDPTLSSLQFPYFVRTTQSDQYQMAAIAEIVDHYGWREVIA  169



>ref|XP_011100274.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100281.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100289.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100297.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
Length=935

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 127/164 (77%), Gaps = 5/164 (3%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W++ F     G +  G+++  S+RP VVNIG I T  S IGKVAK A+E AV DVNSN  
Sbjct  10   WLLSF-----GVLSNGLSANASSRPAVVNIGAIFTLDSTIGKVAKIAIEEAVKDVNSNSS  64

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VL GTKLNV + +SN SGFLG+VEA+R+METD VA+IGPQ+SV+AH I H+ANEL+ P L
Sbjct  65   VLQGTKLNVDIRNSNCSGFLGLVEALRYMETDVVAVIGPQSSVVAHTILHVANELKTPFL  124

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            SFAATDPTLSSLQ+P+F+RT+ +DL  M AVA IV++Y W+EV+
Sbjct  125  SFAATDPTLSSLQFPYFIRTTQSDLHQMTAVADIVEHYGWKEVI  168



>ref|XP_006467103.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
 ref|XP_006467104.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Citrus sinensis]
Length=940

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            +K+ G  V++ + FY       + +  S RP VVNIG +L+F + +GKVAK A++AAVDD
Sbjct  1    MKLSG--VMLLMIFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNS+P  LGGTKL + M D N SGFL + EA+  ME  TVAIIGPQ +V +HV+SH+ANE
Sbjct  59   VNSDPTTLGGTKLKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDAVTSHVVSHVANE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQVPLLSF+ATDPTLSSLQ+P+FVRT+ +D + MAA+A IVD+Y WREV+A
Sbjct  119  LQVPLLSFSATDPTLSSLQFPYFVRTTQSDQYQMAAIAEIVDHYGWREVIA  169



>gb|KDO71522.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=939

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 130/171 (76%), Gaps = 2/171 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            +K+ G  V++ + FY       + +  S RP VVNIG +L+F + +GKVAK A++AAVDD
Sbjct  1    MKLSG--VMLLMIFYCELFVYRITAQASGRPSVVNIGALLSFSTNVGKVAKLAIKAAVDD  58

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNS+P  LGGTKL + M D N SGFL + EA+  ME  TVAIIGPQ +V +HV+SH+ANE
Sbjct  59   VNSDPTTLGGTKLKLQMQDCNHSGFLALAEALHLMEGQTVAIIGPQDAVTSHVVSHVANE  118

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQVPLLSF+ATDPTLSSLQ+P+FVRT+ +D + MAA+A IVD+Y WREV+A
Sbjct  119  LQVPLLSFSATDPTLSSLQFPYFVRTTQSDQYQMAAIAEIVDHYGWREVIA  169



>ref|XP_010680623.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=960

 Score =   182 bits (463),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 125/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  195  SGYVC-EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLN  371
            +G +C  GV++  STRP VVNIG I++F S  GKVAK A+EAA+DDVNS+  VL GTKLN
Sbjct  19   NGILCANGVDTISSTRPKVVNIGAIMSFNSITGKVAKLAIEAAMDDVNSSSQVLKGTKLN  78

Query  372  VTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPT  551
            ++M DSN SGFLG +EAM  +E+  VAIIGPQ+SVIAHV+S +A  LQVPLLSFAATDPT
Sbjct  79   ISMSDSNYSGFLGAIEAMTIIESGVVAIIGPQSSVIAHVVSQVAKGLQVPLLSFAATDPT  138

Query  552  LSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            LSSL YPF VRT+ NDLF MAA+A IVDYY WREV
Sbjct  139  LSSLDYPFVVRTNQNDLFQMAAIADIVDYYGWREV  173



>ref|XP_006383780.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
 gb|ERP61577.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
Length=661

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  201  YVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTM  380
            +   G +  +S+RP VVNIG I TF S IG+VAK A++ AV DVN+N  +L GT+L + M
Sbjct  17   FSTSGYSRNVSSRPAVVNIGAIFTFESTIGRVAKIAIQEAVKDVNANSSILHGTELKIHM  76

Query  381  LDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSS  560
             +SN SGFLG+ EA++F E D +AIIGPQ+SV+AH+ISH+ANELQVPLLSFAATDPTL+S
Sbjct  77   KNSNCSGFLGLAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNS  136

Query  561  LQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQ+PFFVRT+ +D + MAA++ +VD+Y W++V A
Sbjct  137  LQFPFFVRTTQSDFYQMAAISEVVDHYGWKQVTA  170



>dbj|BAL15056.1| glutamate receptor 3.3 [Solanum lycopersicum]
Length=808

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 129/169 (76%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++      G   +G++   ++RP VV++G I TF S IG+ AK A++ AV DVN
Sbjct  6    MNVVWIIVSCIVCFGVCSDGLSRNGTSRPAVVSVGAIFTFDSTIGRAAKIAIQEAVKDVN  65

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKL V + +SN SGFLG+V A++FMETD VA+IGPQ+SV+AH ISH+ANELQ
Sbjct  66   SNSSILQGTKLVVQLQNSNCSGFLGMVGALKFMETDVVAVIGPQSSVVAHTISHVANELQ  125

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VP LSFAATDPTLSSLQ+P+F+RT+ +DL+ M A+A I+++Y W+EV+A
Sbjct  126  VPFLSFAATDPTLSSLQFPYFLRTTQSDLYQMTAIAEIIEFYAWKEVIA  174



>ref|XP_011034843.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Populus euphratica]
Length=951

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            L++RP VVNIG + TF S IG+VAK A++ AV DVN+N  +L GTKLNV + +SN SGFL
Sbjct  46   LTSRPAVVNIGALFTFESSIGRVAKIAIQEAVKDVNANSSILRGTKLNVDVRNSNCSGFL  105

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G+VEA+RFMETD VAIIGPQ+SV+A +ISH+AN+LQVPLLSFAATDP+L+SLQ+PFFV+T
Sbjct  106  GMVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVPLLSFAATDPSLNSLQFPFFVQT  165

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +DL  MAA++ +VDYY W++V A
Sbjct  166  TQSDLHQMAAISDVVDYYGWKQVTA  190



>ref|XP_009359749.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=933

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            ++ RPDVVNIG I+TF S IGK+AK A+  AV+DVNSNP++L GTKL + M ++ SS FL
Sbjct  35   VTARPDVVNIGAIITFDSVIGKIAKLAITLAVEDVNSNPEILNGTKLTLKMQNTKSSDFL  94

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            GI+EA++FME DTVAIIGPQ S  AHVISH+ +EL+VPLLSFAATDPTL+  Q+PFFVRT
Sbjct  95   GIIEALQFMENDTVAIIGPQYSATAHVISHITDELKVPLLSFAATDPTLAPNQFPFFVRT  154

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +DLF MAAVA +V YY WR+V+A
Sbjct  155  TRSDLFQMAAVADLVGYYEWRDVIA  179



>ref|XP_006383781.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
 gb|ERP61578.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
Length=684

 Score =   180 bits (457),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 122/150 (81%), Gaps = 0/150 (0%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            G +  +S+RP VVNIG I TF S IG+VAK A++ AV DVN+N  +L GT+L + M +SN
Sbjct  21   GYSRNVSSRPAVVNIGAIFTFESTIGRVAKIAIQEAVKDVNANSSILHGTELKIHMKNSN  80

Query  393  SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYP  572
             SGFLG+ EA++F E D +AIIGPQ+SV+AH+ISH+ANELQVPLLSFAATDPTL+SLQ+P
Sbjct  81   CSGFLGLAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNSLQFP  140

Query  573  FFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FFVRT+ +D + MAA++ +VD+Y W++V A
Sbjct  141  FFVRTTQSDFYQMAAISEVVDHYGWKQVTA  170



>gb|KDO71518.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=574

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            VV    F +G    GV    ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +
Sbjct  11   VVYNFCFSAGISMNGV----STIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAI  66

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGGTKL +T+ D+N S FLG+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLS
Sbjct  67   LGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLS  126

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FAATDP+LSSLQYPFFVRT+ +DL+ MAA+A IVDY+ WR V+A
Sbjct  127  FAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIA  170



>ref|XP_007203444.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
 gb|EMJ04643.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
Length=895

 Score =   181 bits (460),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +3

Query  183  LTFYSGYVCEGVNSTLST-RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGG  359
            + FY+G    G+ + ++T RP+VVNIG I TF S IGK+AK A+  AV+DVNS+P++L G
Sbjct  1    MVFYNGASSNGLGANVTTARPEVVNIGAIFTFDSVIGKIAKLAIALAVEDVNSDPEILNG  60

Query  360  TKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAA  539
            TKL + M ++ SS FLGI+EA++F+E DTVAIIGPQ S  AHVISH+A+EL+VPLLSFAA
Sbjct  61   TKLTLKMQNTKSSDFLGIIEALQFLENDTVAIIGPQFSATAHVISHIADELKVPLLSFAA  120

Query  540  TDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            TDPTLS  Q+PF VRT+ +DLF M AVA +V YY WR+V+A
Sbjct  121  TDPTLSPTQFPFLVRTTRSDLFQMTAVADLVFYYEWRDVIA  161



>ref|XP_010923968.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
 ref|XP_010923969.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=930

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 123/156 (79%), Gaps = 1/156 (1%)
 Frame = +3

Query  198  GYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNV  374
            G    G N+T + ++P VVNIG + TF S IG+VAK A++ AV DVN+NP++L GT+LNV
Sbjct  17   GAAAAGRNATGVPSKPSVVNIGALFTFNSTIGRVAKLAIQLAVQDVNNNPNLLAGTRLNV  76

Query  375  TMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTL  554
               D+N SGFLGI+EA++ ME D VAIIGPQ+S IAHVISH+ NEL VPLLSFAATDPTL
Sbjct  77   IAQDTNCSGFLGIIEALQLMENDVVAIIGPQSSGIAHVISHVVNELHVPLLSFAATDPTL  136

Query  555  SSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +SLQYP+F+RT+ ND F M A+A ++ YY WRE++A
Sbjct  137  ASLQYPYFLRTTQNDYFGMNAIADMIGYYGWREIIA  172



>ref|XP_006435401.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
 gb|ESR48641.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
Length=930

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W +  +  Y G    G   ++S RP VVN+G + T  S IG+VAK A+E AV DVN
Sbjct  1    MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKLN+TM  SN SGF+G+VEA+RFMETD VAIIGPQ S +AH++S+++NELQ
Sbjct  61   SNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            VPLLSF  TDPTLSSLQYPFFVRT+ +D + M AVA +V YY W  V
Sbjct  121  VPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAV  167



>ref|XP_009372603.1| PREDICTED: glutamate receptor 3.3-like [Pyrus x bretschneideri]
Length=936

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP VVNIG I TF S IG+VAK A++ AV DVNSN  +L GT+L V M  SN SGFLG+V
Sbjct  32   RPAVVNIGAIFTFDSTIGRVAKLAIQEAVKDVNSNSSILHGTELVVHMRTSNCSGFLGMV  91

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
            +A++FMETD VA+IGPQ+SV+AH+ISH++NELQVPLLSFAATDPTLSS Q+PFFVRT+ +
Sbjct  92   QALQFMETDIVAVIGPQSSVVAHIISHVSNELQVPLLSFAATDPTLSSFQFPFFVRTTHS  151

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            DL+ M AVA IVD+Y W+EV+A
Sbjct  152  DLYQMTAVAEIVDHYGWKEVIA  173



>gb|KDO85161.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
 gb|KDO85162.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=930

 Score =   182 bits (461),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W +  +  Y G    G   ++S RP VVN+G + T  S IG+VAK A+E AV DVN
Sbjct  1    MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKLN+TM  SN SGF+G+VEA+RFMETD VAIIGPQ S +AH++S+++NELQ
Sbjct  61   SNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            VPLLSF  TDPTLSSLQYPFFVRT+ +D + M AVA +V YY W  V
Sbjct  121  VPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAV  167



>gb|KDO85160.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=938

 Score =   181 bits (460),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 122/167 (73%), Gaps = 0/167 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            MK  W +  +  Y G    G   ++S RP VVN+G + T  S IG+VAK A+E AV DVN
Sbjct  1    MKTIWFLPLVFLYFGLFSFGYCKSVSARPAVVNVGALFTLDSTIGRVAKIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            SN  +L GTKLN+TM  SN SGF+G+VEA+RFMETD VAIIGPQ S +AH++S+++NELQ
Sbjct  61   SNSSILHGTKLNITMQSSNCSGFIGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREV  656
            VPLLSF  TDPTLSSLQYPFFVRT+ +D + M AVA +V YY W  V
Sbjct  121  VPLLSFGVTDPTLSSLQYPFFVRTTQSDSYQMTAVAEMVSYYGWNAV  167



>ref|XP_007202847.1| hypothetical protein PRUPE_ppa014700mg, partial [Prunus persica]
 gb|EMJ04046.1| hypothetical protein PRUPE_ppa014700mg, partial [Prunus persica]
Length=806

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 122/151 (81%), Gaps = 1/151 (1%)
 Frame = +3

Query  213  GVNSTLST-RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDS  389
            GV +T +T RP+VVNIG I TF S IGK+AK A+  AV+DVNS+P+ L GTKL + M ++
Sbjct  13   GVGATATTARPEVVNIGAIFTFDSVIGKIAKLAIALAVEDVNSDPENLNGTKLTLKMQNT  72

Query  390  NSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQY  569
             SS FLGI+EA++FME DTVAIIGPQ S  AHVISH+A+EL+VPLLSFAATDPTLS  Q+
Sbjct  73   KSSDFLGIIEALQFMENDTVAIIGPQFSATAHVISHIADELKVPLLSFAATDPTLSPTQF  132

Query  570  PFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PF VRT+ +DLF M AVA +VDYY WR+V+A
Sbjct  133  PFLVRTTRSDLFQMTAVADLVDYYEWRDVIA  163



>ref|XP_009401867.1| PREDICTED: glutamate receptor 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=925

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP  V+IG + +  S IG+VAK A++AAV DVN++P VL GTKL V M DSN + F+GIV
Sbjct  32   RPPTVHIGALFSHNSTIGRVAKVAIDAAVSDVNADPSVLQGTKLVVEMQDSNCNSFIGIV  91

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
            +A++FMETD VAIIGPQ+SVIAHVISH+AN+LQVPLLSFAATDPTLSSLQYPFFVRT+ +
Sbjct  92   QALQFMETDIVAIIGPQSSVIAHVISHVANDLQVPLLSFAATDPTLSSLQYPFFVRTTHS  151

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            DLF MAAVA +VDYY W +V+A
Sbjct  152  DLFQMAAVAELVDYYQWSQVIA  173



>ref|XP_008803655.1| PREDICTED: glutamate receptor 3.5-like [Phoenix dactylifera]
Length=957

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +3

Query  198  GYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNV  374
            G    G N T + ++P VVNIG +LTF S IG+ AK A++ AV DVNSNP++L GT+LNV
Sbjct  43   GAAAAGRNGTGVPSKPSVVNIGALLTFNSIIGRAAKLAIQLAVQDVNSNPNLLAGTRLNV  102

Query  375  TMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTL  554
               D+N SGFLGI+EA++ ME D VAIIGPQ+S IAHVISH+ NEL VPLLSFAATDPTL
Sbjct  103  IAQDTNCSGFLGIMEALQLMENDVVAIIGPQSSGIAHVISHVVNELHVPLLSFAATDPTL  162

Query  555  SSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +S QYPFF+RT  ND F M A+A ++ YY WREVVA
Sbjct  163  ASQQYPFFLRTIQNDYFQMNAIADMIGYYGWREVVA  198



>gb|KDO71515.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
 gb|KDO71516.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
 gb|KDO71517.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=633

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            VV    F +G    GV    ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +
Sbjct  11   VVYNFCFSAGISMNGV----STIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAI  66

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGGTKL +T+ D+N S FLG+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLS
Sbjct  67   LGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLS  126

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FAATDP+LSSLQYPFFVRT+ +DL+ MAA+A IVDY+ WR V+A
Sbjct  127  FAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIA  170



>ref|XP_002306988.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE93984.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=932

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 123/154 (80%), Gaps = 0/154 (0%)
 Frame = +3

Query  201  YVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTM  380
            +   G +  +S+RP VVNIG I TF S IG+VAK A++ AV DVN+N  +L GT+L + M
Sbjct  17   FSTSGYSRNVSSRPAVVNIGAIFTFESTIGRVAKIAIQEAVKDVNANSSILHGTELKIHM  76

Query  381  LDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSS  560
             +SN SGFLG+ EA++F E D +AIIGPQ+SV+AH+ISH+ANELQVPLLSFAATDPTL+S
Sbjct  77   KNSNCSGFLGLAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNS  136

Query  561  LQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQ+PFFVRT+ +D + MAA++ +VD+Y W++V A
Sbjct  137  LQFPFFVRTTQSDFYQMAAISEVVDHYGWKQVTA  170



>ref|XP_008373417.1| PREDICTED: glutamate receptor 3.3 [Malus domestica]
Length=959

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP VV IG I TF S IG+VAK A+  AV DVNSN  +L GTKL V M  SN SGFLG+V
Sbjct  55   RPAVVKIGAIFTFESTIGRVAKLAIXEAVKDVNSNSSILHGTKLAVNMQSSNCSGFLGMV  114

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
            +A++FMETD VAIIGPQ+SV+AH+ISH++NELQVPLLSFAATDPTLSSLQ+PFFVRT+ +
Sbjct  115  QALQFMETDIVAIIGPQSSVVAHIISHVSNELQVPLLSFAATDPTLSSLQFPFFVRTTHS  174

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            DL+ M AVA +VD+Y W+ V+A
Sbjct  175  DLYQMTAVAEMVDHYGWKXVIA  196



>ref|XP_006467099.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Citrus sinensis]
Length=632

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            VV    F +G    GV    ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +
Sbjct  11   VVYNFCFSAGISMNGV----STIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAI  66

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGGTKL +T+ D+N S FLG+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLS
Sbjct  67   LGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLS  126

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FAATDP+LSSLQYPFFVRT+ +DL+ MAA+A IVDY+ WR V+A
Sbjct  127  FAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIA  170



>ref|XP_007043077.1| Glutamate receptor 2 isoform 3 [Theobroma cacao]
 gb|EOX98908.1| Glutamate receptor 2 isoform 3 [Theobroma cacao]
Length=639

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +3

Query  177  MFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLG  356
            + L   +  +C GV S  +++PDVVN+G I TF +  GKVAK A++AA +D+NS+P VLG
Sbjct  19   LVLLLSTSILCIGVFSEEASKPDVVNVGAIFTFGTINGKVAKVAMKAAENDINSDPSVLG  78

Query  357  GTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFA  536
            G KL +++ DSN S FLGI+ A++FME+D VAIIGPQ+SV+AHV+SHL NEL VPLLSF 
Sbjct  79   GRKLTISLHDSNYSSFLGIIGALQFMESDKVAIIGPQSSVMAHVLSHLVNELHVPLLSFT  138

Query  537  ATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            A DP+LS LQYPFFV+T+PNDLF M A+A +V Y+ W +V+A
Sbjct  139  ALDPSLSPLQYPFFVQTAPNDLFQMIAIAEMVSYFGWTDVIA  180



>ref|XP_006306244.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
 gb|EOA39142.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
Length=941

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  231  STRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLG  410
            S +P+VV IG I +F S IGKVAK A+E AV DVNSNP++L GTK +V+M +SN SGF+G
Sbjct  26   SGKPEVVKIGSIFSFNSAIGKVAKIAIEEAVKDVNSNPNILTGTKFSVSMQNSNCSGFMG  85

Query  411  IVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTS  590
            +VEA+RFME D V IIGPQ SV+AH+ISH+ANEL+VPLLSFA TDP +S LQ+P+F+RT+
Sbjct  86   MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  145

Query  591  PNDLFXMAAVASIVDYYXWREVVA  662
             +DL+ M A+ASIVD+Y W+EV+A
Sbjct  146  QSDLYQMDAIASIVDFYGWKEVIA  169



>ref|XP_008667836.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008667837.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008667838.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA36289.1| TPA: hypothetical protein ZEAMMB73_842396 [Zea mays]
Length=931

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 121/154 (79%), Gaps = 1/154 (1%)
 Frame = +3

Query  204  VCE-GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTM  380
            VC   +    S RP VVN+G + TF S IG+ AK A+ AAV+D+N +P VL GTKL V M
Sbjct  14   VCSCALGQNTSARPSVVNVGALFTFHSTIGRAAKVAIAAAVNDINRDPSVLQGTKLVVQM  73

Query  381  LDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSS  560
             D+N SGF+ IV+A++FME DT+AIIGPQ+SV+AHVISH+ANELQVPL+SFAATDPTL+ 
Sbjct  74   QDTNYSGFISIVQALQFMEKDTIAIIGPQSSVVAHVISHVANELQVPLMSFAATDPTLTP  133

Query  561  LQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQYPFFVRT  +D F MA+VA+IVDYY W+ V A
Sbjct  134  LQYPFFVRTVHSDQFQMASVAAIVDYYGWKMVTA  167



>gb|KDO71514.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=914

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            VV    F +G    GV    ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +
Sbjct  11   VVYNFCFSAGISMNGV----STIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAI  66

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGGTKL +T+ D+N S FLG+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLS
Sbjct  67   LGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLS  126

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FAATDP+LSSLQYPFFVRT+ +DL+ MAA+A IVDY+ WR V+A
Sbjct  127  FAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIA  170



>gb|KGN48998.1| hypothetical protein Csa_6G509670 [Cucumis sativus]
Length=890

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = +3

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NSNP ++GGTKL +++ D+N SGFLGI+E++RFMET T+AIIGPQ SV AHVISH+ANEL
Sbjct  18   NSNPSIMGGTKLKLSLHDTNYSGFLGIIESLRFMETKTMAIIGPQNSVTAHVISHIANEL  77

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPLLSF+ATDPTLSSLQ+PFF+RTS NDL+ MAAVA IVDY+ W+EV+A
Sbjct  78   QVPLLSFSATDPTLSSLQFPFFIRTSQNDLYQMAAVAEIVDYFQWKEVIA  127



>dbj|BAK04480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=920

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +3

Query  183  LTFYSGYVC-EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGG  359
            L F+  + C   ++  +  RPD V++G + TF S IG+ AK A+ AAV+D+N +  +L G
Sbjct  5    LHFWGLFCCLYALSKNIYARPDTVSVGALFTFNSTIGRAAKIAISAAVNDINKDSSILPG  64

Query  360  TKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAA  539
            T L V M DSN SGF+GIV+A++FME DTVAIIGPQ+SVIAHVISH+ANELQVP+LSF A
Sbjct  65   TNLVVEMQDSNCSGFVGIVQALQFMEKDTVAIIGPQSSVIAHVISHVANELQVPMLSFGA  124

Query  540  TDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            TDPTL+SLQ+PF VRT+ +D F MAAVA +VDYY W++V A
Sbjct  125  TDPTLTSLQFPFLVRTTRSDHFQMAAVADLVDYYGWKQVTA  165



>ref|XP_010550509.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Tarenaya hassleriana]
Length=889

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ +        +G     STRPDVVN+G + TF S IG+V K A+EAAV+DVNS+P 
Sbjct  3    WLLVVMVLCDAVAVQGA----STRPDVVNVGAVFTFGSVIGRVIKVAMEAAVEDVNSSPS  58

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L GT L + M D+   GF+ IVE +RFMETDTVAIIGPQ S  AHV++H+A EL +PLL
Sbjct  59   ILNGTHLKIIMHDTKFIGFMSIVETLRFMETDTVAIIGPQRSTTAHVVAHVATELSIPLL  118

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPT+S LQYPFF+RTS +DLF MAAVA IV YY WREV+A
Sbjct  119  SFTATDPTMSPLQYPFFIRTSLSDLFQMAAVADIVHYYGWREVIA  163



>ref|XP_010550505.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550506.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550507.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550508.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
Length=896

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 4/165 (2%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ +        +G     STRPDVVN+G + TF S IG+V K A+EAAV+DVNS+P 
Sbjct  3    WLLVVMVLCDAVAVQGA----STRPDVVNVGAVFTFGSVIGRVIKVAMEAAVEDVNSSPS  58

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L GT L + M D+   GF+ IVE +RFMETDTVAIIGPQ S  AHV++H+A EL +PLL
Sbjct  59   ILNGTHLKIIMHDTKFIGFMSIVETLRFMETDTVAIIGPQRSTTAHVVAHVATELSIPLL  118

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPT+S LQYPFF+RTS +DLF MAAVA IV YY WREV+A
Sbjct  119  SFTATDPTMSPLQYPFFIRTSLSDLFQMAAVADIVHYYGWREVIA  163



>ref|XP_006425260.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425266.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38500.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38506.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=623

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            +ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +LGGTKL +T+ D+N S FL
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLSFAATDP+LSSLQYPFFVRT
Sbjct  64   GMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRT  123

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +DL+ MAA+A IVDY+ WR V+A
Sbjct  124  TQSDLYQMAAIADIVDYFGWRNVIA  148



>ref|XP_006425259.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425262.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425264.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 ref|XP_006425265.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38499.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38502.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38504.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38505.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=611

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            +ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +LGGTKL +T+ D+N S FL
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLSFAATDP+LSSLQYPFFVRT
Sbjct  64   GMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRT  123

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +DL+ MAA+A IVDY+ WR V+A
Sbjct  124  TQSDLYQMAAIADIVDYFGWRNVIA  148



>ref|XP_006467097.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
Length=948

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            VV    F +G    GV    ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +
Sbjct  11   VVYNFCFSAGISMNGV----STIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAI  66

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGGTKL +T+ D+N S FLG+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLS
Sbjct  67   LGGTKLKLTVHDTNYSRFLGMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLS  126

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FAATDP+LSSLQYPFFVRT+ +DL+ MAA+A IVDY+ WR V+A
Sbjct  127  FAATDPSLSSLQYPFFVRTTQSDLYQMAAIADIVDYFGWRNVIA  170



>ref|XP_011041194.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041195.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041196.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041197.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041198.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041199.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041200.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
Length=933

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/154 (60%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +3

Query  201  YVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTM  380
            +   G +  +S+RP VVNIG + TF S IG+VAK A+E AV DVN+N  +L GT+L + M
Sbjct  17   FSTSGYSRNVSSRPAVVNIGAMFTFESTIGRVAKIAIEEAVKDVNANSSILHGTELKIHM  76

Query  381  LDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSS  560
              SN SGFLG+ EA++F E D +AIIGPQ+SV+AH+ISH+ANELQVPLLSFAATDPTL+S
Sbjct  77   RKSNCSGFLGLAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNS  136

Query  561  LQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQ+PFFVRT+ +D + MAA++ +VD+Y W++V A
Sbjct  137  LQFPFFVRTTHSDFYQMAAISEVVDHYGWKQVTA  170



>ref|XP_006425263.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38503.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=765

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            +ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +LGGTKL +T+ D+N S FL
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLSFAATDP+LSSLQYPFFVRT
Sbjct  64   GMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRT  123

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +DL+ MAA+A IVDY+ WR V+A
Sbjct  124  TQSDLYQMAAIADIVDYFGWRNVIA  148



>gb|KDO68418.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68419.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=549

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M  +W+V   +F  G   +G     + +P+V+N+G I +F +  G+V++ A++AA DD+N
Sbjct  1    MNLWWLVSIFSFCIGTAIQG-----ALKPEVLNVGAIFSFGTVNGQVSRIAMKAAQDDIN  55

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++TM D+  +GFL I+ A++FMETDT+AI+GPQ++V+AHV+SHLANELQ
Sbjct  56   SDPRVLGGRKLSITMHDAKFNGFLSIMGALQFMETDTLAIVGPQSAVMAHVLSHLANELQ  115

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF A DPTLS LQYPFFV+T+PNDL+ M+A+A +V Y+ W EV+A
Sbjct  116  VPLLSFTALDPTLSPLQYPFFVQTAPNDLYLMSAIAEMVSYFGWGEVIA  164



>ref|XP_004976611.1| PREDICTED: glutamate receptor 3.1-like [Setaria italica]
Length=926

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            +S  PDVVNIG + TF S IG+VAK A+ AAV+D+N++  VL GTKL V M D+NSSGF+
Sbjct  23   ISVGPDVVNIGALFTFDSIIGRVAKVAIAAAVNDINNDSRVLSGTKLVVQMQDTNSSGFI  82

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            GIV+A++FME DTVAIIGPQ+SV+AHVISH+ANELQVPL+SFAATDPTL+SLQYPFFVRT
Sbjct  83   GIVQALQFMEKDTVAIIGPQSSVVAHVISHVANELQVPLMSFAATDPTLTSLQYPFFVRT  142

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
              +D F MA+VA +V YY W+ V A
Sbjct  143  IHSDQFQMASVADLVYYYGWKMVTA  167



>ref|XP_007043076.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
 gb|EOX98907.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
Length=940

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  204  VCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTML  383
            +C GV S  +++PDVVN+G I TF +  GKVAK A++AA +D+NS+P VLGG KL +++ 
Sbjct  28   LCIGVFSEEASKPDVVNVGAIFTFGTINGKVAKVAMKAAENDINSDPSVLGGRKLTISLH  87

Query  384  DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSL  563
            DSN S FLGI+ A++FME+D VAIIGPQ+SV+AHV+SHL NEL VPLLSF A DP+LS L
Sbjct  88   DSNYSSFLGIIGALQFMESDKVAIIGPQSSVMAHVLSHLVNELHVPLLSFTALDPSLSPL  147

Query  564  QYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QYPFFV+T+PNDLF M A+A +V Y+ W +V+A
Sbjct  148  QYPFFVQTAPNDLFQMIAIAEMVSYFGWTDVIA  180



>ref|XP_006396004.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
 gb|ESQ33290.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
Length=937

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  231  STRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLG  410
            S +P VV IG I +F S IGKVAK A+  AV DVNSNPD+L GT L V+M +SN SGF+G
Sbjct  23   SGKPTVVKIGSIFSFDSVIGKVAKIAINEAVKDVNSNPDILRGTHLQVSMQNSNCSGFMG  82

Query  411  IVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTS  590
            +VEA+RFME D V IIGPQ SV+AH+ISH+AN+L+VPLLSFA TDP +S LQ+P+F+RTS
Sbjct  83   MVEALRFMEKDIVGIIGPQCSVVAHMISHMANQLRVPLLSFAVTDPVMSPLQFPYFIRTS  142

Query  591  PNDLFXMAAVASIVDYYXWREVVA  662
             +DL+ M A+ASIVD+Y W+EV+A
Sbjct  143  QSDLYQMDAIASIVDFYGWKEVIA  166



>ref|XP_010918356.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010918357.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=922

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            GV   +S+RP VVNIG +  F S IG+VAK A++AAVDDVNS+P VL GTKL + M DS+
Sbjct  19   GVGRNISSRPAVVNIGGLFAFNSTIGRVAKVAIDAAVDDVNSDPGVLQGTKLVIDMKDSS  78

Query  393  SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYP  572
             +GFLG VEA++FME + VA++GPQ+S+IAHVIS +AN LQVPLLSFAATDP LSSL+YP
Sbjct  79   CNGFLGTVEALQFMEKEIVAVVGPQSSMIAHVISCVANNLQVPLLSFAATDPALSSLEYP  138

Query  573  FFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            FFVRT+ NDLF MAA+A +VD+Y W+ ++A
Sbjct  139  FFVRTTQNDLFQMAAIAELVDFYQWKRLIA  168



>ref|XP_010270507.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=938

 Score =   179 bits (453),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  252  NIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRF  431
            NIG IL+F S IG+VAK A+EAA+DDVNSN  VL GTKL + M +SN SGF+GIVEA++F
Sbjct  40   NIGAILSFDSTIGRVAKIALEAAMDDVNSNSSVLHGTKLVIKMQNSNCSGFVGIVEALQF  99

Query  432  METDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXM  611
            MET+T+AIIGPQ+SVIA VIS +ANELQVP+LSFAATDPTLSSLQ+PFF+RT+ +DL+ M
Sbjct  100  METNTIAIIGPQSSVIAQVISQVANELQVPMLSFAATDPTLSSLQFPFFIRTTQSDLYQM  159

Query  612  AAVASIVDYYXWREVVA  662
            +AVA +VDYY WREVVA
Sbjct  160  SAVAEMVDYYGWREVVA  176



>ref|XP_007043075.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
 gb|EOX98906.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
Length=944

 Score =   179 bits (453),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  204  VCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTML  383
            +C GV S  +++PDVVN+G I TF +  GKVAK A++AA +D+NS+P VLGG KL +++ 
Sbjct  28   LCIGVFSEEASKPDVVNVGAIFTFGTINGKVAKVAMKAAENDINSDPSVLGGRKLTISLH  87

Query  384  DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSL  563
            DSN S FLGI+ A++FME+D VAIIGPQ+SV+AHV+SHL NEL VPLLSF A DP+LS L
Sbjct  88   DSNYSSFLGIIGALQFMESDKVAIIGPQSSVMAHVLSHLVNELHVPLLSFTALDPSLSPL  147

Query  564  QYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QYPFFV+T+PNDLF M A+A +V Y+ W +V+A
Sbjct  148  QYPFFVQTAPNDLFQMIAIAEMVSYFGWTDVIA  180



>ref|XP_002520606.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF41779.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=924

 Score =   178 bits (452),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 125/169 (74%), Gaps = 6/169 (4%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+V FL      VC    S  +  P V+N+G I TF +  GKVA+ A++AA DD+N
Sbjct  1    MNRVWLVSFL------VCISSLSHGAPNPGVINVGAIFTFNTINGKVARIAMKAAEDDIN  54

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P +LGG K + TM DSN SGFLGI+ A++FMETDTVAI+GPQ +V+AHV+SHLANEL 
Sbjct  55   SDPSILGGWKFSTTMHDSNFSGFLGIIGALQFMETDTVAILGPQNAVMAHVLSHLANELH  114

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF A DPTLS LQYP+FV+T+PNDLF M A+A +V YY W EV+A
Sbjct  115  VPLLSFTALDPTLSPLQYPYFVQTAPNDLFQMTAIAEMVSYYGWAEVIA  163



>ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
 ref|XP_009618636.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
Length=930

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = +3

Query  198  GYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVT  377
            G   +G+    ++RP VVN+G I TF S IG+VAK A++ AV DVNSN  +L GTKL V 
Sbjct  15   GAGSDGLTGKGTSRPAVVNVGGIFTFDSTIGRVAKIAIQEAVKDVNSNSSLLRGTKLIVK  74

Query  378  MLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLS  557
            + +SN SGFLG+V A++FMETD VA+IGPQ+SV+AH ISH+ANELQVP LSFAATDPTLS
Sbjct  75   LQNSNCSGFLGMVGALKFMETDVVAVIGPQSSVVAHTISHVANELQVPFLSFAATDPTLS  134

Query  558  SLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SLQ+P+F++T+ +DL+ M A A IV+YY W+EV+A
Sbjct  135  SLQFPYFLQTTQSDLYQMTATAEIVEYYGWKEVIA  169



>dbj|BAJ34460.1| unnamed protein product [Thellungiella halophila]
Length=500

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ L        +G+ + +S RP VVNIG + TF S IG+V K A+EAAV+DVN+NP 
Sbjct  3    WLLLLLIVCDAVPLQGLTTNVSARPQVVNIGSVFTFTSLIGRVIKVAMEAAVEDVNANPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VL  T+L + M D+  +GF+ I+E +RFME++TVAIIGPQ S  A V++H+A+EL++P+L
Sbjct  63   VLNNTQLRIIMHDTKFNGFMSIMEPLRFMESETVAIIGPQRSTSARVVAHVASELKIPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPT+S LQ+PFF+RTS NDL+ MAA+A IV +Y WREV+A
Sbjct  123  SFTATDPTMSPLQFPFFIRTSQNDLYQMAAIADIVHFYGWREVIA  167



>ref|XP_006422387.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 ref|XP_006422388.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35627.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35628.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|KDO68414.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68415.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68416.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68417.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=625

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M  +W+V   +F  G   +G     + +P+V+N+G I +F +  G+V++ A++AA DD+N
Sbjct  1    MNLWWLVSIFSFCIGTAIQG-----ALKPEVLNVGAIFSFGTVNGQVSRIAMKAAQDDIN  55

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++TM D+  +GFL I+ A++FMETDT+AI+GPQ++V+AHV+SHLANELQ
Sbjct  56   SDPRVLGGRKLSITMHDAKFNGFLSIMGALQFMETDTLAIVGPQSAVMAHVLSHLANELQ  115

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF A DPTLS LQYPFFV+T+PNDL+ M+A+A +V Y+ W EV+A
Sbjct  116  VPLLSFTALDPTLSPLQYPFFVQTAPNDLYLMSAIAEMVSYFGWGEVIA  164



>ref|XP_006425261.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38501.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=926

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            +ST P V+NIG +    S IGKVAK A+EAAV+DVNSNP +LGGTKL +T+ D+N S FL
Sbjct  4    VSTIPPVLNIGAVFALNSTIGKVAKVAIEAAVEDVNSNPAILGGTKLKLTVHDTNYSRFL  63

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G+VEA+  +E +TVAIIGPQ SVIAH++SH+ANE QVPLLSFAATDP+LSSLQYPFFVRT
Sbjct  64   GMVEALTLLENETVAIIGPQFSVIAHLVSHIANEFQVPLLSFAATDPSLSSLQYPFFVRT  123

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +DL+ MAA+A IVDY+ WR V+A
Sbjct  124  TQSDLYQMAAIADIVDYFGWRNVIA  148



>ref|XP_008235912.1| PREDICTED: glutamate receptor 3.2-like [Prunus mume]
Length=932

 Score =   178 bits (451),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 5/165 (3%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            WVV  L      +C   ++  ++RP  VN+G + T  +  G+V+K A+EAAV+DVNS+P 
Sbjct  5    WVVSILI-----ICIPGSTEGASRPAAVNVGAMCTLGTINGRVSKIAIEAAVNDVNSDPT  59

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +LGGTKL++T  DSN SGFLGI+ A++FME+DTVAIIGPQ +V+AHV+SHLANEL VPLL
Sbjct  60   ILGGTKLSITFHDSNFSGFLGIIGALKFMESDTVAIIGPQTAVMAHVLSHLANELHVPLL  119

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF A DPTLSSLQYP+FV+T+PNDLF MAA+A +V Y+ W EV A
Sbjct  120  SFTALDPTLSSLQYPYFVQTAPNDLFQMAAIADMVSYFGWTEVAA  164



>gb|KDP47011.1| hypothetical protein JCGZ_10738 [Jatropha curcas]
Length=914

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 124/165 (75%), Gaps = 6/165 (4%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W V FL      VC    S  +   DVVN+G I +F +  G+V+K A++AA DD+NS+P 
Sbjct  5    WFVFFL------VCIITFSHGARNSDVVNVGAIFSFSTINGRVSKIAMKAAEDDINSDPS  58

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +LGG KL++TM DSN SGFLGI+ A++FMETDTVAIIGPQ+SV+A ++SHLANEL VPLL
Sbjct  59   ILGGRKLSITMHDSNYSGFLGIIGALQFMETDTVAIIGPQSSVMARILSHLANELHVPLL  118

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF A DPTLS LQYP+F++T+PNDLF M A+A  V YY W EV+A
Sbjct  119  SFTALDPTLSPLQYPYFLQTAPNDLFQMTAIAETVSYYGWAEVIA  163



>gb|KDO68413.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=772

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M  +W+V   +F  G   +G     + +P+V+N+G I +F +  G+V++ A++AA DD+N
Sbjct  1    MNLWWLVSIFSFCIGTAIQG-----ALKPEVLNVGAIFSFGTVNGQVSRIAMKAAQDDIN  55

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++TM D+  +GFL I+ A++FMETDT+AI+GPQ++V+AHV+SHLANELQ
Sbjct  56   SDPRVLGGRKLSITMHDAKFNGFLSIMGALQFMETDTLAIVGPQSAVMAHVLSHLANELQ  115

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF A DPTLS LQYPFFV+T+PNDL+ M+A+A +V Y+ W EV+A
Sbjct  116  VPLLSFTALDPTLSPLQYPFFVQTAPNDLYLMSAIAEMVSYFGWGEVIA  164



>ref|XP_008241922.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
 ref|XP_008241923.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=924

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 129/171 (75%), Gaps = 3/171 (2%)
 Frame = +3

Query  159  KGFWVVMFLTFYSGYVCEG--VNSTLST-RPDVVNIGCILTFISPIGkvakaaveaavdd  329
            K   +++F+ FY+G    G  V +T++T RPDVVNI  I TF S IGK+AK A+  AV+D
Sbjct  3    KALLLMLFMVFYNGASSNGLGVGATVTTARPDVVNIAAIFTFDSVIGKIAKVAIALAVED  62

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            VNS+P++L G KL + M ++ SS FLGI+EA+ F+E DTVAIIGPQ S  AHVISH+A+E
Sbjct  63   VNSDPEILNGKKLTLKMQNTKSSDFLGIIEALLFLENDTVAIIGPQFSATAHVISHIADE  122

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             +VPLLSFAATDPTLS  Q+PF VRT+ +DLF M AVA +V YY WR+V+A
Sbjct  123  PKVPLLSFAATDPTLSPTQFPFLVRTTRSDLFQMTAVADLVFYYEWRDVIA  173



>ref|XP_007203978.1| hypothetical protein PRUPE_ppa025247mg, partial [Prunus persica]
 gb|EMJ05177.1| hypothetical protein PRUPE_ppa025247mg, partial [Prunus persica]
Length=813

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 3/163 (2%)
 Frame = +3

Query  183  LTFYSGYVCEGVN---STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVL  353
            + FY+G    G+    +  + RP+VVNIG I TF S IGK+AK A+  AV+DVNS+P+ L
Sbjct  1    MVFYNGASSNGIGVGATATTARPEVVNIGAIFTFDSVIGKIAKLAIALAVEDVNSDPENL  60

Query  354  GGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSF  533
             GTKL + M ++ SS FLGI+EA++F+E DTVAIIGPQ S  AHVISH+A+EL+VPLLSF
Sbjct  61   NGTKLTLKMQNTKSSDFLGIIEALQFLENDTVAIIGPQFSATAHVISHIADELKVPLLSF  120

Query  534  AATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            AATDPTLS  Q+PF VRT+ +DLF M AVA +V YY WR+V+A
Sbjct  121  AATDPTLSPTQFPFLVRTTRSDLFQMTAVADLVFYYEWRDVIA  163



>ref|XP_007200076.1| hypothetical protein PRUPE_ppa021130mg, partial [Prunus persica]
 gb|EMJ01275.1| hypothetical protein PRUPE_ppa021130mg, partial [Prunus persica]
Length=897

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 5/165 (3%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            WVV  L      +C   ++  ++RP  VN+G + T  +  G+V+K A+EAAV+DVNS+P 
Sbjct  5    WVVSILI-----ICIPGSTEGASRPAAVNVGAMCTVGTINGRVSKIAIEAAVNDVNSDPT  59

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +LGGTKL++T  DSN SGFLGI+ A++FME+DTVAIIGPQ +V+AHV+SHLANEL VPLL
Sbjct  60   ILGGTKLSITFHDSNFSGFLGIIGALKFMESDTVAIIGPQTAVMAHVLSHLANELHVPLL  119

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF A DPTLSSLQYP+FV+T+PNDLF MAA+A +V Y+ W EV A
Sbjct  120  SFTALDPTLSSLQYPYFVQTAPNDLFQMAAIADMVSYFGWTEVAA  164



>ref|XP_003527293.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006581132.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006581133.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
Length=929

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  231  STRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLG  410
            S+RP VV+IG I    S +GKVAK  +E AV DVN++  +L GT+L +TM +SN SGF+G
Sbjct  30   SSRPAVVHIGAIFNIDSVLGKVAKITLEEAVKDVNADKTILHGTQLVLTMQNSNHSGFIG  89

Query  411  IVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTS  590
            +V+A+RFMETD +AIIGPQ+SV AH+ISH+ANEL+VPL+SFAATDPTLSSLQ+PFFVRT+
Sbjct  90   MVQALRFMETDVIAIIGPQSSVTAHIISHVANELRVPLVSFAATDPTLSSLQFPFFVRTT  149

Query  591  PNDLFXMAAVASIVDYYXWREVVA  662
             +DL+ M AVA I+DYY W+EV+A
Sbjct  150  QSDLYQMKAVAEIIDYYGWKEVIA  173



>ref|XP_006577929.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
Length=925

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 132/178 (74%), Gaps = 14/178 (8%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTL---------STRPDVVNIGCILTFISPIGkvakaa  308
            M  FWVV ++       C GV+S           S+RP  V+IG I +  S +GKVAK  
Sbjct  1    MNLFWVVCWVV-----SCLGVSSVTPFVAAANLSSSRPAFVHIGAIFSMDSVLGKVAKIT  55

Query  309  veaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHV  488
            +E AV DVN++  +L GT+L ++M +SN SGF+G+V+A+RFMETD +AIIGPQ+SV AH+
Sbjct  56   LEEAVKDVNADKTILHGTQLVLSMQNSNHSGFVGMVQALRFMETDVIAIIGPQSSVTAHI  115

Query  489  ISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ISH+ANEL+VPL+SFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+DYY W+EV+A
Sbjct  116  ISHVANELRVPLVSFAATDPTLSSLQFPFFVRTTQSDLYQMKAVAEIIDYYGWKEVIA  173



>ref|XP_004500848.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Cicer arietinum]
Length=935

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  234  TRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGI  413
            +RP  VNIG I TF S IGKVAK A+E AV D+NSN ++L GT+L + M  SN SGF G+
Sbjct  40   SRPTFVNIGAIFTFDSSIGKVAKLAMEEAVKDINSNSNILHGTQLRLHMQTSNCSGFDGM  99

Query  414  VEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSP  593
            ++A+RFMETD +AI+GPQ+SV++H++SH+ANEL+VP+LSFAATDPTLSSLQ+PFFVRT+ 
Sbjct  100  IQALRFMETDVIAILGPQSSVVSHIVSHVANELRVPMLSFAATDPTLSSLQFPFFVRTTL  159

Query  594  NDLFXMAAVASIVDYYXWREVVA  662
            +DL+ M AVA I+D+Y W+EV+A
Sbjct  160  SDLYQMTAVAEIIDFYGWKEVIA  182



>gb|KDO68407.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=953

 Score =   177 bits (448),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 132/171 (77%), Gaps = 5/171 (3%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavdd  329
            + M  +W+V   +F  G   +G     + +P+V+N+G I +F +  G+V++ A++AA DD
Sbjct  22   ITMNLWWLVSIFSFCIGTAIQG-----ALKPEVLNVGAIFSFGTVNGQVSRIAMKAAQDD  76

Query  330  vNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANE  509
            +NS+P VLGG KL++TM D+  +GFL I+ A++FMETDT+AI+GPQ++V+AHV+SHLANE
Sbjct  77   INSDPRVLGGRKLSITMHDAKFNGFLSIMGALQFMETDTLAIVGPQSAVMAHVLSHLANE  136

Query  510  LQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LQVPLLSF A DPTLS LQYPFFV+T+PNDL+ M+A+A +V Y+ W EV+A
Sbjct  137  LQVPLLSFTALDPTLSPLQYPFFVQTAPNDLYLMSAIAEMVSYFGWGEVIA  187



>ref|XP_004512282.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=915

 Score =   176 bits (447),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W++  +  Y+G+         STRP VVNIG + +F + +G++ K A+EAAV DVN
Sbjct  1    MVKIWLLALMILYNGFSSTEAGIHNSTRPAVVNIGALFSFNTSVGRIIKIAIEAAVKDVN  60

Query  336  SNPDVLGGTKLNVTML-DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            S+P++LG TKL +++  DS   GFL I E ++ M +DTVAIIGP +SV AHVI+H+ANEL
Sbjct  61   SDPNILGETKLKLSLQEDSKYRGFLSIAEVLQVMSSDTVAIIGPHSSVTAHVITHIANEL  120

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPLLSF+A DPTLSSLQ+PFF+RT  +DLF MAA+A +VDYY W+EV+A
Sbjct  121  QVPLLSFSALDPTLSSLQFPFFIRTCHSDLFQMAAIADLVDYYGWKEVIA  170



>ref|XP_006486565.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006486566.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Citrus sinensis]
Length=930

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M  +W+V   +F  G   +G     + +P+V+N+G I +F +  G+V++ A++AA DD+N
Sbjct  1    MNLWWLVSIFSFCIGTAIQG-----ALKPEVLNVGAIFSFGTVNGQVSRIAMKAAQDDIN  55

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++TM D+  +GFL I+ A++FMETDT+AI+GPQ++V+AHV+SHLANELQ
Sbjct  56   SDPRVLGGRKLSITMHDAKFNGFLSIMGALQFMETDTLAIVGPQSAVMAHVLSHLANELQ  115

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF A DPTLS LQYPFFV+T+PNDL+ M+A+A +V Y+ W EV+A
Sbjct  116  VPLLSFTALDPTLSPLQYPFFVQTAPNDLYLMSAIAEMVSYFGWGEVIA  164



>ref|XP_006422390.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 ref|XP_006422391.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35630.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35631.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|KDO68408.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68409.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68410.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68411.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=930

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M  +W+V   +F  G   +G     + +P+V+N+G I +F +  G+V++ A++AA DD+N
Sbjct  1    MNLWWLVSIFSFCIGTAIQG-----ALKPEVLNVGAIFSFGTVNGQVSRIAMKAAQDDIN  55

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++TM D+  +GFL I+ A++FMETDT+AI+GPQ++V+AHV+SHLANELQ
Sbjct  56   SDPRVLGGRKLSITMHDAKFNGFLSIMGALQFMETDTLAIVGPQSAVMAHVLSHLANELQ  115

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPLLSF A DPTLS LQYPFFV+T+PNDL+ M+A+A +V Y+ W EV+A
Sbjct  116  VPLLSFTALDPTLSPLQYPFFVQTAPNDLYLMSAIAEMVSYFGWGEVIA  164



>ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF52890.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=927

 Score =   176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  234  TRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGI  413
            +RP VV+IG I T  S IG+VAK A+E AV DVN+N  +L GT+L + + +SN SGF G+
Sbjct  27   SRPAVVSIGAIFTLDSTIGRVAKVAIEEAVKDVNANSSILHGTRLALHIQNSNCSGFSGM  86

Query  414  VEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSP  593
            VEA+RFMETD VAI+GPQ+SV+AH ISH+ NELQVPLLSFAATDPTL+SLQ+PFFVRT+ 
Sbjct  87   VEALRFMETDVVAILGPQSSVVAHTISHVVNELQVPLLSFAATDPTLTSLQFPFFVRTTQ  146

Query  594  NDLFXMAAVASIVDYYXWREVVA  662
            +DL+ MAA+A IVD+Y W++V+A
Sbjct  147  SDLYQMAAIAEIVDHYSWKQVIA  169



>ref|XP_010267713.1| PREDICTED: glutamate receptor 3.5-like isoform X4 [Nelumbo nucifera]
Length=854

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  219  NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSS  398
             ST ST P VVNIG +LT  S IGKV+  A+ AAVDDVNS+P +LG TKL V+M D+N S
Sbjct  74   RSTTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCS  133

Query  399  GFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFF  578
            GFLG +EA++ +E D VAIIGPQ+SV+AHVI+H+ANEL VPLLSFAATDPTLS+LQYP+F
Sbjct  134  GFLGTIEALQLLEKDMVAIIGPQSSVVAHVITHVANELHVPLLSFAATDPTLSALQYPYF  193

Query  579  VRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +RT+ +DLF M A+   +D+  WREV+A
Sbjct  194  LRTTHSDLFQMQAIVDFIDFNGWREVIA  221



>ref|XP_004512281.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
Length=943

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W++  +  Y+G+         STRP VVNIG + +F + +G++ K A+EAAV DVN
Sbjct  1    MVKIWLLALMILYNGFSSTEAGIHNSTRPAVVNIGALFSFNTSVGRIIKIAIEAAVKDVN  60

Query  336  SNPDVLGGTKLNVTML-DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            S+P++LG TKL +++  DS   GFL I E ++ M +DTVAIIGP +SV AHVI+H+ANEL
Sbjct  61   SDPNILGETKLKLSLQEDSKYRGFLSIAEVLQVMSSDTVAIIGPHSSVTAHVITHIANEL  120

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPLLSF+A DPTLSSLQ+PFF+RT  +DLF MAA+A +VDYY W+EV+A
Sbjct  121  QVPLLSFSALDPTLSSLQFPFFIRTCHSDLFQMAAIADLVDYYGWKEVIA  170



>ref|XP_010267711.1| PREDICTED: glutamate receptor 3.5-like isoform X3 [Nelumbo nucifera]
 ref|XP_010267712.1| PREDICTED: glutamate receptor 3.5-like isoform X3 [Nelumbo nucifera]
Length=939

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  219  NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSS  398
             ST ST P VVNIG +LT  S IGKV+  A+ AAVDDVNS+P +LG TKL V+M D+N S
Sbjct  36   RSTTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCS  95

Query  399  GFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFF  578
            GFLG +EA++ +E D VAIIGPQ+SV+AHVI+H+ANEL VPLLSFAATDPTLS+LQYP+F
Sbjct  96   GFLGTIEALQLLEKDMVAIIGPQSSVVAHVITHVANELHVPLLSFAATDPTLSALQYPYF  155

Query  579  VRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +RT+ +DLF M A+   +D+  WREV+A
Sbjct  156  LRTTHSDLFQMQAIVDFIDFNGWREVIA  183



>ref|XP_010267710.1| PREDICTED: glutamate receptor 3.5-like isoform X2 [Nelumbo nucifera]
Length=942

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  219  NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSS  398
             ST ST P VVNIG +LT  S IGKV+  A+ AAVDDVNS+P +LG TKL V+M D+N S
Sbjct  74   RSTTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCS  133

Query  399  GFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFF  578
            GFLG +EA++ +E D VAIIGPQ+SV+AHVI+H+ANEL VPLLSFAATDPTLS+LQYP+F
Sbjct  134  GFLGTIEALQLLEKDMVAIIGPQSSVVAHVITHVANELHVPLLSFAATDPTLSALQYPYF  193

Query  579  VRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +RT+ +DLF M A+   +D+  WREV+A
Sbjct  194  LRTTHSDLFQMQAIVDFIDFNGWREVIA  221



>ref|XP_010267709.1| PREDICTED: glutamate receptor 3.5-like isoform X1 [Nelumbo nucifera]
Length=977

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +3

Query  219  NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSS  398
             ST ST P VVNIG +LT  S IGKV+  A+ AAVDDVNS+P +LG TKL V+M D+N S
Sbjct  74   RSTTSTVPSVVNIGTLLTVDSIIGKVSMPAISAAVDDVNSDPTILGRTKLRVSMQDTNCS  133

Query  399  GFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFF  578
            GFLG +EA++ +E D VAIIGPQ+SV+AHVI+H+ANEL VPLLSFAATDPTLS+LQYP+F
Sbjct  134  GFLGTIEALQLLEKDMVAIIGPQSSVVAHVITHVANELHVPLLSFAATDPTLSALQYPYF  193

Query  579  VRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +RT+ +DLF M A+   +D+  WREV+A
Sbjct  194  LRTTHSDLFQMQAIVDFIDFNGWREVIA  221



>ref|XP_010923978.1| PREDICTED: glutamate receptor 3.5-like [Elaeis guineensis]
Length=661

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = +3

Query  198  GYVCEGVNST-LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNV  374
            G    G N T + ++P VVNIG + TF S IG+VAK A++ AV DVNSN ++L GT LN+
Sbjct  17   GAAAAGQNRTGVPSKPSVVNIGALFTFNSTIGRVAKLAIQLAVQDVNSNRNLLAGTMLNI  76

Query  375  TMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTL  554
               D+N SGFLGI++A++ ME D VA+IGPQ+S IAH ISH+ NEL VPLLSFAATDPTL
Sbjct  77   IPRDTNCSGFLGIIQALQLMENDVVAVIGPQSSGIAHAISHVGNELHVPLLSFAATDPTL  136

Query  555  SSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +SLQYP+F+RT+ ND F M A+A ++ YY WREV+A
Sbjct  137  TSLQYPYFLRTAQNDYFQMNAIADMIGYYGWREVIA  172



>gb|EMT00479.1| Glutamate receptor 3.1 [Aegilops tauschii]
Length=1357

 Score =   177 bits (449),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RPD V++G + TF S IG+ AK A+ AAV+++N++  +L GT L V M DSN SGF+GIV
Sbjct  496  RPDAVSVGALFTFNSTIGRAAKIAISAAVNEINNDSSILPGTNLVVEMQDSNCSGFVGIV  555

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
            +A++FME DTVAIIGPQ+SVIAHV+SH+ANELQVP+LSF ATDPTL+SLQ+PF VRT+ +
Sbjct  556  QALQFMEKDTVAIIGPQSSVIAHVVSHVANELQVPMLSFGATDPTLTSLQFPFLVRTTRS  615

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            D F MAAVA +VDYY W++V A
Sbjct  616  DHFQMAAVADLVDYYEWKQVTA  637



>ref|XP_006403911.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
 gb|ESQ45364.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
Length=896

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 125/165 (76%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ L        +G+ + +S RP VVNIG + TF S IG+V K A+EAAV+DVN+NP 
Sbjct  3    WLLLLLIVCDAVPLQGLTTNVSARPQVVNIGSVFTFTSLIGRVIKVAMEAAVEDVNANPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VL  T+L + M D+  +GF+ I+E +RFME++TVAIIGPQ S  A V++H+A+EL++P+L
Sbjct  63   VLNNTQLRIIMHDTKFNGFMSIMEPLRFMESETVAIIGPQRSTSARVVAHVASELKIPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPT+S LQ+PFF+RTS NDL+ MAA+A IV +Y WREV+A
Sbjct  123  SFTATDPTMSPLQFPFFIRTSQNDLYQMAAIADIVHFYGWREVIA  167



>emb|CAN72607.1| hypothetical protein VITISV_021339 [Vitis vinifera]
Length=916

 Score =   174 bits (442),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +3

Query  246  VVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAM  425
            +VN+G + TF S IG+VAK A+E AV DVNS+  VL GTK  +TM +SN SGF+G++ A+
Sbjct  13   IVNVGAVFTFESTIGRVAKIAIEEAVKDVNSDAGVLTGTKFVLTMRNSNCSGFIGMIGAL  72

Query  426  RFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLF  605
            +FMET+T+AIIGPQ+SV+AH+ISH+ANELQVPLLSFAATDPTLSSLQ+PFFVRT+ +DL+
Sbjct  73   QFMETETIAIIGPQSSVVAHMISHVANELQVPLLSFAATDPTLSSLQFPFFVRTTQSDLY  132

Query  606  XMAAVASIVDYYXWREVVA  662
             M A+  +VDYY WR V+A
Sbjct  133  QMKAITELVDYYGWRSVIA  151



>ref|XP_002313575.2| Glutamate receptor 3.1 precursor family protein [Populus trichocarpa]
 gb|EEE87530.2| Glutamate receptor 3.1 precursor family protein [Populus trichocarpa]
Length=900

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 122/166 (73%), Gaps = 9/166 (5%)
 Frame = +3

Query  165  FWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            FW++   +F  G +  G           VN+G I TF S  G+VAK A+EAA DD+NS+P
Sbjct  9    FWILCTSSFSQGALSPG---------GTVNVGAIFTFSSINGRVAKIAMEAAEDDINSDP  59

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             +LGG KL++ M DSN SGFLGI+ A++F+ETDTVA+IGPQ +V+AHV+SHLANELQVP 
Sbjct  60   SLLGGRKLSINMHDSNFSGFLGIIGALQFLETDTVAVIGPQTAVMAHVLSHLANELQVPF  119

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LSF A DPTLS LQ+P+F++T+PNDLF M A+A IV YY W EV A
Sbjct  120  LSFTALDPTLSPLQFPYFIQTAPNDLFQMTAIADIVSYYGWSEVTA  165



>emb|CBI37733.3| unnamed protein product [Vitis vinifera]
Length=1147

 Score =   175 bits (443),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  240  PDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVE  419
            P+VVNIG I TF +  GKVAK A++AA  DVNS+P +LGG KL +T+ DSN SGFL IV 
Sbjct  254  PEVVNIGAIFTFSTINGKVAKIAMKAAEQDVNSDPSILGGRKLAITLHDSNYSGFLSIVG  313

Query  420  AMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPND  599
            A++FME+DTVAIIGPQ++V+AHV+SHLANEL VPLLSF A DP LS LQ+P+F++T+P+D
Sbjct  314  ALQFMESDTVAIIGPQSAVMAHVLSHLANELHVPLLSFTALDPALSPLQFPYFIQTAPSD  373

Query  600  LFXMAAVASIVDYYXWREVVA  662
            LF M A+A +V Y+ WREV+A
Sbjct  374  LFQMTAIADMVSYFEWREVIA  394



>gb|KEH36347.1| glutamate receptor 3.2 [Medicago truncatula]
Length=708

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaavea  317
            + +++    +W+ +   F   Y+ E V S  ++RP  VNIG I TF S IGKVAK A+E 
Sbjct  42   ITLDMNFYYYWLWLVFLFMLPYL-EQVYS--NSRPSFVNIGAIFTFDSSIGKVAKLAMEQ  98

Query  318  avddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISH  497
            AV DVNSN  +L  T+L + M  SN SGF G+++A+RFMETD +AI+GPQ+SV++H+++H
Sbjct  99   AVKDVNSNSSILHSTQLVLHMQTSNCSGFDGMIQALRFMETDVIAILGPQSSVVSHIVAH  158

Query  498  LANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            +ANEL+VP+LSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+
Sbjct  159  VANELRVPMLSFAATDPTLSSLQFPFFVRTTLSDLYQMTAVAEIIDFYGWKEVI  212



>ref|XP_002279899.1| PREDICTED: glutamate receptor 3.2 [Vitis vinifera]
Length=917

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  240  PDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVE  419
            P+VVNIG I TF +  GKVAK A++AA  DVNS+P +LGG KL +T+ DSN SGFL IV 
Sbjct  24   PEVVNIGAIFTFSTINGKVAKIAMKAAEQDVNSDPSILGGRKLAITLHDSNYSGFLSIVG  83

Query  420  AMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPND  599
            A++FME+DTVAIIGPQ++V+AHV+SHLANEL VPLLSF A DP LS LQ+P+F++T+P+D
Sbjct  84   ALQFMESDTVAIIGPQSAVMAHVLSHLANELHVPLLSFTALDPALSPLQFPYFIQTAPSD  143

Query  600  LFXMAAVASIVDYYXWREVVA  662
            LF M A+A +V Y+ WREV+A
Sbjct  144  LFQMTAIADMVSYFEWREVIA  164



>ref|XP_010530328.1| PREDICTED: glutamate receptor 3.3 [Tarenaya hassleriana]
Length=962

 Score =   174 bits (441),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +3

Query  210  EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDS  389
            +G +  +S RP  V IG I +F S IGKVAK A++ AV DVNSNPD+L GT+ +V+M +S
Sbjct  20   KGYSRNVSVRPAAVKIGSIFSFDSVIGKVAKIAIDEAVKDVNSNPDILDGTQFDVSMHNS  79

Query  390  NSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQY  569
            N SGFLG+VEA+R ME D VAI+GPQ SV+AH+I ++ANEL VPLLSF  TDP +S LQ+
Sbjct  80   NCSGFLGMVEALRLMEKDIVAIVGPQCSVVAHMIGYVANELHVPLLSFGVTDPVMSPLQF  139

Query  570  PFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            P+FVRT+ +D + M AVAS+VDYY W+EV+A
Sbjct  140  PYFVRTAQSDSYQMEAVASVVDYYGWKEVIA  170



>emb|CDP07274.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  231  STRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLG  410
            STRP VVN+G I +F S IG+VAK A++ AV DVNSN  +L GTKL V M  SN SGF+G
Sbjct  30   STRPAVVNVGAIFSFDSTIGRVAKIAIQEAVKDVNSNSTLLPGTKLVVKMRTSNCSGFVG  89

Query  411  IVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTS  590
            +V A++ MET+TVA+IGPQ+SV+AH ISH+ANELQVPLLSFAATDPTLSSLQ+P+FVRT+
Sbjct  90   MVGALQLMETETVAVIGPQSSVVAHTISHVANELQVPLLSFAATDPTLSSLQFPYFVRTT  149

Query  591  PNDLFXMAAVASIVDYYXWREVV  659
             +D + M A+A +VDYY W++V+
Sbjct  150  RSDSYQMTAIAEMVDYYGWKDVI  172



>ref|XP_008452999.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Cucumis melo]
Length=918

 Score =   173 bits (438),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 123/169 (73%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W V  L+   G    G    +S+RP VVNIG IL++ S IGKVA  A++ AV DVN
Sbjct  1    MSFLWFVSLLSLVCGTFPLGFGKNISSRPSVVNIGAILSYNSTIGKVATIAIKEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            ++P +L GT L +   +SN SGFLG+VE ++ ME +TVAIIGPQ+SV+AH+ S +A E Q
Sbjct  61   ADPSILPGTNLWLQTQNSNCSGFLGMVEVLQLMENETVAIIGPQSSVVAHISSQVATEFQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPL+SF+ATDPTLS+LQ+PFFVR + +DLF M AVA IV++Y W+EV+A
Sbjct  121  VPLVSFSATDPTLSALQFPFFVRAAQSDLFQMTAVAEIVEFYKWKEVIA  169



>gb|KEH36348.1| glutamate receptor 3.2 [Medicago truncatula]
Length=663

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  165  FWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            +W+ +   F   Y+ E V S  ++RP  VNIG I TF S IGKVAK A+E AV DVNSN 
Sbjct  6    YWLWLVFLFMLPYL-EQVYS--NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNS  62

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             +L  T+L + M  SN SGF G+++A+RFMETD +AI+GPQ+SV++H+++H+ANEL+VP+
Sbjct  63   SILHSTQLVLHMQTSNCSGFDGMIQALRFMETDVIAILGPQSSVVSHIVAHVANELRVPM  122

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            LSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+
Sbjct  123  LSFAATDPTLSSLQFPFFVRTTLSDLYQMTAVAEIIDFYGWKEVI  167



>gb|KDP43780.1| hypothetical protein JCGZ_22407 [Jatropha curcas]
Length=919

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +3

Query  183  LTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGT  362
            + FY+G+    V+S    RP+VVNIG +L F S IGKVAK A+E AV+DVN +P VLGGT
Sbjct  1    MVFYNGF-SSNVSSNFDARPNVVNIGALLNFNSTIGKVAKVAIETAVEDVNRDPSVLGGT  59

Query  363  KLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAAT  542
            KL V +  ++ SG+L  +EA+  + ++ VAI+GPQ S  AHVISH+A+ELQVPLLSFAAT
Sbjct  60   KLQV-ICRTDYSGYLDTLEALSLIGSEVVAILGPQFSTTAHVISHIADELQVPLLSFAAT  118

Query  543  DPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            DPTLSSLQYPFFVRT+ +D+F MAA+A I+DYY WR VVA
Sbjct  119  DPTLSSLQYPFFVRTTQSDIFQMAAIADIIDYYGWRTVVA  158



>gb|KJB50477.1| hypothetical protein B456_008G173300 [Gossypium raimondii]
Length=654

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ A  A++AAVDDVNS+P 
Sbjct  22   FLCFPPGVVCDTGNVSASSNSSSKPKVINIGALFTLNSVLGEAANRAIQAAVDDVNSDPT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D V  IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVVAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>ref|XP_004145549.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 ref|XP_004157067.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 gb|KGN55521.1| hypothetical protein Csa_4G664290 [Cucumis sativus]
Length=918

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 122/169 (72%), Gaps = 0/169 (0%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W V  L+   G    G    +S+RP VVNIG IL+  S IG+VA  A+E AV DVN
Sbjct  1    MSFLWFVSLLSLVCGTFPLGFGKNVSSRPSVVNIGAILSHNSTIGRVATIAIEEAVKDVN  60

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            ++P +L GT L + M +SN SGFLG+VE ++ ME  TVAIIGPQ+SV+AH+ S +A E Q
Sbjct  61   ADPSILPGTNLWLQMQNSNCSGFLGMVEVLQLMENKTVAIIGPQSSVVAHISSQVATEFQ  120

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VPL+SF+ATDPTLS+LQ+PFFVR + +DLF M AVA IV++Y W+EV+A
Sbjct  121  VPLVSFSATDPTLSALQFPFFVRAAQSDLFQMTAVAEIVEHYLWKEVIA  169



>ref|XP_008242065.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=867

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 130/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            +++F+ F++      +++ ++ RPDVVNIG I+TF S IGK+AK A+  A++DVNS+P++
Sbjct  6    LLLFMVFHNASSSSALSTNVAARPDVVNIGAIITFDSIIGKIAKLAIAIAIEDVNSDPEI  65

Query  351  LGGTKLNVTMLDSNSSGFLGIVE-AMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            L GTKL + M ++ S+ FLGIV+ A++FME DTVAIIGPQ S  A ++SH+AN+L+VPLL
Sbjct  66   LNGTKLTLKMQNTGSNDFLGIVDLALQFMENDTVAIIGPQFSATARMLSHIANDLKVPLL  125

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPTLS +Q+PF VRT+ +DLF M AVA +V +Y WREV+A
Sbjct  126  SFSATDPTLSPVQFPFLVRTTRSDLFQMTAVADLVAFYEWREVIA  170



>ref|XP_010270514.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Nelumbo nucifera]
Length=765

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  234  TRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGI  413
            +RP  VNIG I TF +  GKVA+ A++AAVDDVNS+  +LGG+KL +T  DSN SG  GI
Sbjct  22   SRPASVNIGAIFTFDTINGKVARIAMKAAVDDVNSDLSILGGSKLALTFHDSNYSGLFGI  81

Query  414  VEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSP  593
            + A+++ME DTVAIIGPQ  V+AHV+SHLANELQVPLLSF A DPTLS+LQYPFF++T+P
Sbjct  82   IGALQYMEADTVAIIGPQHPVMAHVLSHLANELQVPLLSFTALDPTLSALQYPFFLQTAP  141

Query  594  NDLFXMAAVASIVDYYXWREVVA  662
            NDLF M+A+A +V YY WR+V+A
Sbjct  142  NDLFLMSAIADMVSYYGWRDVIA  164



>gb|KEH36349.1| glutamate receptor 3.2 [Medicago truncatula]
Length=781

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  165  FWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            +W+ +   F   Y+ E V S  ++RP  VNIG I TF S IGKVAK A+E AV DVNSN 
Sbjct  6    YWLWLVFLFMLPYL-EQVYS--NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNS  62

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             +L  T+L + M  SN SGF G+++A+RFMETD +AI+GPQ+SV++H+++H+ANEL+VP+
Sbjct  63   SILHSTQLVLHMQTSNCSGFDGMIQALRFMETDVIAILGPQSSVVSHIVAHVANELRVPM  122

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            LSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+
Sbjct  123  LSFAATDPTLSSLQFPFFVRTTLSDLYQMTAVAEIIDFYGWKEVI  167



>gb|KEH36346.1| glutamate receptor 3.2 [Medicago truncatula]
Length=959

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = +3

Query  138  LVIELKMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaavea  317
            + +++    +W+ +   F   Y+ E V S  ++RP  VNIG I TF S IGKVAK A+E 
Sbjct  42   ITLDMNFYYYWLWLVFLFMLPYL-EQVYS--NSRPSFVNIGAIFTFDSSIGKVAKLAMEQ  98

Query  318  avddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISH  497
            AV DVNSN  +L  T+L + M  SN SGF G+++A+RFMETD +AI+GPQ+SV++H+++H
Sbjct  99   AVKDVNSNSSILHSTQLVLHMQTSNCSGFDGMIQALRFMETDVIAILGPQSSVVSHIVAH  158

Query  498  LANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            +ANEL+VP+LSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+
Sbjct  159  VANELRVPMLSFAATDPTLSSLQFPFFVRTTLSDLYQMTAVAEIIDFYGWKEVI  212



>gb|KJB50478.1| hypothetical protein B456_008G173300 [Gossypium raimondii]
Length=807

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ A  A++AAVDDVNS+P 
Sbjct  22   FLCFPPGVVCDTGNVSASSNSSSKPKVINIGALFTLNSVLGEAANRAIQAAVDDVNSDPT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D V  IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVVAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>gb|KEH27628.1| glutamate receptor 3.2 [Medicago truncatula]
Length=951

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W++  +  Y+G+      +  STRPD+VNIG + +F + +GK+ K A+EAAV+DVN
Sbjct  1    MVKVWLLALMILYNGFSSTVAGTHNSTRPDIVNIGALFSFNTSVGKIIKIALEAAVNDVN  60

Query  336  SNPDVLGGTKLNVTML-DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            S+P++LG TKL +++  DS   GFL I E ++ M    VAIIGP +SV AHVI+H+ANEL
Sbjct  61   SDPNILGETKLKLSLQEDSKYRGFLSIAEVLQVMARHNVAIIGPHSSVTAHVITHIANEL  120

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPL+SF+A DPTLSSLQ+PFF+RT  +DL+ MAA+A +VDYY W+EV+A
Sbjct  121  QVPLISFSALDPTLSSLQFPFFIRTCHSDLYQMAAIADLVDYYGWKEVIA  170



>gb|KJB50474.1| hypothetical protein B456_008G173300 [Gossypium raimondii]
Length=813

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ A  A++AAVDDVNS+P 
Sbjct  22   FLCFPPGVVCDTGNVSASSNSSSKPKVINIGALFTLNSVLGEAANRAIQAAVDDVNSDPT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D V  IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVVAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>ref|XP_003612376.1| Glutamate receptor 3.6 [Medicago truncatula]
 gb|AES95334.1| glutamate receptor 3.2 [Medicago truncatula]
Length=983

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W++  +  Y+G+      +  STRPD+VNIG + +F + +GK+ K A+EAAV+DVN
Sbjct  33   MVKVWLLALMILYNGFSSTVAGTHNSTRPDIVNIGALFSFNTSVGKIIKIALEAAVNDVN  92

Query  336  SNPDVLGGTKLNVTML-DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            S+P++LG TKL +++  DS   GFL I E ++ M    VAIIGP +SV AHVI+H+ANEL
Sbjct  93   SDPNILGETKLKLSLQEDSKYRGFLSIAEVLQVMARHNVAIIGPHSSVTAHVITHIANEL  152

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QVPL+SF+A DPTLSSLQ+PFF+RT  +DL+ MAA+A +VDYY W+EV+A
Sbjct  153  QVPLISFSALDPTLSSLQFPFFIRTCHSDLYQMAAIADLVDYYGWKEVIA  202



>ref|XP_008230073.1| PREDICTED: glutamate receptor 3.4-like [Prunus mume]
 ref|XP_008230074.1| PREDICTED: glutamate receptor 3.4-like [Prunus mume]
Length=944

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            LSTRP  +NIG + T  S IG+ AK A+ AA+DDVNS+P +L GTKLNV + D+N SGFL
Sbjct  41   LSTRPSSLNIGALFTLNSVIGRAAKPAIYAAIDDVNSDPRILPGTKLNVILHDTNCSGFL  100

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G VEA++ +E D VA IGPQ+S IAHVISH+ NEL VPLLSFAATDP+L++LQYP+FVRT
Sbjct  101  GTVEALQLIENDVVAAIGPQSSGIAHVISHVVNELHVPLLSFAATDPSLAALQYPYFVRT  160

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +D F M AVA +V+Y+ WREV+A
Sbjct  161  TQSDHFQMYAVADVVEYFGWREVIA  185



>ref|XP_011087614.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Sesamum indicum]
Length=791

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  180  FLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGG  359
             L  +S     G ++   +RP+ V IG I +F + IGKVAK A++AAV+DVNS+P +LGG
Sbjct  6    LLVLFSCLFVGGFSADKVSRPEFVKIGSIFSFGTIIGKVAKIAMKAAVEDVNSDPTILGG  65

Query  360  TKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAA  539
            TKL  +M DSN SGFLGI+  +++MET+TVAIIGPQAS +AH++SHLANEL +P+LSF A
Sbjct  66   TKLVFSMHDSNYSGFLGIIGGLKYMETNTVAIIGPQASGMAHILSHLANELHIPMLSFTA  125

Query  540  TDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
             DP+L+SLQYP+F++T+PNDLF M A+A ++ ++ +REVV
Sbjct  126  LDPSLASLQYPYFIQTAPNDLFQMTAIADMLSHFGYREVV  165



>ref|XP_006364369.1| PREDICTED: glutamate receptor 3.2-like [Solanum tuberosum]
Length=895

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  231  STRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLG  410
            S   D V IG I +F +  GKVAK A+EAAV DVNS+P +LGG KL +T+ DSN SGFLG
Sbjct  18   SEETDEVKIGAIFSFGTTNGKVAKIAMEAAVQDVNSDPSLLGGRKLALTLHDSNYSGFLG  77

Query  411  IVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTS  590
            I+ A++FMETDTVA+IGPQ+SVIAHV+SHL N+L VPLLSF A DPTLS LQYP+F++T+
Sbjct  78   IIGALQFMETDTVAVIGPQSSVIAHVLSHLVNQLHVPLLSFTALDPTLSPLQYPYFIQTA  137

Query  591  PNDLFXMAAVASIVDYYXWREVVA  662
            PNDLF M AVA ++ Y+ +REVVA
Sbjct  138  PNDLFLMTAVADMISYFQYREVVA  161



>ref|XP_011000874.1| PREDICTED: glutamate receptor 3.2 [Populus euphratica]
 ref|XP_011000875.1| PREDICTED: glutamate receptor 3.2 [Populus euphratica]
Length=928

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 121/166 (73%), Gaps = 9/166 (5%)
 Frame = +3

Query  165  FWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            FW++   +F  G +  G           VN+G I TF S  G+VAK A+EAA DD+NS+P
Sbjct  9    FWILCTSSFSQGALSPG---------GTVNVGAIFTFSSINGRVAKIAMEAAEDDINSDP  59

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             +LGG KL++ M DSN SGFLGI+ A++F+ETDTVA+IGPQ +V+AHV+SHLANEL VP 
Sbjct  60   SLLGGRKLSINMHDSNFSGFLGIIGALQFLETDTVAVIGPQTAVMAHVLSHLANELHVPF  119

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LSF A DPTLS LQ+P+F++T+PNDLF M A+A +V YY W EV A
Sbjct  120  LSFTALDPTLSPLQFPYFIQTAPNDLFQMTAIADMVSYYGWSEVTA  165



>ref|XP_003603849.1| Glutamate-gated kainate-type ion channel receptor subunit GluR5 
[Medicago truncatula]
 gb|AES74100.1| glutamate receptor 3.2 [Medicago truncatula]
Length=914

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  165  FWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            +W+ +   F   Y+ E V S  ++RP  VNIG I TF S IGKVAK A+E AV DVNSN 
Sbjct  6    YWLWLVFLFMLPYL-EQVYS--NSRPSFVNIGAIFTFDSSIGKVAKLAMEQAVKDVNSNS  62

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             +L  T+L + M  SN SGF G+++A+RFMETD +AI+GPQ+SV++H+++H+ANEL+VP+
Sbjct  63   SILHSTQLVLHMQTSNCSGFDGMIQALRFMETDVIAILGPQSSVVSHIVAHVANELRVPM  122

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            LSFAATDPTLSSLQ+PFFVRT+ +DL+ M AVA I+D+Y W+EV+
Sbjct  123  LSFAATDPTLSSLQFPFFVRTTLSDLYQMTAVAEIIDFYGWKEVI  167



>gb|KJB50476.1| hypothetical protein B456_008G173300 [Gossypium raimondii]
Length=922

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ A  A++AAVDDVNS+P 
Sbjct  22   FLCFPPGVVCDTGNVSASSNSSSKPKVINIGALFTLNSVLGEAANRAIQAAVDDVNSDPT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D V  IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVVAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>gb|KJB50475.1| hypothetical protein B456_008G173300 [Gossypium raimondii]
Length=915

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ A  A++AAVDDVNS+P 
Sbjct  22   FLCFPPGVVCDTGNVSASSNSSSKPKVINIGALFTLNSVLGEAANRAIQAAVDDVNSDPT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D V  IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVVAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>gb|KJB50471.1| hypothetical protein B456_008G173300 [Gossypium raimondii]
Length=950

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 123/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ A  A++AAVDDVNS+P 
Sbjct  22   FLCFPPGVVCDTGNVSASSNSSSKPKVINIGALFTLNSVLGEAANRAIQAAVDDVNSDPT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D V  IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVVAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>ref|XP_010270512.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010270513.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
Length=924

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  234  TRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGI  413
            +RP  VNIG I TF +  GKVA+ A++AAVDDVNS+  +LGG+KL +T  DSN SG  GI
Sbjct  22   SRPASVNIGAIFTFDTINGKVARIAMKAAVDDVNSDLSILGGSKLALTFHDSNYSGLFGI  81

Query  414  VEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSP  593
            + A+++ME DTVAIIGPQ  V+AHV+SHLANELQVPLLSF A DPTLS+LQYPFF++T+P
Sbjct  82   IGALQYMEADTVAIIGPQHPVMAHVLSHLANELQVPLLSFTALDPTLSALQYPFFLQTAP  141

Query  594  NDLFXMAAVASIVDYYXWREVVA  662
            NDLF M+A+A +V YY WR+V+A
Sbjct  142  NDLFLMSAIADMVSYYGWRDVIA  164



>ref|XP_004952125.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Setaria italica]
 ref|XP_004952126.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Setaria italica]
Length=965

 Score =   171 bits (432),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            G++++L+ RP VV+IG IL F S  G V+  A+ AA++D+NS+P VL GT L V M D+N
Sbjct  19   GIHNSLAARPSVVSIGSILRFNSTTGGVSAVAIRAALEDINSDPTVLNGTMLRVDMRDTN  78

Query  393  -SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQY  569
               GFLG+VEA++FMETD +AIIGPQ S IAH+IS++ANELQVPL+SF A+D TLSS+Q+
Sbjct  79   CDDGFLGMVEALQFMETDVIAIIGPQCSTIAHIISYVANELQVPLMSF-ASDATLSSIQF  137

Query  570  PFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PFFVRT P+DL+ MAAVA++VDYY W+ V A
Sbjct  138  PFFVRTMPSDLYEMAAVAAVVDYYQWKIVTA  168



>emb|CAB63012.1| putative glutamate receptor [Arabidopsis thaliana]
Length=1039

 Score =   171 bits (433),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +3

Query  153  KMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            KMK  W ++ L   +    +G+   +S RP VVNIG + TF S IGKV K A++AAV+DV
Sbjct  174  KMK--WFLLMLIICNAVPLQGLTKIVSARPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDV  231

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            N++P +L  T L + M D+  +GF+ I+E ++FME++TVAIIGPQ S  A V++H+A EL
Sbjct  232  NASPSILNTTTLRIIMHDTKYNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATEL  291

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ++P+LSF+ATDPT+S LQ+PFF+RTS NDLF MAA+A IV +Y WREVVA
Sbjct  292  KIPILSFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVA  341



>ref|XP_004952127.1| PREDICTED: glutamate receptor 3.1-like isoform X3 [Setaria italica]
Length=934

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            G++++L+ RP VV+IG IL F S  G V+  A+ AA++D+NS+P VL GT L V M D+N
Sbjct  19   GIHNSLAARPSVVSIGSILRFNSTTGGVSAVAIRAALEDINSDPTVLNGTMLRVDMRDTN  78

Query  393  -SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQY  569
               GFLG+VEA++FMETD +AIIGPQ S IAH+IS++ANELQVPL+SF A+D TLSS+Q+
Sbjct  79   CDDGFLGMVEALQFMETDVIAIIGPQCSTIAHIISYVANELQVPLMSF-ASDATLSSIQF  137

Query  570  PFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PFFVRT P+DL+ MAAVA++VDYY W+ V A
Sbjct  138  PFFVRTMPSDLYEMAAVAAVVDYYQWKIVTA  168



>gb|KHG21169.1| Glutamate receptor 3.2 -like protein [Gossypium arboreum]
Length=925

 Score =   170 bits (431),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            +V+ L+ +S ++  GV S     P ++N+G I +F +  GKVAK A++AA DD+NS+P V
Sbjct  3    LVLLLSTFSLFI--GVLSEEGLNPGIMNVGAIFSFNTINGKVAKVAMKAAEDDINSDPSV  60

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGG KL++ + DSN S FLGI+ A++FMETDTVAIIGPQ+S +AHV+S+LANELQVPLLS
Sbjct  61   LGGRKLSIQLHDSNFSSFLGIIGALQFMETDTVAIIGPQSSEMAHVLSNLANELQVPLLS  120

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            F A DP+LS LQYPFFV+T+PND F M A+A +V Y+ W EVVA
Sbjct  121  FTALDPSLSPLQYPFFVQTAPNDEFQMTAIAEMVSYFSWSEVVA  164



>gb|EYU41186.1| hypothetical protein MIMGU_mgv1a000937mg [Erythranthe guttata]
Length=938

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP VVN+G I T  S IG+VAK A+E AV+DVNSN  VL GTKL V + +SN SGFLG+V
Sbjct  32   RPKVVNVGAIFTLDSTIGRVAKIAIEEAVNDVNSNSSVLNGTKLVVDIRNSNCSGFLGLV  91

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
            EA+RFMETD +A+IGPQ+SV+AH I H+ANELQ P LSFAATDPTLSSLQ+P+F+RT+ +
Sbjct  92   EALRFMETDVMAVIGPQSSVVAHTILHVANELQTPFLSFAATDPTLSSLQFPYFLRTTQS  151

Query  597  DLFXMAAVASIVDYYXWREVV  659
            DL  M A+A +V++Y W++V+
Sbjct  152  DLHQMTAIAELVEHYNWKDVI  172



>gb|KJB79726.1| hypothetical protein B456_013G064100 [Gossypium raimondii]
Length=558

 Score =   167 bits (423),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP+VVN+G I +F +  GKVAK A++AA DD+NS+P +LGG KL V + DSN S FL  +
Sbjct  31   RPNVVNVGAIFSFDTINGKVAKVAMKAAEDDINSDPSILGGRKLFVALHDSNYSSFLSFI  90

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
             A++FMETDTVAIIGPQ+SV+AHV+SHLANEL VPLLSF A DP LS LQYPFFV+T+PN
Sbjct  91   GALQFMETDTVAIIGPQSSVMAHVLSHLANELHVPLLSFTALDPGLSPLQYPFFVQTAPN  150

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            D F M A+A +V Y+ W EV+A
Sbjct  151  DEFQMIAIAEMVSYFGWAEVIA  172



>gb|KJB47170.1| hypothetical protein B456_008G013900 [Gossypium raimondii]
 gb|KJB47171.1| hypothetical protein B456_008G013900 [Gossypium raimondii]
Length=925

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 127/164 (77%), Gaps = 2/164 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            +V+ L+ +S ++  GV S     P VVN+G I +F +  GKVAK A++AA DD+NS+P V
Sbjct  3    LVLLLSTFSLFI--GVLSEEGLNPAVVNVGAIFSFNTINGKVAKVAMKAAEDDINSDPSV  60

Query  351  LGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLS  530
            LGG KL++ + DSN S FLGI+ A++FMETDTVAIIGPQ+S +AHV+S+LANELQVPLLS
Sbjct  61   LGGRKLSIQVHDSNFSSFLGILGALQFMETDTVAIIGPQSSEMAHVLSNLANELQVPLLS  120

Query  531  FAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            F A DP+LS LQYPFFV+T+PND F M A+A +V Y+ W EV+A
Sbjct  121  FTALDPSLSPLQYPFFVQTAPNDEFQMTAIAEMVSYFSWSEVIA  164



>ref|XP_003608170.1| Glutamate receptor 3.6, partial [Medicago truncatula]
Length=450

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 6/168 (4%)
 Frame = +3

Query  168  WVVMFLTFYS---GYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNS  338
            W V+ +  Y+        G+++  ST P  VNIG + +F + +G++ K AVEAAV D+NS
Sbjct  5    WFVVLMVLYNLMFSSTVAGLDN--STVPPFVNIGVLYSFNTSVGRMVKIAVEAAVADINS  62

Query  339  NPDVLGGTKLNVTML-DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            +P +LG TKLN+++  DS   GFL I EA++ M T TVAIIGPQ S  AHVISH+ANELQ
Sbjct  63   DPTILGNTKLNLSLQEDSKYRGFLSIAEALQLMATQTVAIIGPQTSTTAHVISHIANELQ  122

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            VPLLSF ATDPTLSSLQ+PFF+RTS ND+F M A+A IV +Y WREV+
Sbjct  123  VPLLSFTATDPTLSSLQFPFFLRTSFNDIFQMTAIADIVSHYGWREVI  170



>ref|XP_004487403.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Cicer arietinum]
 ref|XP_004487404.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Cicer arietinum]
 ref|XP_004487405.1| PREDICTED: glutamate receptor 3.4-like isoform X3 [Cicer arietinum]
Length=932

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +3

Query  219  NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSS  398
            NST+S+R  VV IG + T  S IG+ AK  + AA++DVN N  +L G KL V + D+N S
Sbjct  32   NSTVSSRLSVVKIGALFTVDSVIGRSAKPGIVAAIEDVNVNKTILPGIKLEVILHDTNCS  91

Query  399  GFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFF  578
            GFLG VEA++ ME + VA IGPQ+S IAHVISH+ NEL VPLLSF ATDPTLSSLQYP+F
Sbjct  92   GFLGTVEALQLMENEVVAAIGPQSSGIAHVISHVVNELHVPLLSFGATDPTLSSLQYPYF  151

Query  579  VRTSPNDLFXMAAVASIVDYYXWREVVA  662
            VRT+ ND F M A+A IVDYY WREV+A
Sbjct  152  VRTTQNDYFQMYAIADIVDYYRWREVIA  179



>emb|CDX73718.1| BnaC08g22850D [Brassica napus]
Length=891

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W+++ L  +     +G ++ +S RP VVNIG + TF S IGKV K A++AAVDDVN+NP 
Sbjct  3    WLLLLLLLFHAVPLQGQSTNVSPRPQVVNIGSVFTFKSLIGKVIKVAMQAAVDDVNANPT  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            VL  T+LN+ M D+  +GF+ I+E +RFME  TVAIIGPQ    A V+SH+A EL++P+L
Sbjct  63   VLNNTRLNIIMHDTKFNGFMSIMEPLRFMENKTVAIIGPQRPTSARVVSHVATELKIPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPT+S  Q+PFF+RTS NDLF MAA+A IV +Y WREV+A
Sbjct  123  SFTATDPTMSPRQFPFFIRTSQNDLFQMAAIADIVHHYGWREVIA  167



>ref|XP_011087613.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Sesamum indicum]
Length=930

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +3

Query  180  FLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGG  359
             L  +S     G ++   +RP+ V IG I +F + IGKVAK A++AAV+DVNS+P +LGG
Sbjct  6    LLVLFSCLFVGGFSADKVSRPEFVKIGSIFSFGTIIGKVAKIAMKAAVEDVNSDPTILGG  65

Query  360  TKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAA  539
            TKL  +M DSN SGFLGI+  +++MET+TVAIIGPQAS +AH++SHLANEL +P+LSF A
Sbjct  66   TKLVFSMHDSNYSGFLGIIGGLKYMETNTVAIIGPQASGMAHILSHLANELHIPMLSFTA  125

Query  540  TDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
             DP+L+SLQYP+F++T+PNDLF M A+A ++ ++ +REVV
Sbjct  126  LDPSLASLQYPYFIQTAPNDLFQMTAIADMLSHFGYREVV  165



>ref|NP_190716.3| glutamate receptor 3.6 [Arabidopsis thaliana]
 sp|Q84W41.1|GLR36_ARATH RecName: Full=Glutamate receptor 3.6; AltName: Full=Ligand-gated 
ion channel 3.6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO42266.1| putative glutamate receptor [Arabidopsis thaliana]
 gb|AEE78797.1| glutamate receptor 3.6 [Arabidopsis thaliana]
Length=903

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 123/165 (75%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W ++ L   +    +G+   +S RP VVNIG + TF S IGKV K A++AAV+DVN++P 
Sbjct  3    WFLLMLIICNAVPLQGLTKIVSARPQVVNIGSVFTFNSLIGKVIKVAMDAAVEDVNASPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L  T L + M D+  +GF+ I+E ++FME++TVAIIGPQ S  A V++H+A EL++P+L
Sbjct  63   ILNTTTLRIIMHDTKYNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPT+S LQ+PFF+RTS NDLF MAA+A IV +Y WREVVA
Sbjct  123  SFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVA  167



>ref|XP_004161019.1| PREDICTED: glutamate receptor 3.2-like [Cucumis sativus]
Length=644

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++ L    G + EG     S+R +VV +G I +  S  GKV+K A+EAA  DVN
Sbjct  20   MNMVWLLLVLFCVQGIISEG-----SSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVN  74

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++++ D+N SGFLGI  AM++M +DTVAI+GP+ S +AH++SHL+NEL 
Sbjct  75   SDPSVLGGRKLSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDSTMAHILSHLSNELH  134

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            +PLLSF A DPTLSSLQYP+F++T+PND F M A+A I+ YY W ++V
Sbjct  135  IPLLSFTALDPTLSSLQYPYFIQTAPNDKFQMTAIADIIHYYDWHDIV  182



>ref|XP_006412122.1| hypothetical protein EUTSA_v10024351mg [Eutrema salsugineum]
 gb|ESQ53575.1| hypothetical protein EUTSA_v10024351mg [Eutrema salsugineum]
Length=911

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 125/170 (74%), Gaps = 9/170 (5%)
 Frame = +3

Query  165  FWVVMFLTFY----SGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            FWV++ L+F      G + EG     +++P VVN+G I +  +  G VA  A++AA DDV
Sbjct  2    FWVLVLLSFIVLSGDGLISEG-----ASKPHVVNVGAIFSLSTVYGNVANIAMKAAEDDV  56

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            NS+P  LGG+KL + M D+  +GFL I+ A++FMETD VAIIGPQ S++AHV+SHLANEL
Sbjct  57   NSDPSFLGGSKLRILMYDAKRNGFLSIMGALQFMETDAVAIIGPQTSIMAHVLSHLANEL  116

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
             VP+LSF A DP+LS+LQ+PFFV+T+P+DLF M A+A ++ YY W +V+A
Sbjct  117  NVPMLSFTALDPSLSALQFPFFVQTAPSDLFLMRAIAEMITYYGWSDVIA  166



>ref|XP_004290072.1| PREDICTED: glutamate receptor 3.2-like [Fragaria vesca subsp. 
vesca]
Length=939

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +3

Query  204  VCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTML  383
            +C G  +  ++RP VVNIG +    +  G V+K A++AA +DVN++P +L GTK +V++ 
Sbjct  12   ICVGRFTEGASRPAVVNIGAMFAVSTINGGVSKIAIKAAEEDVNADPSILSGTKFSVSIH  71

Query  384  DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSL  563
            DSN SGFL I+ A+++ME+DTVAIIGPQ SV+AH+ISHLANEL VPLLSF A DPTL+SL
Sbjct  72   DSNYSGFLSIIGALKYMESDTVAIIGPQTSVMAHIISHLANELHVPLLSFTALDPTLTSL  131

Query  564  QYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            QYP+F++T+PND F M A+  IV Y+ W+EVVA
Sbjct  132  QYPYFLQTAPNDQFQMNAIGDIVSYFGWKEVVA  164



>ref|XP_011092253.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
 ref|XP_011092254.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
 ref|XP_011092255.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
Length=931

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +3

Query  222  STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSG  401
            S   +RP VVNIG   TF +  GKVAK A+ AAV+DVNS+P  LGG+KL ++  DSN SG
Sbjct  24   SKEHSRPAVVNIGAAFTFGTINGKVAKIAMNAAVEDVNSDPSFLGGSKLVLSTHDSNYSG  83

Query  402  FLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFV  581
            FLGI+  +++METDTVAIIGPQ S +AH++SHLANEL VP+LSF A DP+LSSLQYP+FV
Sbjct  84   FLGIIGGLQYMETDTVAIIGPQVSGMAHILSHLANELHVPMLSFTALDPSLSSLQYPYFV  143

Query  582  RTSPNDLFXMAAVASIVDYYXWREVVA  662
            +T+PNDLF MAA+A ++ Y+ ++EVVA
Sbjct  144  QTAPNDLFQMAAIADMISYFGYKEVVA  170



>gb|KHG01323.1| Glutamate receptor 3.4 -like protein [Gossypium arboreum]
Length=950

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 124/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  180  FLTFYSGYVCEGVN----STLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            FL F  G VC+  N    S  S++P V+NIG + T  S +G+ AK A++AAVDDVNS+  
Sbjct  22   FLCFPPGVVCDTGNVSTSSNSSSKPKVINIGALFTLNSVLGEAAKPAIQAAVDDVNSDTT  81

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L G +L + + D+N SGF+G +EA++ ME+D VA IGPQ+S IAHVISH+ NEL VPLL
Sbjct  82   ILNGVQLKLLISDTNCSGFIGTMEALQLMESDVVAAIGPQSSGIAHVISHVVNELHVPLL  141

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF ATDPTLSS+QYP+F+RT+P+D F M A+A IVDYY WREV+A
Sbjct  142  SFGATDPTLSSMQYPYFLRTTPSDHFQMYAIADIVDYYGWREVIA  186



>ref|XP_009115834.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
 ref|XP_009115835.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
Length=940

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = +3

Query  153  KMKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddv  332
            KMK  W+++ L        +G ++ +S RP VVNIG + TF S IGKV K A++AAVDDV
Sbjct  49   KMK--WLLLLLLLCHAVPLQGQSTNVSPRPQVVNIGSVFTFKSLIGKVIKVAMQAAVDDV  106

Query  333  NSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANEL  512
            N+NP VL  T+LN+ M D+  +GF+ I+E +RFME  TVAIIGPQ    A V+SH+A EL
Sbjct  107  NANPTVLNNTRLNIIMHDTKFNGFMSIMEPLRFMENKTVAIIGPQRPTSARVVSHVATEL  166

Query  513  QVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            ++P+LSF ATDPT+S  Q+PFF+RTS NDLF MAA+A IV +Y WREV+A
Sbjct  167  KIPILSFTATDPTMSPRQFPFFIRTSQNDLFQMAAIADIVHHYGWREVIA  216



>ref|XP_002876089.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52348.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
Length=903

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 124/165 (75%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W ++ +      + +G+  + S RP VVNIG + TF S IGKV K A++AAV+DVN++P+
Sbjct  3    WFLLMIIICDAVLLQGLPKSDSERPQVVNIGAVFTFNSLIGKVIKVAMDAAVEDVNASPN  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L  T L + M D+  +GF+ I+E ++FME++TVAIIGPQ S  A V++H+A EL++P+L
Sbjct  63   ILNTTTLKIIMHDTKFNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPT+S LQ+PFF+RTS NDLF MAA+A IV +Y WREVVA
Sbjct  123  SFSATDPTMSPLQFPFFIRTSQNDLFQMAAIADIVQFYGWREVVA  167



>ref|XP_010907850.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=932

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +3

Query  165  FWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNP  344
            F V MF T   G      N++ S+ P VVN+G + TF S IG+ A  A+E AV+DVN + 
Sbjct  21   FLVGMFATTGRGQN----NTSNSSVPPVVNVGALFTFNSTIGRAATLAIEFAVEDVNKDA  76

Query  345  DVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPL  524
             VL GTKLNV   D+N SGFLG +EA++ ME D VAIIGPQ+S I HVISH+ NEL VPL
Sbjct  77   SVLSGTKLNVIKQDTNCSGFLGTIEALQLMEKDVVAIIGPQSSGIGHVISHVVNELHVPL  136

Query  525  LSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            LSFAATDPTLSSL+YP+F+RT  +D F M A+A IV YY WR+V A
Sbjct  137  LSFAATDPTLSSLEYPYFIRTIHSDYFQMNAIADIVQYYGWRKVTA  182



>ref|XP_009115836.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Brassica rapa]
 emb|CDX78008.1| BnaA09g32030D [Brassica napus]
Length=891

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 116/151 (77%), Gaps = 0/151 (0%)
 Frame = +3

Query  210  EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDS  389
            +G ++ +S RP VVNIG + TF S IGKV K A++AAVDDVN+NP VL  T+LN+ M D+
Sbjct  17   QGQSTNVSPRPQVVNIGSVFTFKSLIGKVIKVAMQAAVDDVNANPTVLNNTRLNIIMHDT  76

Query  390  NSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQY  569
              +GF+ I+E +RFME  TVAIIGPQ    A V+SH+A EL++P+LSF ATDPT+S  Q+
Sbjct  77   KFNGFMSIMEPLRFMENKTVAIIGPQRPTSARVVSHVATELKIPILSFTATDPTMSPRQF  136

Query  570  PFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PFF+RTS NDLF MAA+A IV +Y WREV+A
Sbjct  137  PFFIRTSQNDLFQMAAIADIVHHYGWREVIA  167



>ref|XP_010530965.1| PREDICTED: glutamate receptor 3.2-like [Tarenaya hassleriana]
 ref|XP_010530966.1| PREDICTED: glutamate receptor 3.2-like [Tarenaya hassleriana]
 ref|XP_010530967.1| PREDICTED: glutamate receptor 3.2-like [Tarenaya hassleriana]
Length=914

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            G+ S  ++RP VVN+G I +  +  G VA  A++AA +DVNS+P   GG+KL +T+ D  
Sbjct  23   GLLSEAASRPHVVNVGAICSLSTKDGIVANIAMKAAENDVNSDPTFFGGSKLAITLHDGK  82

Query  393  SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYP  572
            +SGFLG++ A++FMETDTVAIIGPQ S++AHV+SHLANEL VPLLSF A DP+LS+LQYP
Sbjct  83   TSGFLGLMGALQFMETDTVAIIGPQTSIMAHVLSHLANELHVPLLSFTALDPSLSALQYP  142

Query  573  FFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +FV+T+P+DLF M A+A ++ +Y W +V+A
Sbjct  143  YFVQTAPSDLFLMRAIAEMISFYGWSDVIA  172



>ref|XP_004154082.1| PREDICTED: glutamate receptor 3.2-like, partial [Cucumis sativus]
Length=817

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++ L    G + EG     S+R +VV +G I +  S  GKV+K A+EAA  DVN
Sbjct  20   MNMVWLLLVLFCVQGIISEG-----SSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVN  74

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++++ D+N SGFLGI  AM++M +DTVAI+GP+ S +AH++SHL+NEL 
Sbjct  75   SDPSVLGGRKLSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDSTMAHILSHLSNELH  134

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            +PLLSF A DPTLSSLQYP+F++T+PND F M A+A I+ YY W ++V
Sbjct  135  IPLLSFTALDPTLSSLQYPYFIQTAPNDKFQMTAIADIIHYYDWHDIV  182



>gb|KJB79724.1| hypothetical protein B456_013G064100 [Gossypium raimondii]
Length=804

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP+VVN+G I +F +  GKVAK A++AA DD+NS+P +LGG KL V + DSN S FL  +
Sbjct  12   RPNVVNVGAIFSFDTINGKVAKVAMKAAEDDINSDPSILGGRKLFVALHDSNYSSFLSFI  71

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
             A++FMETDTVAIIGPQ+SV+AHV+SHLANEL VPLLSF A DP LS LQYPFFV+T+PN
Sbjct  72   GALQFMETDTVAIIGPQSSVMAHVLSHLANELHVPLLSFTALDPGLSPLQYPFFVQTAPN  131

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            D F M A+A +V Y+ W EV+A
Sbjct  132  DEFQMIAIAEMVSYFGWAEVIA  153



>gb|EEC72350.1| hypothetical protein OsI_05591 [Oryza sativa Indica Group]
Length=906

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +3

Query  210  EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDS  389
            +G+  +L+ RP +VNIG IL F S IG V+  A++AA++D+NS+  +L GT L V M D+
Sbjct  18   DGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  390  N-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQ  566
            N   GFLG+VEA++FMETD +AIIGPQ S IAH++S++ANEL+VPL+SF A+D TLSS+Q
Sbjct  78   NCDDGFLGMVEALQFMETDVIAIIGPQCSTIAHIVSYVANELRVPLMSF-ASDATLSSIQ  136

Query  567  YPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +PFFVRT+P+DL+ M AVA+IVDYY W+ V A
Sbjct  137  FPFFVRTAPSDLYQMDAVAAIVDYYRWKIVTA  168



>gb|EEE56178.1| hypothetical protein OsJ_05129 [Oryza sativa Japonica Group]
Length=870

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +3

Query  210  EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDS  389
            +G+  +L+ RP +VNIG IL F S IG V+  A++AA++D+NS+  +L GT L V M D+
Sbjct  18   DGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  390  N-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQ  566
            N   GFLG+VEA++FMETD +AIIGPQ S IAH++S++ANEL+VPL+SF A+D TLSS+Q
Sbjct  78   NCDDGFLGMVEALQFMETDVIAIIGPQCSTIAHIVSYVANELRVPLMSF-ASDATLSSIQ  136

Query  567  YPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +PFFVRT+P+DL+ M AVA+IVDYY W+ V A
Sbjct  137  FPFFVRTAPSDLYQMDAVAAIVDYYRWKIVTA  168



>ref|XP_010503844.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=751

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            WV++ L         G+   +S RP  VNIG + TF S IGKV K A +AAV+DVN++P 
Sbjct  3    WVLLMLVVCYAVPLHGLTKIVSARPKAVNIGAVFTFNSLIGKVIKVATDAAVEDVNASPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L  T L + M D+  +GF+ I+E + FME++TVAIIGPQ S  A V++H+A EL+VP+L
Sbjct  63   ILNTTTLRIIMHDTKFNGFMSIMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPT+S LQ+PFF+RT+ NDLF MAA+A IV +Y WREVVA
Sbjct  123  SFSATDPTMSPLQFPFFIRTAHNDLFQMAAIADIVQFYGWREVVA  167



>gb|KGN43348.1| hypothetical protein Csa_7G025200 [Cucumis sativus]
Length=921

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++ L    G + EG     S+R +VV +G I +  S  GKV+K A+EAA  DVN
Sbjct  20   MNMVWLLLVLFCVQGIISEG-----SSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVN  74

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++++ D+N SGFLGI  AM++M +DTVAI+GP+ S +AH++SHL+NEL 
Sbjct  75   SDPSVLGGRKLSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDSTMAHILSHLSNELH  134

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            +PLLSF A DPTLSSLQYP+F++T+PND F M A+A I+ YY W ++V
Sbjct  135  IPLLSFTALDPTLSSLQYPYFIQTAPNDKFQMTAIADIIHYYDWHDIV  182



>ref|XP_004144891.1| PREDICTED: glutamate receptor 3.2-like [Cucumis sativus]
Length=922

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  156  MKGFWVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvN  335
            M   W+++ L    G + EG     S+R +VV +G I +  S  GKV+K A+EAA  DVN
Sbjct  20   MNMVWLLLVLFCVQGIISEG-----SSRNEVVKVGAIFSLSSVNGKVSKIAIEAAEKDVN  74

Query  336  SNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            S+P VLGG KL++++ D+N SGFLGI  AM++M +DTVAI+GP+ S +AH++SHL+NEL 
Sbjct  75   SDPSVLGGRKLSISIHDANYSGFLGITGAMKYMVSDTVAILGPEDSTMAHILSHLSNELH  134

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            +PLLSF A DPTLSSLQYP+F++T+PND F M A+A I+ YY W ++V
Sbjct  135  IPLLSFTALDPTLSSLQYPYFIQTAPNDKFQMTAIADIIHYYDWHDIV  182



>ref|NP_001045687.1| Os02g0117500 [Oryza sativa Japonica Group]
 dbj|BAD07727.1| putative glutamate receptor [Oryza sativa Japonica Group]
 dbj|BAF07601.1| Os02g0117500 [Oryza sativa Japonica Group]
Length=944

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +3

Query  210  EGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDS  389
            +G+  +L+ RP +VNIG IL F S IG V+  A++AA++D+NS+  +L GT L V M D+
Sbjct  18   DGIRRSLAARPSIVNIGAILRFNSTIGGVSMIAIQAALEDINSDSTILNGTTLKVDMRDT  77

Query  390  N-SSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQ  566
            N   GFLG+VEA++FMETD +AIIGPQ S IAH++S++ANEL+VPL+SF A+D TLSS+Q
Sbjct  78   NCDDGFLGMVEALQFMETDVIAIIGPQCSTIAHIVSYVANELRVPLMSF-ASDATLSSIQ  136

Query  567  YPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            +PFFVRT+P+DL+ M AVA+IVDYY W+ V A
Sbjct  137  FPFFVRTAPSDLYQMDAVAAIVDYYRWKIVTA  168



>ref|XP_007204033.1| hypothetical protein PRUPE_ppa020695mg [Prunus persica]
 gb|EMJ05232.1| hypothetical protein PRUPE_ppa020695mg [Prunus persica]
Length=900

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 1/165 (1%)
 Frame = +3

Query  171  VVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDV  350
            +++ + FY+G    G+ + ++ RPD VNIG I  F S IG++AK A+  AV+DVNS+P +
Sbjct  4    LLVLMVFYNGSSSSGLGTNVTARPDTVNIGAIFPFDSVIGEIAKLAISIAVEDVNSDPKL  63

Query  351  LGGTKLNVTMLDSNSSGFLGIVE-AMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            L GTKL + + +  SS FLGIVE A++FME D VAI+GPQ S    V+SH+ANEL VPLL
Sbjct  64   LNGTKLILKIQNIKSSDFLGIVEQALQFMENDIVAILGPQFSATVRVVSHIANELHVPLL  123

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SFAATDPTLS +Q+PF VRT+ +DLF M AVA +V +Y WREV+A
Sbjct  124  SFAATDPTLSPVQFPFLVRTAQSDLFQMTAVADLVAFYEWREVIA  168



>ref|XP_002306435.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
 gb|EEE93431.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
Length=913

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +3

Query  183  LTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGT  362
            + F +G    G+    + RP VV IG +L F + +GKVAK A+EAAV+DVN N  +LG T
Sbjct  1    MVFSNGLSSNGIGLNDTARPKVVKIGALLNFNTTVGKVAKVAIEAAVEDVN-NSTILGET  59

Query  363  KLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAAT  542
            KL VTM D+ +S FLG+++A+  M+ +TVAIIGPQ S  AHV+S +A+E+ +P+LSF AT
Sbjct  60   KLQVTMQDTENSSFLGMLDALSLMDGETVAIIGPQTSATAHVVSQIADEIHIPMLSFGAT  119

Query  543  DPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            DPTLSSLQYPFFVRT+ NDLF MAA+A I+DYY WR+V A
Sbjct  120  DPTLSSLQYPFFVRTTQNDLFQMAAIAEIIDYYGWRDVTA  159



>gb|KEH20344.1| glutamate receptor 3.2 [Medicago truncatula]
Length=550

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 122/168 (73%), Gaps = 6/168 (4%)
 Frame = +3

Query  168  WVVMFLTFYS---GYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNS  338
            W V+ +  Y+        G+++  ST P  VNIG + +F + +G++ K AVEAAV D+NS
Sbjct  5    WFVVLMVLYNLMFSSTVAGLDN--STVPPFVNIGVLYSFNTSVGRMVKIAVEAAVADINS  62

Query  339  NPDVLGGTKLNVTML-DSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQ  515
            +P +LG TKLN+++  DS   GFL I EA++ M T TVAIIGPQ S  AHVISH+ANELQ
Sbjct  63   DPTILGNTKLNLSLQEDSKYRGFLSIAEALQLMATQTVAIIGPQTSTTAHVISHIANELQ  122

Query  516  VPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            VPLLSF ATDPTLSSLQ+PFF+RTS ND+F M A+A IV +Y WREV+
Sbjct  123  VPLLSFTATDPTLSSLQFPFFLRTSFNDIFQMTAIADIVSHYGWREVI  170



>gb|KJB79723.1| hypothetical protein B456_013G064100 [Gossypium raimondii]
Length=886

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP+VVN+G I +F +  GKVAK A++AA DD+NS+P +LGG KL V + DSN S FL  +
Sbjct  12   RPNVVNVGAIFSFDTINGKVAKVAMKAAEDDINSDPSILGGRKLFVALHDSNYSSFLSFI  71

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
             A++FMETDTVAIIGPQ+SV+AHV+SHLANEL VPLLSF A DP LS LQYPFFV+T+PN
Sbjct  72   GALQFMETDTVAIIGPQSSVMAHVLSHLANELHVPLLSFTALDPGLSPLQYPFFVQTAPN  131

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            D F M A+A +V Y+ W EV+A
Sbjct  132  DEFQMIAIAEMVSYFGWAEVIA  153



>ref|XP_010515559.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
Length=751

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 119/165 (72%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            WV++ L         G+    S RP  VNIG + TF S IGKV K A++AAV+DVN++P 
Sbjct  3    WVLLMLIICYAVPLHGLTKVASARPKAVNIGAVFTFNSLIGKVIKVAMDAAVEDVNASPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L  T L + M D+  +GF+ I+E + FME++TVAIIGPQ S  A V++H+A EL+VP+L
Sbjct  63   ILNTTTLRIIMHDTKFNGFMSIMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPT+S LQ+PFF+RT+ NDLF MAA+A IV +Y WREVVA
Sbjct  123  SFSATDPTMSPLQFPFFIRTAHNDLFQMAAIADIVQFYGWREVVA  167



>ref|XP_010426706.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Camelina sativa]
Length=751

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 120/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            WV++ L         G+   +S RP  VNIG + TF S IGKV K A++AAV+DVN++P 
Sbjct  3    WVLLILIVCYAVPLHGLTKIVSARPKAVNIGAVFTFNSLIGKVIKVAMDAAVEDVNASPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L  T L + M D+  +GF+ I+E + FME++TVAIIGPQ S  A V++H+A EL+VP+L
Sbjct  63   ILNTTTLKIIMHDTKFNGFMSIMEPLHFMESETVAIIGPQRSTTARVVAHVATELRVPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPT+S LQ+PFF+RT+ NDLF MAA+A IV +Y WREVVA
Sbjct  123  SFSATDPTMSPLQFPFFIRTAHNDLFQMAAIADIVQFYGWREVVA  167



>gb|KJB79725.1| hypothetical protein B456_013G064100 [Gossypium raimondii]
Length=905

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  237  RPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIV  416
            RP+VVN+G I +F +  GKVAK A++AA DD+NS+P +LGG KL V + DSN S FL  +
Sbjct  31   RPNVVNVGAIFSFDTINGKVAKVAMKAAEDDINSDPSILGGRKLFVALHDSNYSSFLSFI  90

Query  417  EAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPN  596
             A++FMETDTVAIIGPQ+SV+AHV+SHLANEL VPLLSF A DP LS LQYPFFV+T+PN
Sbjct  91   GALQFMETDTVAIIGPQSSVMAHVLSHLANELHVPLLSFTALDPGLSPLQYPFFVQTAPN  150

Query  597  DLFXMAAVASIVDYYXWREVVA  662
            D F M A+A +V Y+ W EV+A
Sbjct  151  DEFQMIAIAEMVSYFGWAEVIA  172



>ref|XP_006292183.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
 gb|EOA25081.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
Length=903

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W ++          +G+   +S RP VVNIG + TF S IGKV K A++AAV+DVN++P 
Sbjct  3    WFLLMFIICDAVSLQGLTKIVSARPQVVNIGAVFTFDSLIGKVIKIAMDAAVEDVNASPS  62

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
            +L  T L + M D+  +GF+ I+E ++FME++TVAIIGPQ S  A V++H+A EL++P+L
Sbjct  63   ILNTTTLKIIMHDTKFNGFMSIMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPIL  122

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            SF+ATDPT+S LQ+PFF+RT+ NDLF MAA+A IV +Y WREVVA
Sbjct  123  SFSATDPTMSPLQFPFFIRTAQNDLFQMAAIADIVQFYGWREVVA  167



>ref|XP_008812265.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Phoenix dactylifera]
Length=929

 Score =   167 bits (424),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = +3

Query  129  SGGLVIELKMKGFWVVMFLTFYSGYVCEGVNSTL--STRPDVVNIGCILTFISPIGkvak  302
            S G  +   ++ F  V FL    G    G N+T   S RP VVN+G + TF S IG+VA 
Sbjct  5    SAGFKVRPSIRLF-AVCFLVGMIGTTGRGQNNTSNSSVRP-VVNVGALFTFNSTIGRVAT  62

Query  303  aaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIA  482
             A+E AV+DVN +  VL GT+LNV   D+N SGFLG +EA++ ME D VAI+GPQ+S I 
Sbjct  63   LAIEFAVEDVNKDTSVLAGTRLNVIKQDTNCSGFLGTMEALQLMEKDVVAIVGPQSSGIG  122

Query  483  HVISHLANELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            HVISH+ NEL VPLLSFAATDPTLSSL+YP+F+RT  +D F M A+A IV+YY WR+V A
Sbjct  123  HVISHVVNELHVPLLSFAATDPTLSSLEYPYFIRTIHSDYFQMNAIADIVEYYGWRKVTA  182



>ref|XP_003573352.1| PREDICTED: glutamate receptor 3.1 isoform X1 [Brachypodium distachyon]
Length=925

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 120/151 (79%), Gaps = 2/151 (1%)
 Frame = +3

Query  213  GVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSN  392
            G+  +L+ RP VVNIG IL F S IG V+  A+ AA++D+N++P VL GT L V + D+N
Sbjct  19   GICKSLAARPPVVNIGSILQFNSTIGGVSAVAIHAALEDINADPTVLNGTTLQVMLKDTN  78

Query  393  S-SGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQY  569
               GFLG+V+A++FMETD +AIIGPQ S IAH+IS++ANELQVPL+SF A+D TLSS+Q+
Sbjct  79   CYDGFLGMVQALQFMETDVIAIIGPQCSTIAHIISYVANELQVPLMSF-ASDATLSSIQF  137

Query  570  PFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            PFFVRT+P+DL+ MAAVA+IVDY  W+ V A
Sbjct  138  PFFVRTAPSDLYQMAAVAAIVDYNQWKLVTA  168



>ref|XP_010028859.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Eucalyptus 
grandis]
Length=766

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = +3

Query  168  WVVMFLTFYSGYVCEGVNSTLSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPD  347
            W++     +SG +  G ++  +   D V IG I TF +  GKVA+ A++AA +DVN++P 
Sbjct  5    WLLCIFVLFSGELSLGRSTPDA---DAVTIGAIFTFSTLNGKVAQIAMKAAENDVNADPT  61

Query  348  VLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLL  527
             LGG KL++ M DSN SGFLGI+ A++FME DTVAIIGPQ S  AH++SHLANEL VP+L
Sbjct  62   FLGGRKLSIIMYDSNFSGFLGIIGALQFMEMDTVAIIGPQTSGTAHILSHLANELHVPML  121

Query  528  SFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVV  659
            SF A DP LS LQYP+F++T+P+DLF M AVA ++ YY WREVV
Sbjct  122  SFTALDPMLSPLQYPYFIQTAPSDLFQMMAVADMISYYGWREVV  165



>ref|XP_009353274.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009353275.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Pyrus x bretschneideri]
Length=959

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +3

Query  228  LSTRPDVVNIGCILTFISPIGkvakaaveaavddvNSNPDVLGGTKLNVTMLDSNSSGFL  407
            LS RP  +NIG + TF S IG+ AK A+ AA+DDVNS+  +L GTKLN+ + D+N SGFL
Sbjct  42   LSARPSSLNIGALFTFNSVIGRAAKPAILAAIDDVNSDQSILRGTKLNIILHDTNCSGFL  101

Query  408  GIVEAMRFMETDTVAIIGPQASVIAHVISHLANELQVPLLSFAATDPTLSSLQYPFFVRT  587
            G VEAM  +E D VA +GPQ+S IAHVISH+ NEL VPLLSF ATDP+L++LQYP+FVRT
Sbjct  102  GTVEAMELIENDVVAAVGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRT  161

Query  588  SPNDLFXMAAVASIVDYYXWREVVA  662
            + +D F M AVA +V+Y+ WREV+A
Sbjct  162  TQSDYFQMYAVADLVEYFGWREVIA  186



>gb|KEH39010.1| glutamate receptor 3.2 [Medicago truncatula]
Length=698

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 125/172 (73%), Gaps = 1/172 (1%)
 Frame = +3

Query  150  LKMKGFWVVMFLTFYSGYVCEGV-NSTLSTRPDVVNIGCILTFISPIGkvakaaveaavd  326
            L +KGF ++ F  +    V   + NST+S+RP VV IG + T  S IG+ A+  ++ A+D
Sbjct  4    LGVKGFVLLFFCLWIPNEVVAIIGNSTVSSRPTVVKIGALFTVDSVIGRSAQQGIKTAID  63

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            DVN+N  +L G K++V   D+N SGF+G VEA++ ME + +A IGPQ+S IAH+I+H+AN
Sbjct  64   DVNANKTILPGIKMDVIFHDTNCSGFIGTVEALQLMENEVIATIGPQSSGIAHIIAHVAN  123

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            EL VPLLSF ATDPTLSSLQ+P+FVRT+ +D F M A+A IVD+  WR+V+A
Sbjct  124  ELHVPLLSFGATDPTLSSLQFPYFVRTTHSDYFQMYAIADIVDFCRWRQVIA  175



>ref|XP_008353536.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
 ref|XP_008353537.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
 ref|XP_008353538.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
Length=946

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 125/172 (73%), Gaps = 2/172 (1%)
 Frame = +3

Query  153  KMKGFWVVMFLTFYSGYVCEGV-NSTLST-RPDVVNIGCILTFISPIGkvakaaveaavd  326
            K +    ++F  + S  V  G  N+T S+ RP  +NIG + TF S IGK AK A+ AA++
Sbjct  15   KTRTLLALVFCMWVSMEVMAGTENATRSSARPSTLNIGALFTFNSVIGKAAKPAILAAIE  74

Query  327  dvNSNPDVLGGTKLNVTMLDSNSSGFLGIVEAMRFMETDTVAIIGPQASVIAHVISHLAN  506
            DVNS+  VL GTKLNV   D+N SGFLG VEA++ +E D VA IGPQ+S IAHVISH+ N
Sbjct  75   DVNSDQSVLHGTKLNVIFHDTNCSGFLGTVEALQLIENDVVAAIGPQSSGIAHVISHVVN  134

Query  507  ELQVPLLSFAATDPTLSSLQYPFFVRTSPNDLFXMAAVASIVDYYXWREVVA  662
            EL VPLLSF ATDP+L++LQYP+FVRT+ +D F M AVA +V+Y+ WREV+A
Sbjct  135  ELHVPLLSFGATDPSLAALQYPYFVRTTQSDYFQMYAVADLVEYFGWREVIA  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140